F461343

General Info

Members Datasets Scaffolds Average Seq Length
541 248 541 248

Family's Representative Sequence

Representative Sequence 3300006175|Ga0070712_100163211|Ga0070712_1001632112
Length 293
Sequence MNRPDGGPIAVSEVVGGGHAGTVRRSDERRLTRAARALSSRAVCHDPDSGPPIPPIAGASVSHDDLVLEAADGTRFAAFAAGPDAPARCGVVVLPDVRGLHHFYEELTLRLGEQGIAAVAIDYFGRTAGVGKRDEDFPYAEHVPLTTGAGIQADVGAAVSHLRSQGVPAVFTVGFCFGGRHSWLSTAGGHELAGAIGFYGSTGPRNGEPGPIQRAAEFRAPILALMGGADQAITADDVAAFDSALAEAGVEHEVVTYDRAPHSFFDRKQEQFADVSADAWRRVLAFFESHTPA

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
88 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
131 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
132 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
133 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
134 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
135 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
136 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
137 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
138 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
139 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
140 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
141 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
142 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
143 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
144 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
145 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
146 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
147 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
148 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
149 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
150 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
151 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
152 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
153 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
154 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
155 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
156 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
157 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
158 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
159 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
160 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
162 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
163 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
166 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
167 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
177 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
178 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
179 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
180 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
181 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
182 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
183 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
184 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
185 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
188 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
189 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
190 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
191 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
192 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
193 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
224 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
225 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
226 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
227 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
228 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
229 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
230 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
231 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
232 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
233 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
236 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
237 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
238 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
239 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
240 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
241 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
242 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
243 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
244 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
245 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
246 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
247 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
248 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.08
Metatranscriptomes 0.92
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.76
Rhizosphere 91.5
Stem 0
Stem Tuber 0
