F461355

General Info

Members Datasets Scaffolds Average Seq Length
541 239 1082 312

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10231256|Ga0105245_102312561
Length 348
Sequence MTERPDDLSVMTTERPAPAPGAXPSAGERIDAAAAMAKAATLIEALPWLDRFHGQTVVIKYGGHAMTDGALQVAFAQDVVFLRYAGLRPVVVHGGGPQISAHLERLGVASTFTAGLRVTTPETMDVVRMVLTGQVNRDVVGLINRHGPFAVGMSGEDANLFTASSREALVNGELVDIGMVGEIDTVNPAALRALLADGRVPVVSSVARGAGGEIYNVNADTAAAALAVALGAAKLVVLTDVEGLYAGWDVGNTSPVQFPAPPGAKIRTGDQVPPSGDVISLLTAAELERLLPSLSAGMIPKMEACLRAVRGGVPQAHVLDGRLPHSVLLEIFTDSGIGTMVIPDGAHS

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
79 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
80 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
124 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
125 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
126 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
127 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
128 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
129 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
130 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
131 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
132 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
133 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
134 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
135 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
136 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
137 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
138 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
139 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
140 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
141 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
142 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
143 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
144 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
145 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
146 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
147 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
148 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
149 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
150 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
151 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
153 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
158 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
159 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
160 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
161 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
162 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
163 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
167 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
168 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
169 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
170 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
171 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
172 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
173 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
174 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
175 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
176 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
177 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
178 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
179 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
180 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
181 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
182 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
183 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
184 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
185 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
186 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
187 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
188 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
189 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
190 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
191 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
192 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
193 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
194 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
195 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
196 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
197 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
198 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
199 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
200 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
201 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
202 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
203 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
204 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
205 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
206 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
207 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
208 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
209 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
223 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
224 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
225 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
226 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
229 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
230 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
231 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
232 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
233 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
234 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
235 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
236 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
237 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
238 2952252522 Salinicola sp. DM10 Isolate Unclassified
239 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.71
Metatranscriptomes 0.74
Isolates 0.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.37
Nodule 0
Rhizoplane 5.36
Rhizosphere 90.57
Stem 0
Stem Tuber 0
Unclassified 0.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10231256 3300009098 Bacteria 1788
2 JGI25404J52841_10000428 3300003659 Bacteria 5897
3 Ga0070683_100046943 3300005329 Bacteria 3990
4 Ga0070683_100420167 3300005329 Bacteria 1275
5 Ga0070666_10084755 3300005335 Bacteria 2169
6 Ga0070680_100418385 3300005336 Bacteria 1143
7 Ga0070682_100138404 3300005337 Bacteria 1656
8 Ga0070682_100148572 3300005337 Bacteria 1605
9 Ga0070660_100132915 3300005339 Bacteria 1992
10 Ga0070689_100070299 3300005340 Bacteria 2733
11 Ga0070691_10042898 3300005341 Bacteria 2142
12 Ga0070687_100018820 3300005343 Bacteria 3203
13 Ga0070692_10016997 3300005345 Bacteria 3470
14 Ga0070692_10132306 3300005345 Bacteria 1403
15 Ga0070675_100081520 3300005354 Bacteria 2698
16 Ga0070675_100496705 3300005354 Bacteria 1099
17 Ga0070671_100425677 3300005355 Bacteria 1137
18 Ga0070673_100042230 3300005364 Bacteria 3514
19 Ga0070659_100085130 3300005366 Bacteria 2528
20 Ga0070709_10004370 3300005434 Bacteria 7620
21 Ga0070709_10023142 3300005434 Bacteria 3644
22 Ga0070709_10149567 3300005434 Bacteria 1612
23 Ga0070709_10150597 3300005434 Bacteria 1607
24 Ga0070714_100003148 3300005435 Bacteria 12250
25 Ga0070714_100008229 3300005435 Bacteria 8126
26 Ga0070714_100025661 3300005435 Bacteria 4865
27 Ga0070714_100033658 3300005435 Bacteria 4286
28 Ga0070714_100443420 3300005435 Bacteria 1232
29 Ga0070713_100001944 3300005436 Bacteria 13338
30 Ga0070713_100028762 3300005436 Bacteria 4392
31 Ga0070713_100107681 3300005436 Bacteria 2425
32 Ga0070713_100209683 3300005436 Bacteria 1763
33 Ga0070713_100282057 3300005436 Bacteria 1524
34 Ga0070710_10022576 3300005437 Bacteria 3293
35 Ga0070710_10056820 3300005437 Bacteria 2215
36 Ga0070710_10217413 3300005437 Bacteria 1214
37 Ga0070701_10163051 3300005438 Bacteria 1293
38 Ga0070711_100004625 3300005439 Bacteria 8147
39 Ga0070711_100100286 3300005439 Bacteria 2105
40 Ga0070711_100156358 3300005439 Bacteria 1724
41 Ga0070705_100110011 3300005440 Bacteria 1758
42 Ga0070694_100104575 3300005444 Bacteria 2008
43 Ga0070708_100001321 3300005445 Bacteria 19006
44 Ga0070708_100011075 3300005445 Bacteria 7327
45 Ga0070708_100151264 3300005445 Bacteria 2158
46 Ga0070708_100215666 3300005445 Bacteria 1799
47 Ga0070663_100017646 3300005455 Bacteria 4662
48 Ga0070678_100106179 3300005456 Bacteria 2188
49 Ga0070678_100450340 3300005456 Bacteria 1127
50 Ga0070706_100010073 3300005467 Bacteria 8782
51 Ga0070706_100019856 3300005467 Bacteria 6194
52 Ga0070706_100038525 3300005467 Bacteria 4412
53 Ga0070706_100048736 3300005467 Bacteria 3909
54 Ga0070706_100099861 3300005467 Bacteria 2696
55 Ga0070706_100100422 3300005467 Bacteria 2689
56 Ga0070706_100200802 3300005467 Bacteria 1862
57 Ga0070707_100002548 3300005468 Bacteria 17322
58 Ga0070707_100003790 3300005468 Bacteria 14265
59 Ga0070707_100005423 3300005468 Bacteria 11929
60 Ga0070707_100006002 3300005468 Bacteria 11335
61 Ga0070707_100016795 3300005468 Bacteria 6872
62 Ga0070707_100023427 3300005468 Bacteria 5841
63 Ga0070707_100039640 3300005468 Bacteria 4503
64 Ga0070707_100080947 3300005468 Bacteria 3135
65 Ga0070707_100112568 3300005468 Bacteria 2640
66 Ga0070707_100454357 3300005468 Bacteria 1242
67 Ga0070698_100002410 3300005471 Bacteria 20596
68 Ga0070698_100003145 3300005471 Bacteria 18190
69 Ga0070698_100006733 3300005471 Bacteria 12461
70 Ga0070698_100011096 3300005471 Bacteria 9575
71 Ga0070698_100020407 3300005471 Bacteria 6945
72 Ga0070698_100023236 3300005471 Bacteria 6481
73 Ga0070698_100033296 3300005471 Bacteria 5338
74 Ga0070698_100070398 3300005471 Bacteria 3510
75 Ga0070698_100099961 3300005471 Bacteria 2874
76 Ga0070698_100122018 3300005471 Bacteria 2565
77 Ga0070698_100163564 3300005471 Bacteria 2168
78 Ga0070698_100239724 3300005471 Bacteria 1747
79 Ga0070699_100002391 3300005518 Bacteria 16832
80 Ga0070679_100305092 3300005530 Bacteria 1542
81 Ga0070684_100067828 3300005535 Bacteria 3134
82 Ga0070697_100379993 3300005536 Bacteria 1223
83 Ga0070672_100063065 3300005543 Bacteria 2926
84 Ga0070696_100043433 3300005546 Bacteria 3109
85 Ga0070693_100173286 3300005547 Bacteria 1383
86 Ga0070665_100124868 3300005548 Bacteria 2576
87 Ga0070665_100169153 3300005548 Bacteria 2187
88 Ga0070704_100036453 3300005549 Bacteria 3352
89 Ga0070664_100113787 3300005564 Bacteria 2363
90 Ga0068857_100036053 3300005577 Bacteria 4382
91 Ga0068857_100061525 3300005577 Bacteria 3335
92 Ga0068857_100141281 3300005577 Bacteria 2176
93 Ga0068857_100272144 3300005577 Bacteria 1557
94 Ga0068856_100031138 3300005614 Bacteria 5218
95 Ga0068852_100036110 3300005616 Bacteria 4131
96 Ga0068859_100052720 3300005617 Bacteria 4090
97 Ga0068859_100347343 3300005617 Bacteria 1578
98 Ga0068864_100015009 3300005618 Bacteria 6438
99 Ga0068870_10019155 3300005840 Bacteria 3315
100 Ga0068863_100112936 3300005841 Bacteria 2587
101 Ga0068863_100313706 3300005841 Bacteria 1522
102 Ga0068863_100317971 3300005841 Bacteria 1512
103 Ga0068858_100009136 3300005842 Bacteria 9478
104 Ga0081540_1000482 3300005983 Bacteria 39035
105 Ga0081540_1001691 3300005983 Bacteria 18722
106 Ga0081540_1064289 3300005983 Bacteria 1732
107 Ga0070717_10028305 3300006028 Bacteria 4484
108 Ga0070717_10038412 3300006028 Bacteria 3891
109 Ga0070717_10050155 3300006028 Bacteria 3428
110 Ga0070717_10064579 3300006028 Bacteria 3040
111 Ga0070717_10095049 3300006028 Bacteria 2522
112 Ga0070717_10158294 3300006028 Bacteria 1963
113 Ga0070715_10022767 3300006163 Bacteria 2446
114 Ga0070716_100001032 3300006173 Bacteria 12191
115 Ga0070716_100094536 3300006173 Bacteria 1817
116 Ga0070712_100012303 3300006175 Bacteria 5438
117 Ga0070712_100075469 3300006175 Bacteria 2424
118 Ga0097621_100088338 3300006237 Bacteria 2590
119 Ga0068871_100022180 3300006358 Bacteria 4895
120 Ga0068871_100263334 3300006358 Bacteria 1504
121 Ga0075428_100056077 3300006844 Bacteria 4317
122 Ga0075433_10031965 3300006852 Bacteria 4504
123 Ga0075433_10225130 3300006852 Bacteria 1666
124 Ga0075434_100054553 3300006871 Bacteria 3970
125 Ga0075436_100016089 3300006914 Bacteria 5120
126 Ga0097620_100052718 3300006931 Bacteria 4090
127 Ga0097620_100347347 3300006931 Bacteria 1578
128 Ga0075435_100087119 3300007076 Bacteria 2572
129 Ga0075435_100159016 3300007076 Bacteria 1902
130 Ga0111539_10076861 3300009094 Bacteria 3931
131 Ga0105245_10474327 3300009098 Bacteria 1263
132 Ga0114129_10006158 3300009147 Bacteria 17018
133 Ga0105241_10324512 3300009174 Bacteria 1329
134 Ga0105242_10283879 3300009176 Bacteria 1505
135 Ga0105248_10636373 3300009177 Bacteria 1203
136 Ga0105239_10123016 3300010375 Bacteria 2883
137 Ga0105246_10253373 3300011119 Bacteria 1398
138 Ga0157338_1000629 3300012515 Bacteria 2176
139 Ga0157373_10060641 3300013100 Bacteria 2680
140 Ga0157371_10193225 3300013102 Bacteria 1458
141 Ga0157374_10025728 3300013296 Bacteria 5288
142 Ga0157374_10176944 3300013296 Bacteria 2083
143 Ga0157372_10053685 3300013307 Bacteria 4493
144 Ga0157372_10581879 3300013307 Bacteria 1305
145 Ga0163163_10024696 3300014325 Bacteria 5723
146 Ga0163163_10215316 3300014325 Bacteria 1970
147 Ga0163163_10810952 3300014325 Bacteria 999
148 Ga0157379_10031817 3300014968 Bacteria 4700
149 Ga0157376_10147707 3300014969 Bacteria 2116
150 Ga0206351_10452047 3300020077 Bacteria 2746
151 Ga0206353_10603764 3300020082 Bacteria 3634
152 Ga0213874_10052959 3300021377 Bacteria 1251
153 Ga0213875_10037325 3300021388 Bacteria 2289
154 Ga0213875_10064339 3300021388 Bacteria 1714
155 Ga0224712_10005013 3300022467 Bacteria 3640
156 Ga0224712_10038133 3300022467 Bacteria 1793
157 Ga0207653_10001877 3300025885 Bacteria 6729
158 Ga0207692_10001699 3300025898 Bacteria 8322
159 Ga0207692_10008501 3300025898 Bacteria 4249
160 Ga0207692_10017794 3300025898 Bacteria 3176
161 Ga0207692_10185421 3300025898 Unclassified 1215
162 Ga0207688_10005145 3300025901 Bacteria 7108
163 Ga0207647_10021255 3300025904 Bacteria 4334
164 Ga0207647_10064904 3300025904 Bacteria 2217
165 Ga0207685_10010212 3300025905 Bacteria 2762
166 Ga0207685_10037656 3300025905 Bacteria 1783
167 Ga0207685_10086147 3300025905 Bacteria 1312
168 Ga0207699_10010365 3300025906 Bacteria 4676
169 Ga0207699_10019488 3300025906 Bacteria 3619
170 Ga0207699_10129059 3300025906 Bacteria 1646
171 Ga0207643_10006984 3300025908 Bacteria 6053
172 Ga0207684_10005597 3300025910 Bacteria 11563
173 Ga0207684_10007500 3300025910 Bacteria 9818
174 Ga0207684_10008418 3300025910 Bacteria 9173
175 Ga0207684_10011027 3300025910 Bacteria 7921
176 Ga0207684_10034343 3300025910 Bacteria 4310
177 Ga0207684_10067155 3300025910 Bacteria 3047
178 Ga0207684_10154297 3300025910 Bacteria 1976
179 Ga0207695_10376936 3300025913 Bacteria 1305
180 Ga0207693_10004160 3300025915 Bacteria 12277
181 Ga0207693_10027363 3300025915 Bacteria 4509
182 Ga0207693_10055308 3300025915 Bacteria 3114
183 Ga0207663_10012829 3300025916 Bacteria 4540
184 Ga0207663_10103165 3300025916 Bacteria 1920
185 Ga0207663_10144150 3300025916 Bacteria 1663
186 Ga0207663_10313764 3300025916 Bacteria 1176
187 Ga0207660_10042047 3300025917 Bacteria 3206
188 Ga0207662_10007665 3300025918 Bacteria 5882
189 Ga0207657_10031939 3300025919 Bacteria 4762
190 Ga0207649_10025038 3300025920 Bacteria 3474
191 Ga0207646_10004909 3300025922 Bacteria 14315
192 Ga0207646_10005894 3300025922 Bacteria 12792
193 Ga0207646_10006662 3300025922 Bacteria 11906
194 Ga0207646_10009294 3300025922 Bacteria 9724
195 Ga0207646_10015315 3300025922 Bacteria 7245
196 Ga0207646_10046696 3300025922 Bacteria 3885
197 Ga0207646_10054076 3300025922 Bacteria 3592
198 Ga0207646_10119988 3300025922 Bacteria 2362
199 Ga0207646_10148377 3300025922 Bacteria 2114
200 Ga0207687_10187374 3300025927 Bacteria 1608
201 Ga0207700_10004533 3300025928 Bacteria 8207
202 Ga0207700_10004934 3300025928 Bacteria 7926
203 Ga0207700_10026860 3300025928 Bacteria 4021
204 Ga0207700_10051269 3300025928 Bacteria 3079
205 Ga0207700_10111234 3300025928 Bacteria 2204
206 Ga0207664_10003992 3300025929 Bacteria 9941
207 Ga0207664_10014724 3300025929 Bacteria 5659
208 Ga0207664_10059961 3300025929 Bacteria 3032
209 Ga0207664_10060809 3300025929 Bacteria 3012
210 Ga0207664_10135289 3300025929 Bacteria 2079
211 Ga0207664_10186362 3300025929 Bacteria 1784
212 Ga0207706_10102206 3300025933 Bacteria 2522
213 Ga0207709_10079828 3300025935 Bacteria 2105
214 Ga0207665_10001654 3300025939 Bacteria 14998
215 Ga0207665_10008156 3300025939 Bacteria 6912
216 Ga0207665_10023538 3300025939 Bacteria 4057
217 Ga0207689_10429962 3300025942 Bacteria 1102
218 Ga0207661_10103124 3300025944 Bacteria 2400
219 Ga0207661_10198187 3300025944 Bacteria 1764
220 Ga0207679_10254696 3300025945 Bacteria 1494
221 Ga0207667_10085629 3300025949 Bacteria 3262
222 Ga0207640_10213731 3300025981 Bacteria 1471
223 Ga0207677_10055807 3300026023 Bacteria 2703
224 Ga0207703_10165891 3300026035 Bacteria 1938
225 Ga0207639_10239645 3300026041 Bacteria 1576
226 Ga0207678_10008267 3300026067 Bacteria 9167
227 Ga0207678_10051097 3300026067 Bacteria 3569
228 Ga0207708_10025728 3300026075 Bacteria 4453
229 Ga0207702_10012019 3300026078 Bacteria 7196
230 Ga0207702_10065968 3300026078 Bacteria 3101
231 Ga0207702_10203548 3300026078 Bacteria 1836
232 Ga0207641_10094080 3300026088 Bacteria 2627
233 Ga0207676_10095280 3300026095 Bacteria 2454
234 Ga0207676_10240568 3300026095 Bacteria 1623
235 Ga0207674_10014112 3300026116 Bacteria 8826
236 Ga0207674_10022371 3300026116 Bacteria 6788
237 Ga0207674_10072427 3300026116 Bacteria 3461
238 Ga0207674_10172525 3300026116 Bacteria 2116
239 Ga0207675_100127680 3300026118 Bacteria 2410
240 Ga0207683_10002402 3300026121 Bacteria 16354
241 Ga0207683_10134557 3300026121 Bacteria 2225
242 Ga0207698_10114326 3300026142 Bacteria 2270
243 Ga0268266_10216734 3300028379 Bacteria 1758
244 Ga0268265_10225159 3300028380 Bacteria 1644
245 Ga0268264_10199989 3300028381 Bacteria 1827
246 Ga0265338_10010976 3300028800 Bacteria 10527
247 Ga0265327_10000002 3300031251 Bacteria 856593
248 Ga0307514_10032764 3300031649 Bacteria 4154
249 Ga0316214_1004955 3300033545 Bacteria 1732
250 Ga0373950_0003774 3300034818 Bacteria 2191
251 Ga0373926_0000769 3300035083 Bacteria 8984
252 Ga0373926_0004257 3300035083 Bacteria 4679
253 Ga0373926_0032598 3300035083 Bacteria 1838
254 Ga0373928_0001819 3300035084 Bacteria 4153
255 Ga0373934_0000014 3300035086 Bacteria 59312
256 Ga0373934_0036173 3300035086 Bacteria 1944
257 Ga0373934_0056540 3300035086 Bacteria 1560
258 Ga0373944_0003453 3300035089 Bacteria 4081
259 Ga0373949_0052615 3300035090 Bacteria 1029
260 Ga0373951_0011505 3300035091 Bacteria 1987
261 Ga0373952_0025042 3300035092 Bacteria 1286
262 Ga0373923_0019802 3300035111 Bacteria 2609
263 Ga0373923_0024262 3300035111 Bacteria 2392
264 Ga0373923_0032696 3300035111 Bacteria 2102
265 Ga0373936_0000318 3300035113 Bacteria 16313
266 Ga0373936_0001017 3300035113 Bacteria 10032
267 Ga0373939_0011548 3300035114 Bacteria 2232
268 Ga0373939_0013090 3300035114 Bacteria 2127
269 Ga0373941_0074435 3300035115 Bacteria 1134
270 Ga0373945_0007321 3300035116 Bacteria 3576
271 Ga0373945_0025943 3300035116 Bacteria 2039
272 Ga0373953_0021810 3300035117 Bacteria 2408
273 Ga0373954_0001669 3300035118 Bacteria 9091
274 Ga0373954_0086185 3300035118 Bacteria 1504
275 Ga0373956_0001414 3300035119 Bacteria 9923
276 Ga0373956_0011982 3300035119 Bacteria 3583
277 Ga0373957_0000846 3300035120 Bacteria 8012
278 Ga0373957_0001048 3300035120 Bacteria 7302
279 Ga0373960_0023666 3300035121 Bacteria 1655
280 Ga0373943_0001163 3300035170 Bacteria 11749
281 Ga0373943_0029831 3300035170 Bacteria 2578
282 Ga0373946_0000854 3300035171 Bacteria 10462
283 Ga0373955_0000040 3300035172 Bacteria 51762
284 Ga0373955_0011729 3300035172 Bacteria 4188
285 Ga0373955_0041740 3300035172 Bacteria 2460
286 Ga0373955_0081418 3300035172 Bacteria 1830
287 Ga0373955_0100786 3300035172 Bacteria 1657
288 Ga0316574_0030341 3300035398 Bacteria 3274
289 Ga0373924_0001593 3300035410 Bacteria 7428
290 Ga0373924_0008048 3300035410 Bacteria 3817
291 Ga0373924_0013588 3300035410 Bacteria 3061
292 Ga0373924_0020879 3300035410 Bacteria 2549
293 Ga0373924_0044694 3300035410 Bacteria 1820
294 Ga0373931_0068707 3300035691 Bacteria 1929
295 Ga0373931_0249594 3300035691 Bacteria 1078
296 Ga0373935_0001435 3300035692 Bacteria 13201
297 Ga0373935_0007682 3300035692 Bacteria 6462
298 Ga0373935_0057875 3300035692 Bacteria 2474
299 Ga0373927_0007896 3300035695 Bacteria 7190
300 Ga0373927_0017804 3300035695 Bacteria 4673
301 Ga0373933_0000085 3300035724 Bacteria 59115
302 Ga0373933_0001065 3300035724 Bacteria 16563
303 Ga0373933_0015798 3300035724 Bacteria 4212
304 Ga0373947_0000195 3300035725 Bacteria 33609
305 Ga0373947_0001660 3300035725 Bacteria 13615
306 Ga0373947_0024976 3300035725 Bacteria 3484
307 Ga0373947_0071496 3300035725 Bacteria 2128
308 Ga0373937_0000197 3300036401 Bacteria 59124
309 Ga0373937_0009525 3300036401 Bacteria 8446
310 Ga0373937_0121009 3300036401 Bacteria 2439
311 Ga0373937_0135583 3300036401 Bacteria 2301
312 Ga0373937_0199148 3300036401 Bacteria 1882
313 Ga0373925_0010016 3300037068 Bacteria 6883
314 Ga0373925_0054711 3300037068 Bacteria 2985
315 Ga0373925_0055604 3300037068 Bacteria 2963
316 Ga0373925_0162505 3300037068 Bacteria 1760
317 Ga0436364_0512295 3300037853 Bacteria 4135
318 Ga0436364_0815007 3300037853 Bacteria 996
319 Ga0436364_0827727 3300037853 Bacteria 9422
320 Ga0436364_1476981 3300037853 Bacteria 1852
321 Ga0436364_1494074 3300037853 Bacteria 1609
322 Ga0436364_1532326 3300037853 Bacteria 2694
323 Ga0436365_1146832 3300039437 Bacteria 2582
324 Ga0436363_0591387 3300039450 Bacteria 2644
325 Ga0436363_0909015 3300039450 Bacteria 1959
326 Ga0436363_1171857 3300039450 Bacteria 1303
327 Ga0436363_1432609 3300039450 Bacteria 2234
328 Ga0451577_0000281 3300042876 Bacteria 98760
329 Ga0451577_0000624 3300042876 Bacteria 56728
330 Ga0451577_0004925 3300042876 Bacteria 13901
331 Ga0451577_0021965 3300042876 Bacteria 5832
332 Ga0466969_0027480 3300044656 Bacteria 2913
333 Ga0466969_0100857 3300044656 Bacteria 1359
334 Ga0453684_0000208 3300044712 Bacteria 255911
335 Ga0453684_0001802 3300044712 Bacteria 56876
336 Ga0453684_0004345 3300044712 Bacteria 30108
337 Ga0453684_0027681 3300044712 Bacteria 8116
338 Ga0453684_0309139 3300044712 Bacteria 1794
339 Ga0466968_0045767 3300044735 Bacteria 1858
340 Ga0451576_0000989 3300045051 Bacteria 52600
341 Ga0451576_0086838 3300045051 Bacteria 3254
342 Ga0451576_0107788 3300045051 Bacteria 2899
343 Ga0466967_0011053 3300045976 Bacteria 6813
344 Ga0466967_0184913 3300045976 Bacteria 1967
345 Ga0495592_0000157 3300046454 Bacteria 59697
346 Ga0495592_0005544 3300046454 Bacteria 9333
347 Ga0495592_0031560 3300046454 Bacteria 4003
348 Ga0495592_0123670 3300046454 Bacteria 1817
349 Ga0495592_0158304 3300046454 Bacteria 1560
350 Ga0495629_0001111 3300046459 Bacteria 21303
351 Ga0495629_0004740 3300046459 Bacteria 10187
352 Ga0495629_0021855 3300046459 Bacteria 4565
353 Ga0495641_0019547 3300046461 Bacteria 3462
354 Ga0495641_0021312 3300046461 Bacteria 3262
355 Ga0495641_0051379 3300046461 Bacteria 1882
356 Ga0495651_0000115 3300046462 Bacteria 59129
357 Ga0495651_0006915 3300046462 Bacteria 8672
358 Ga0495651_0091444 3300046462 Bacteria 2281
359 Ga0495653_0008374 3300046463 Bacteria 8476
360 Ga0495653_0011549 3300046463 Bacteria 7210
361 Ga0495653_0039902 3300046463 Bacteria 3674
362 Ga0495653_0049401 3300046463 Bacteria 3240
363 Ga0495650_0000702 3300046471 Bacteria 42949
364 Ga0495580_0009545 3300046472 Bacteria 7625
365 Ga0495582_0003495 3300046473 Bacteria 8852
366 Ga0495639_0011515 3300046475 Bacteria 3814
367 Ga0495639_0020494 3300046475 Bacteria 2889
368 Ga0495662_0004916 3300046476 Bacteria 6694
369 Ga0495662_0006776 3300046476 Bacteria 5702
370 Ga0495662_0011770 3300046476 Bacteria 4276
371 Ga0495662_0015349 3300046476 Bacteria 3720
372 Ga0495664_0000083 3300046477 Bacteria 46009
373 Ga0495664_0011596 3300046477 Bacteria 4971
374 Ga0495664_0106272 3300046477 Bacteria 1692
375 Ga0495608_0003716 3300046511 Bacteria 10963
376 Ga0495608_0099593 3300046511 Bacteria 1874
377 Ga0495618_0025434 3300046514 Bacteria 3674
378 Ga0495618_0078629 3300046514 Bacteria 2102
379 Ga0495628_0000492 3300046516 Bacteria 36145
380 Ga0495628_0051709 3300046516 Bacteria 3247
381 Ga0495628_0062383 3300046516 Bacteria 2921
382 Ga0495628_0150127 3300046516 Bacteria 1775
383 Ga0495628_0227142 3300046516 Bacteria 1400
384 Ga0495630_0000391 3300046517 Bacteria 34434
385 Ga0495630_0013544 3300046517 Bacteria 5930
386 Ga0495630_0028700 3300046517 Bacteria 4134
387 Ga0495630_0070482 3300046517 Bacteria 2630
388 Ga0495666_0037181 3300046526 Bacteria 2368
389 Ga0495652_0007274 3300046529 Bacteria 10216
390 Ga0495652_0084359 3300046529 Bacteria 2612
391 Ga0495652_0094347 3300046529 Bacteria 2440
392 Ga0495652_0122306 3300046529 Bacteria 2073
393 Ga0495665_0001781 3300046531 Bacteria 11589
394 Ga0495665_0005180 3300046531 Bacteria 7028
395 Ga0495665_0010032 3300046531 Bacteria 5132
396 Ga0495665_0012503 3300046531 Bacteria 4593
397 Ga0495665_0048761 3300046531 Bacteria 2245
398 Ga0495640_0027454 3300046533 Bacteria 4105
399 Ga0495640_0060857 3300046533 Bacteria 2567
400 Ga0495586_0000017 3300046535 Bacteria 116426
401 Ga0495586_0097242 3300046535 Bacteria 1631
402 Ga0495587_0000123 3300046536 Bacteria 59101
403 Ga0495587_0022691 3300046536 Bacteria 3861
404 Ga0495587_0039198 3300046536 Bacteria 2837
405 Ga0495587_0045533 3300046536 Bacteria 2607
406 Ga0495587_0046448 3300046536 Bacteria 2578
407 Ga0495667_0000107 3300046559 Bacteria 60366
408 Ga0495667_0037068 3300046559 Bacteria 3251
409 Ga0495667_0139649 3300046559 Bacteria 1561
410 Ga0495634_0006493 3300046642 Bacteria 8884
411 Ga0495634_0008416 3300046642 Bacteria 7684
412 Ga0495634_0063148 3300046642 Bacteria 2458
413 Ga0495634_0063192 3300046642 Bacteria 2457
414 Ga0495635_0021289 3300046663 Bacteria 4519
415 Ga0495635_0022242 3300046663 Bacteria 4415
416 Ga0495635_0023794 3300046663 Bacteria 4268
417 Ga0495635_0153349 3300046663 Bacteria 1568
418 Ga0495588_0015215 3300046674 Bacteria 3698
419 Ga0495657_0000169 3300046675 Bacteria 59112
420 Ga0495657_0011577 3300046675 Bacteria 6591
421 Ga0495657_0024576 3300046675 Bacteria 4289
422 Ga0495657_0119927 3300046675 Bacteria 1657
423 Ga0495657_0125026 3300046675 Bacteria 1616
424 Ga0495599_0002521 3300046678 Bacteria 10653
425 Ga0495599_0009772 3300046678 Bacteria 5873
426 Ga0495599_0015968 3300046678 Bacteria 4660
427 Ga0495599_0041562 3300046678 Bacteria 2886
428 Ga0495623_0000166 3300046679 Bacteria 41152
429 Ga0495623_0022038 3300046679 Bacteria 4115
430 Ga0495623_0044798 3300046679 Bacteria 2811
431 Ga0495623_0059050 3300046679 Bacteria 2410
432 Ga0495623_0114892 3300046679 Bacteria 1627
433 Ga0495646_0064908 3300046680 Bacteria 2162
434 Ga0495647_0056369 3300046681 Bacteria 1540
435 Ga0495647_0091225 3300046681 Bacteria 1249
436 Ga0495647_0143335 3300046681 Bacteria 1020
437 Ga0495658_0008068 3300046683 Bacteria 5214
438 Ga0495658_0008508 3300046683 Bacteria 5086
439 Ga0495658_0015102 3300046683 Bacteria 3958
440 Ga0495658_0037374 3300046683 Bacteria 2683
441 Ga0495613_0074147 3300046689 Bacteria 2478
442 Ga0495624_0018405 3300046690 Bacteria 4672
443 Ga0495624_0082209 3300046690 Bacteria 1993
444 Ga0495600_0003759 3300046809 Bacteria 8983
445 Ga0495600_0014405 3300046809 Bacteria 4983
446 Ga0495600_0051992 3300046809 Bacteria 2674
447 Ga0495600_0063965 3300046809 Bacteria 2404
448 Ga0495600_0079322 3300046809 Bacteria 2143
449 Ga0495600_0109288 3300046809 Bacteria 1800
450 Ga0495600_0233835 3300046809 Bacteria 1172
451 Ga0495604_0000161 3300047317 Bacteria 59093
452 Ga0495604_0041992 3300047317 Bacteria 3586
453 Ga0495604_0083431 3300047317 Bacteria 2388
454 Ga0495604_0095515 3300047317 Bacteria 2195
455 Ga0495604_0149191 3300047317 Bacteria 1663
456 Ga0495674_0000793 3300047319 Bacteria 29978
457 Ga0495674_0053530 3300047319 Bacteria 3547
458 Ga0495674_0076848 3300047319 Bacteria 2871
459 Ga0495674_0094089 3300047319 Bacteria 2556
460 Ga0495674_0176445 3300047319 Bacteria 1780
461 Ga0495676_0007860 3300047321 Bacteria 9781
462 Ga0495676_0048227 3300047321 Bacteria 3436
463 Ga0495676_0112969 3300047321 Bacteria 1989
464 Ga0495680_0004695 3300047322 Bacteria 13009
465 Ga0495680_0007013 3300047322 Bacteria 10389
466 Ga0495680_0012025 3300047322 Bacteria 7636
467 Ga0495680_0046838 3300047322 Bacteria 3406
468 Ga0495680_0073385 3300047322 Bacteria 2600
469 Ga0495680_0101886 3300047322 Bacteria 2138
470 Ga0495675_0001882 3300047444 Bacteria 12503
471 Ga0495675_0002978 3300047444 Bacteria 10167
472 Ga0495675_0011417 3300047444 Bacteria 5576
473 Ga0495675_0062122 3300047444 Bacteria 2365
474 Ga0495675_0099075 3300047444 Bacteria 1825
475 Ga0495684_0006983 3300047471 Bacteria 8768
476 Ga0495684_0023133 3300047471 Bacteria 4778
477 Ga0495684_0027242 3300047471 Bacteria 4388
478 Ga0495684_0028792 3300047471 Bacteria 4264
479 Ga0495684_0041727 3300047471 Bacteria 3515
480 Ga0495684_0105372 3300047471 Bacteria 2130
481 Ga0495593_0010787 3300047673 Bacteria 5266
482 Ga0495593_0013233 3300047673 Bacteria 4709
483 Ga0495593_0037458 3300047673 Bacteria 2623
484 Ga0495593_0098039 3300047673 Bacteria 1505
485 Ga0495602_0000182 3300048088 Bacteria 59124
486 Ga0495602_0034352 3300048088 Bacteria 4744
487 Ga0495602_0049715 3300048088 Bacteria 3753
488 Ga0495602_0144561 3300048088 Bacteria 1878
489 Ga0495614_0018877 3300048089 Bacteria 2986
490 Ga0495614_0022086 3300048089 Bacteria 2747
491 Ga0495614_0029133 3300048089 Bacteria 2377
492 Ga0496100_0145049 3300048903 Bacteria 1687
493 Ga0496102_0023585 3300048905 Bacteria 5467
494 Ga0496102_0068395 3300048905 Bacteria 3258
495 Ga0496102_0100366 3300048905 Bacteria 2688
496 Ga0496104_0155863 3300048907 Bacteria 2191
497 Ga0496104_0225644 3300048907 Bacteria 1785
498 Ga0496105_0006278 3300048908 Bacteria 9127
499 Ga0496105_0161982 3300048908 Bacteria 1836
500 Ga0496106_0064013 3300048909 Bacteria 2797
501 Ga0496106_0141542 3300048909 Bacteria 1892
502 Ga0496106_0544345 3300048909 Bacteria 931
503 Ga0496107_0077237 3300048910 Bacteria 2425
504 Ga0496107_0081268 3300048910 Bacteria 2363
505 Ga0496108_0082178 3300048911 Bacteria 2731
506 Ga0496109_0012022 3300048912 Bacteria 7455
507 Ga0496109_0020253 3300048912 Bacteria 5875
508 Ga0496109_0020914 3300048912 Bacteria 5784
509 Ga0496110_0010081 3300048913 Bacteria 7671
510 Ga0496110_0067176 3300048913 Bacteria 3172
511 Ga0496110_0089330 3300048913 Bacteria 2754
512 Ga0496111_0012745 3300048914 Bacteria 5700
513 Ga0496112_0065017 3300048915 Bacteria 3600
514 Ga0496112_0338774 3300048915 Bacteria 1447
515 Ga0496113_0147307 3300048916 Bacteria 1855
516 Ga0496113_0324870 3300048916 Bacteria 1233
517 Ga0496114_0041659 3300048917 Bacteria 3806
518 Ga0496114_0126481 3300048917 Bacteria 2204
519 Ga0496114_0136353 3300048917 Bacteria 2122
520 Ga0496115_0351770 3300048918 Bacteria 1201
521 Ga0496119_0012424 3300048922 Bacteria 6917
522 Ga0496120_0010579 3300048923 Bacteria 6421
523 Ga0501042_0091948 3300049578 Bacteria 2178
524 nmdc:mga05p37_11899_c1 3300050507 Bacteria 10376
525 nmdc:mga08y16_833455_c1 3300050511 Bacteria 913
526 nmdc:mga0n895_11040_c1 3300050512 Bacteria 8032
527 nmdc:mga08x19_6450_c1 3300050514 Bacteria 6947
528 nmdc:mga0a205_62127_c1 3300050515 Bacteria 3609
529 Ga0495601_0066059 3300053077 Bacteria 2302
530 Ga0495612_0012216 3300053078 Bacteria 3462
531 Ga0495612_0019329 3300053078 Bacteria 2728
532 Ga0495595_0002459 3300053084 Bacteria 7246
533 Ga0495595_0008455 3300053084 Bacteria 4224
534 Ga0495595_0019541 3300053084 Bacteria 2940
535 Ga0495619_0000784 3300053085 Bacteria 20817
536 Ga0495619_0089155 3300053085 Bacteria 2086
537 Ga0500651_0001689 3300053093 Bacteria 11274
538 Ga0500620_000139 3300053155 Bacteria 14617
539 2687580482 2687453129 Bacteria 4387428
540 2952254095 2952252522 Bacteria 4171745
541 8057163295 8057160832 Bacteria 3268302
542 Ga0105245_10231256
543 JGI25404J52841_10000428
544 Ga0070683_100046943
545 Ga0070683_100420167
546 Ga0070666_10084755
547 Ga0070680_100418385
548 Ga0070682_100138404
549 Ga0070682_100148572
550 Ga0070660_100132915
551 Ga0070689_100070299
552 Ga0070691_10042898
553 Ga0070687_100018820
554 Ga0070692_10016997
555 Ga0070692_10132306
556 Ga0070675_100081520
557 Ga0070675_100496705
558 Ga0070671_100425677
559 Ga0070673_100042230
560 Ga0070659_100085130
561 Ga0070709_10004370
562 Ga0070709_10023142
563 Ga0070709_10149567
564 Ga0070709_10150597
565 Ga0070714_100003148
566 Ga0070714_100008229
567 Ga0070714_100025661
568 Ga0070714_100033658
569 Ga0070714_100443420
570 Ga0070713_100001944
571 Ga0070713_100028762
572 Ga0070713_100107681
573 Ga0070713_100209683
574 Ga0070713_100282057
575 Ga0070710_10022576
576 Ga0070710_10056820
577 Ga0070710_10217413
578 Ga0070701_10163051
579 Ga0070711_100004625
580 Ga0070711_100100286
581 Ga0070711_100156358
582 Ga0070705_100110011
583 Ga0070694_100104575
584 Ga0070708_100001321
585 Ga0070708_100011075
586 Ga0070708_100151264
587 Ga0070708_100215666
588 Ga0070663_100017646
589 Ga0070678_100106179
590 Ga0070678_100450340
591 Ga0070706_100010073
592 Ga0070706_100019856
593 Ga0070706_100038525
594 Ga0070706_100048736
595 Ga0070706_100099861
596 Ga0070706_100100422
597 Ga0070706_100200802
598 Ga0070707_100002548
599 Ga0070707_100003790
600 Ga0070707_100005423
601 Ga0070707_100006002
602 Ga0070707_100016795
603 Ga0070707_100023427
604 Ga0070707_100039640
605 Ga0070707_100080947
606 Ga0070707_100112568
607 Ga0070707_100454357
608 Ga0070698_100002410
609 Ga0070698_100003145
610 Ga0070698_100006733
611 Ga0070698_100011096
612 Ga0070698_100020407
613 Ga0070698_100023236
614 Ga0070698_100033296
615 Ga0070698_100070398
616 Ga0070698_100099961
617 Ga0070698_100122018
618 Ga0070698_100163564
619 Ga0070698_100239724
620 Ga0070699_100002391
621 Ga0070679_100305092
622 Ga0070684_100067828
623 Ga0070697_100379993
624 Ga0070672_100063065
625 Ga0070696_100043433
626 Ga0070693_100173286
627 Ga0070665_100124868
628 Ga0070665_100169153
629 Ga0070704_100036453
630 Ga0070664_100113787
631 Ga0068857_100036053
632 Ga0068857_100061525
633 Ga0068857_100141281
634 Ga0068857_100272144
635 Ga0068856_100031138
636 Ga0068852_100036110
637 Ga0068859_100052720
638 Ga0068859_100347343
639 Ga0068864_100015009
640 Ga0068870_10019155
641 Ga0068863_100112936
642 Ga0068863_100313706
643 Ga0068863_100317971
644 Ga0068858_100009136
645 Ga0081540_1000482
646 Ga0081540_1001691
647 Ga0081540_1064289
648 Ga0070717_10028305
649 Ga0070717_10038412
650 Ga0070717_10050155
651 Ga0070717_10064579
652 Ga0070717_10095049
653 Ga0070717_10158294
654 Ga0070715_10022767
655 Ga0070716_100001032
656 Ga0070716_100094536
657 Ga0070712_100012303
658 Ga0070712_100075469
659 Ga0097621_100088338
660 Ga0068871_100022180
661 Ga0068871_100263334
662 Ga0075428_100056077
663 Ga0075433_10031965
664 Ga0075433_10225130
665 Ga0075434_100054553
666 Ga0075436_100016089
667 Ga0097620_100052718
668 Ga0097620_100347347
669 Ga0075435_100087119
670 Ga0075435_100159016
671 Ga0111539_10076861
672 Ga0105245_10474327
673 Ga0114129_10006158
674 Ga0105241_10324512
675 Ga0105242_10283879
676 Ga0105248_10636373
677 Ga0105239_10123016
678 Ga0105246_10253373
679 Ga0157338_1000629
680 Ga0157373_10060641
681 Ga0157371_10193225
682 Ga0157374_10025728
683 Ga0157374_10176944
684 Ga0157372_10053685
685 Ga0157372_10581879
686 Ga0163163_10024696
687 Ga0163163_10215316
688 Ga0163163_10810952
689 Ga0157379_10031817
690 Ga0157376_10147707
691 Ga0206351_10452047
692 Ga0206353_10603764
693 Ga0213874_10052959
694 Ga0213875_10037325
695 Ga0213875_10064339
696 Ga0224712_10005013
697 Ga0224712_10038133
698 Ga0207653_10001877
699 Ga0207692_10001699
700 Ga0207692_10008501
701 Ga0207692_10017794
702 Ga0207692_10185421
703 Ga0207688_10005145
704 Ga0207647_10021255
705 Ga0207647_10064904
706 Ga0207685_10010212
707 Ga0207685_10037656
708 Ga0207685_10086147
709 Ga0207699_10010365
710 Ga0207699_10019488
711 Ga0207699_10129059
712 Ga0207643_10006984
713 Ga0207684_10005597
714 Ga0207684_10007500
715 Ga0207684_10008418
716 Ga0207684_10011027
717 Ga0207684_10034343
718 Ga0207684_10067155
719 Ga0207684_10154297
720 Ga0207695_10376936
721 Ga0207693_10004160
722 Ga0207693_10027363
723 Ga0207693_10055308
724 Ga0207663_10012829
725 Ga0207663_10103165
726 Ga0207663_10144150
727 Ga0207663_10313764
728 Ga0207660_10042047
729 Ga0207662_10007665
730 Ga0207657_10031939
731 Ga0207649_10025038
732 Ga0207646_10004909
733 Ga0207646_10005894
734 Ga0207646_10006662
735 Ga0207646_10009294
736 Ga0207646_10015315
737 Ga0207646_10046696
738 Ga0207646_10054076
739 Ga0207646_10119988
740 Ga0207646_10148377
741 Ga0207687_10187374
742 Ga0207700_10004533
743 Ga0207700_10004934
744 Ga0207700_10026860
745 Ga0207700_10051269
746 Ga0207700_10111234
747 Ga0207664_10003992
748 Ga0207664_10014724
749 Ga0207664_10059961
750 Ga0207664_10060809
751 Ga0207664_10135289
752 Ga0207664_10186362
753 Ga0207706_10102206
754 Ga0207709_10079828
755 Ga0207665_10001654
756 Ga0207665_10008156
757 Ga0207665_10023538
758 Ga0207689_10429962
759 Ga0207661_10103124
760 Ga0207661_10198187
761 Ga0207679_10254696
762 Ga0207667_10085629
763 Ga0207640_10213731
764 Ga0207677_10055807
765 Ga0207703_10165891
766 Ga0207639_10239645
767 Ga0207678_10008267
768 Ga0207678_10051097
769 Ga0207708_10025728
770 Ga0207702_10012019
771 Ga0207702_10065968
772 Ga0207702_10203548
773 Ga0207641_10094080
774 Ga0207676_10095280
775 Ga0207676_10240568
776 Ga0207674_10014112
777 Ga0207674_10022371
778 Ga0207674_10072427
779 Ga0207674_10172525
780 Ga0207675_100127680
781 Ga0207683_10002402
782 Ga0207683_10134557
783 Ga0207698_10114326
784 Ga0268266_10216734
785 Ga0268265_10225159
786 Ga0268264_10199989
787 Ga0265338_10010976
788 Ga0265327_10000002
789 Ga0307514_10032764
790 Ga0316214_1004955
791 Ga0373950_0003774
792 Ga0373926_0000769
793 Ga0373926_0004257
794 Ga0373926_0032598
795 Ga0373928_0001819
796 Ga0373934_0000014
797 Ga0373934_0036173
798 Ga0373934_0056540
799 Ga0373944_0003453
800 Ga0373949_0052615
801 Ga0373951_0011505
802 Ga0373952_0025042
803 Ga0373923_0019802
804 Ga0373923_0024262
805 Ga0373923_0032696
806 Ga0373936_0000318
807 Ga0373936_0001017
808 Ga0373939_0011548
809 Ga0373939_0013090
810 Ga0373941_0074435
811 Ga0373945_0007321
812 Ga0373945_0025943
813 Ga0373953_0021810
814 Ga0373954_0001669
815 Ga0373954_0086185
816 Ga0373956_0001414
817 Ga0373956_0011982
818 Ga0373957_0000846
819 Ga0373957_0001048
820 Ga0373960_0023666
821 Ga0373943_0001163
822 Ga0373943_0029831
823 Ga0373946_0000854
824 Ga0373955_0000040
825 Ga0373955_0011729
826 Ga0373955_0041740
827 Ga0373955_0081418
828 Ga0373955_0100786
829 Ga0316574_0030341
830 Ga0373924_0001593
831 Ga0373924_0008048
832 Ga0373924_0013588
833 Ga0373924_0020879
834 Ga0373924_0044694
835 Ga0373931_0068707
836 Ga0373931_0249594
837 Ga0373935_0001435
838 Ga0373935_0007682
839 Ga0373935_0057875
840 Ga0373927_0007896
841 Ga0373927_0017804
842 Ga0373933_0000085
843 Ga0373933_0001065
844 Ga0373933_0015798
845 Ga0373947_0000195
846 Ga0373947_0001660
847 Ga0373947_0024976
848 Ga0373947_0071496
849 Ga0373937_0000197
850 Ga0373937_0009525
851 Ga0373937_0121009
852 Ga0373937_0135583
853 Ga0373937_0199148
854 Ga0373925_0010016
855 Ga0373925_0054711
856 Ga0373925_0055604
857 Ga0373925_0162505
858 Ga0436364_0512295
859 Ga0436364_0815007
860 Ga0436364_0827727
861 Ga0436364_1476981
862 Ga0436364_1494074
863 Ga0436364_1532326
864 Ga0436365_1146832
865 Ga0436363_0591387
866 Ga0436363_0909015
867 Ga0436363_1171857
868 Ga0436363_1432609
869 Ga0451577_0000281
870 Ga0451577_0000624
871 Ga0451577_0004925
872 Ga0451577_0021965
873 Ga0466969_0027480
874 Ga0466969_0100857
875 Ga0453684_0000208
876 Ga0453684_0001802
877 Ga0453684_0004345
878 Ga0453684_0027681
879 Ga0453684_0309139
880 Ga0466968_0045767
881 Ga0451576_0000989
882 Ga0451576_0086838
883 Ga0451576_0107788
884 Ga0466967_0011053
885 Ga0466967_0184913
886 Ga0495592_0000157
887 Ga0495592_0005544
888 Ga0495592_0031560
889 Ga0495592_0123670
890 Ga0495592_0158304
891 Ga0495629_0001111
892 Ga0495629_0004740
893 Ga0495629_0021855
894 Ga0495641_0019547
895 Ga0495641_0021312
896 Ga0495641_0051379
897 Ga0495651_0000115
898 Ga0495651_0006915
899 Ga0495651_0091444
900 Ga0495653_0008374
901 Ga0495653_0011549
902 Ga0495653_0039902
903 Ga0495653_0049401
904 Ga0495650_0000702
905 Ga0495580_0009545
906 Ga0495582_0003495
907 Ga0495639_0011515
908 Ga0495639_0020494
909 Ga0495662_0004916
910 Ga0495662_0006776
911 Ga0495662_0011770
912 Ga0495662_0015349
913 Ga0495664_0000083
914 Ga0495664_0011596
915 Ga0495664_0106272
916 Ga0495608_0003716
917 Ga0495608_0099593
918 Ga0495618_0025434
919 Ga0495618_0078629
920 Ga0495628_0000492
921 Ga0495628_0051709
922 Ga0495628_0062383
923 Ga0495628_0150127
924 Ga0495628_0227142
925 Ga0495630_0000391
926 Ga0495630_0013544
927 Ga0495630_0028700
928 Ga0495630_0070482
929 Ga0495666_0037181
930 Ga0495652_0007274
931 Ga0495652_0084359
932 Ga0495652_0094347
933 Ga0495652_0122306
934 Ga0495665_0001781
935 Ga0495665_0005180
936 Ga0495665_0010032
937 Ga0495665_0012503
938 Ga0495665_0048761
939 Ga0495640_0027454
940 Ga0495640_0060857
941 Ga0495586_0000017
942 Ga0495586_0097242
943 Ga0495587_0000123
944 Ga0495587_0022691
945 Ga0495587_0039198
946 Ga0495587_0045533
947 Ga0495587_0046448
948 Ga0495667_0000107
949 Ga0495667_0037068
950 Ga0495667_0139649
951 Ga0495634_0006493
952 Ga0495634_0008416
953 Ga0495634_0063148
954 Ga0495634_0063192
955 Ga0495635_0021289
956 Ga0495635_0022242
957 Ga0495635_0023794
958 Ga0495635_0153349
959 Ga0495588_0015215
960 Ga0495657_0000169
961 Ga0495657_0011577
962 Ga0495657_0024576
963 Ga0495657_0119927
964 Ga0495657_0125026
965 Ga0495599_0002521
966 Ga0495599_0009772
967 Ga0495599_0015968
968 Ga0495599_0041562
969 Ga0495623_0000166
970 Ga0495623_0022038
971 Ga0495623_0044798
972 Ga0495623_0059050
973 Ga0495623_0114892
974 Ga0495646_0064908
975 Ga0495647_0056369
976 Ga0495647_0091225
977 Ga0495647_0143335
978 Ga0495658_0008068
979 Ga0495658_0008508
980 Ga0495658_0015102
981 Ga0495658_0037374
982 Ga0495613_0074147
983 Ga0495624_0018405
984 Ga0495624_0082209
985 Ga0495600_0003759
986 Ga0495600_0014405
987 Ga0495600_0051992
988 Ga0495600_0063965
989 Ga0495600_0079322
990 Ga0495600_0109288
991 Ga0495600_0233835
992 Ga0495604_0000161
993 Ga0495604_0041992
994 Ga0495604_0083431
995 Ga0495604_0095515
996 Ga0495604_0149191
997 Ga0495674_0000793
998 Ga0495674_0053530
999 Ga0495674_0076848
1000 Ga0495674_0094089
1001 Ga0495674_0176445
1002 Ga0495676_0007860
1003 Ga0495676_0048227
1004 Ga0495676_0112969
1005 Ga0495680_0004695
1006 Ga0495680_0007013
1007 Ga0495680_0012025
1008 Ga0495680_0046838
1009 Ga0495680_0073385
1010 Ga0495680_0101886
1011 Ga0495675_0001882
1012 Ga0495675_0002978
1013 Ga0495675_0011417
1014 Ga0495675_0062122
1015 Ga0495675_0099075
1016 Ga0495684_0006983
1017 Ga0495684_0023133
1018 Ga0495684_0027242
1019 Ga0495684_0028792
1020 Ga0495684_0041727
1021 Ga0495684_0105372
1022 Ga0495593_0010787
1023 Ga0495593_0013233
1024 Ga0495593_0037458
1025 Ga0495593_0098039
1026 Ga0495602_0000182
1027 Ga0495602_0034352
1028 Ga0495602_0049715
1029 Ga0495602_0144561
1030 Ga0495614_0018877
1031 Ga0495614_0022086
1032 Ga0495614_0029133
1033 Ga0496100_0145049
1034 Ga0496102_0023585
1035 Ga0496102_0068395
1036 Ga0496102_0100366
1037 Ga0496104_0155863
1038 Ga0496104_0225644
1039 Ga0496105_0006278
1040 Ga0496105_0161982
1041 Ga0496106_0064013
1042 Ga0496106_0141542
1043 Ga0496106_0544345
1044 Ga0496107_0077237
1045 Ga0496107_0081268
1046 Ga0496108_0082178
1047 Ga0496109_0012022
1048 Ga0496109_0020253
1049 Ga0496109_0020914
1050 Ga0496110_0010081
1051 Ga0496110_0067176
1052 Ga0496110_0089330
1053 Ga0496111_0012745
1054 Ga0496112_0065017
1055 Ga0496112_0338774
1056 Ga0496113_0147307
1057 Ga0496113_0324870
1058 Ga0496114_0041659
1059 Ga0496114_0126481
1060 Ga0496114_0136353
1061 Ga0496115_0351770
1062 Ga0496119_0012424
1063 Ga0496120_0010579
1064 Ga0501042_0091948
1065 nmdc:mga05p37_11899_c1
1066 nmdc:mga08y16_833455_c1
1067 nmdc:mga0n895_11040_c1
1068 nmdc:mga08x19_6450_c1
1069 nmdc:mga0a205_62127_c1
1070 Ga0495601_0066059
1071 Ga0495612_0012216
1072 Ga0495612_0019329
1073 Ga0495595_0002459
1074 Ga0495595_0008455
1075 Ga0495595_0019541
1076 Ga0495619_0000784
1077 Ga0495619_0089155
1078 Ga0500651_0001689
1079 Ga0500620_000139
1080 2687580482
1081 2952254095
1082 8057163295

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00696

AA_kinase

Amino acid kinase family

55

256

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ap9-assembly1.cif.gz_B crystal structure of acetylglutamate kinase from mycobacterium tuberculosis cdc1551 0.964 11 297
7nly-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis argb in complex with 2-chlorobenzimidazole. 0.9574 7 296
2buf-assembly1.cif.gz_F arginine feed-back inhibitable acetylglutamate kinase 0.9565 9 296
2buf-assembly1.cif.gz_E arginine feed-back inhibitable acetylglutamate kinase 0.9495 9 294
2v5h-assembly1.cif.gz_D controlling the storage of nitrogen as arginine: the complex of pii and acetylglutamate kinase from synechococcus elongatus pcc 7942 0.9476 15 298
ID Description Score Start End Superfamily
af_P9WQ01_4_294_3.40.1160.10 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9871 12 296 3.40.1160.10
af_P9WQ01_4_294_3.40.1160.10 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9636 12 296 3.40.1160.10
2v5hF00 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9504 18 297 3.40.1160.10
1uvdA00 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9269 9 299 3.40.1160.10
2v5hF00 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9116 18 297 3.40.1160.10
ID Description Score Start End GO Terms
AF-F8XRQ2-F1-model_v4 deleted 0.992 12 107
AF-A0A4Q5YWM1-F1-model_v4 deleted 0.9915 13 135
AF-A0A7W5JTV5-F1-model_v4 Acetylglutamate kinase (EC 2.7.2.8) (N-acetyl-L-glutamate 5-phosphotransferase) (NAG kinase) (NAGK) 0.991 13 294 GO:0003991
GO:0004042
GO:0005524
GO:0005737
GO:0006526
GO:0042450
AF-A0A1H2KCM4-F1-model_v4 Acetylglutamate kinase (EC 2.7.2.8) (N-acetyl-L-glutamate 5-phosphotransferase) (NAG kinase) (NAGK) 0.9903 6 296 GO:0003991
GO:0005524
GO:0005737
GO:0006526
GO:0042450
AF-D2PM79-F1-model_v4 Acetylglutamate kinase (EC 2.7.2.8) (N-acetyl-L-glutamate 5-phosphotransferase) (NAG kinase) (NAGK) 0.9903 10 296 GO:0003991
GO:0005524
GO:0005737
GO:0006526
GO:0042450

Map