Unclassified 0.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10037509 3300005327 Bacteria 3907
2 Ga0070683_100039173 3300005329 Bacteria 4349
3 Ga0070683_100137158 3300005329 Bacteria 2317
4 Ga0070683_100339916 3300005329 Bacteria 1429
5 Ga0070670_100078262 3300005331 Bacteria 2840
6 Ga0070680_100444660 3300005336 Bacteria 1107
7 Ga0070682_100029952 3300005337 Bacteria 3280
8 Ga0070682_100219685 3300005337 Bacteria 1352
9 Ga0070660_100002536 3300005339 Bacteria 12518
10 Ga0070660_100059265 3300005339 Bacteria 2969
11 Ga0070660_100080287 3300005339 Bacteria 2559
12 Ga0070660_100460132 3300005339 Bacteria 1056
13 Ga0070689_100200122 3300005340 Bacteria 1631
14 Ga0070661_100053256 3300005344 Bacteria 2961
15 Ga0070661_100420800 3300005344 Bacteria 1059
16 Ga0070668_100006034 3300005347 Bacteria 8987
17 Ga0070671_100165482 3300005355 Bacteria 1870
18 Ga0070671_100303330 3300005355 Bacteria 1360
19 Ga0070671_100475298 3300005355 Bacteria 1074
20 Ga0070674_100002662 3300005356 Bacteria 9894
21 Ga0070674_100103761 3300005356 Unclassified 2076
22 Ga0070688_100006185 3300005365 Bacteria 6372
23 Ga0070709_10037155 3300005434 Bacteria 2972
24 Ga0070709_10543970 3300005434 Bacteria 888
25 Ga0070714_100045100 3300005435 Bacteria 3735
26 Ga0070714_100262081 3300005435 Bacteria 1601
27 Ga0070714_100363878 3300005435 Bacteria 1360
28 Ga0070713_100027322 3300005436 Bacteria 4491
29 Ga0070711_100007896 3300005439 Bacteria 6487
30 Ga0070711_100122110 3300005439 Bacteria 1928
31 Ga0070705_100126675 3300005440 Bacteria 1659
32 Ga0070700_100018616 3300005441 Bacteria 3995
33 Ga0070700_100338249 3300005441 Unclassified 1112
34 Ga0070694_100012612 3300005444 Bacteria 5260
35 Ga0070694_100340565 3300005444 Bacteria 1159
36 Ga0070708_100048888 3300005445 Bacteria 3741
37 Ga0070708_100439031 3300005445 Bacteria 1231
38 Ga0070663_100111222 3300005455 Bacteria 2058
39 Ga0070663_100126861 3300005455 Bacteria 1934
40 Ga0070678_100033479 3300005456 Bacteria 3568
41 Ga0070678_100216357 3300005456 Bacteria 1590
42 Ga0070662_100012390 3300005457 Bacteria 5654
43 Ga0070681_10000568 3300005458 Bacteria 30431
44 Ga0070681_10016731 3300005458 Bacteria 7321
45 Ga0070681_10039602 3300005458 Bacteria 4723
46 Ga0070681_10137606 3300005458 Bacteria 2372
47 Ga0068867_100315744 3300005459 Bacteria 1293
48 Ga0070707_100057082 3300005468 Bacteria 3746
49 Ga0070707_100418420 3300005468 Bacteria 1300
50 Ga0070699_100081894 3300005518 Bacteria 2813
51 Ga0070699_100242084 3300005518 Bacteria 1611
52 Ga0070699_100502390 3300005518 Bacteria 1102
53 Ga0070679_100065848 3300005530 Bacteria 3611
54 Ga0070679_100255875 3300005530 Bacteria 1706
55 Ga0070679_100271822 3300005530 Bacteria 1649
56 Ga0070684_100050693 3300005535 Bacteria 3606
57 Ga0070684_100146792 3300005535 Bacteria 2135
58 Ga0070697_100167309 3300005536 Bacteria 1859
59 Ga0070697_100234632 3300005536 Bacteria 1565
60 Ga0068853_100071880 3300005539 Bacteria 3014
61 Ga0068853_100386489 3300005539 Bacteria 1308
62 Ga0070672_100099257 3300005543 Bacteria 2360
63 Ga0070686_100033242 3300005544 Bacteria 3168
64 Ga0070686_100109195 3300005544 Bacteria 1882
65 Ga0070696_100052533 3300005546 Bacteria 2835
66 Ga0070696_100293999 3300005546 Bacteria 1242
67 Ga0070665_100018342 3300005548 Bacteria 7014
68 Ga0070665_100023734 3300005548 Bacteria 6177
69 Ga0068855_100005379 3300005563 Bacteria 15618
70 Ga0068855_100089909 3300005563 Bacteria 3544
71 Ga0068855_100117772 3300005563 Bacteria 3042
72 Ga0068855_100228924 3300005563 Bacteria 2082
73 Ga0068855_100311297 3300005563 Bacteria 1742
74 Ga0070664_100329845 3300005564 Unclassified 1384
75 Ga0070664_100434627 3300005564 Bacteria 1203
76 Ga0068857_100139125 3300005577 Bacteria 2194
77 Ga0068854_100173581 3300005578 Bacteria 1679
78 Ga0068856_100112734 3300005614 Bacteria 2717
79 Ga0068856_100188089 3300005614 Bacteria 2079
80 Ga0068856_100216498 3300005614 Bacteria 1930
81 Ga0068856_100999603 3300005614 Unclassified 855
82 Ga0070702_100138605 3300005615 Bacteria 1547
83 Ga0068852_100346430 3300005616 Bacteria 1449
84 Ga0068859_100181417 3300005617 Bacteria 2188
85 Ga0068861_100059776 3300005719 Bacteria 2919
86 Ga0068858_100275674 3300005842 Bacteria 1601
87 Ga0081539_10004194 3300005985 Bacteria 16284
88 Ga0070717_10106028 3300006028 Bacteria 2393
89 Ga0070715_10091897 3300006163 Unclassified 1398
90 Ga0070716_100089394 3300006173 Bacteria 1860
91 Ga0070716_100103431 3300006173 Bacteria 1751
92 Ga0070716_100121551 3300006173 Unclassified 1635
93 Ga0070712_100001811 3300006175 Bacteria 13024
94 Ga0070712_100163211 3300006175 Bacteria 1722
95 Ga0070712_100164223 3300006175 Bacteria 1717
96 Ga0097621_100279823 3300006237 Bacteria 1468
97 Ga0068871_100011692 3300006358 Bacteria 6445
98 Ga0068871_100231697 3300006358 Bacteria 1603
99 Ga0075428_100038150 3300006844 Bacteria 5288
100 Ga0075431_100149835 3300006847 Bacteria 2403
101 Ga0075431_100407517 3300006847 Bacteria 1360
102 Ga0075433_10048087 3300006852 Bacteria 3709
103 Ga0075434_100004672 3300006871 Bacteria 12376
104 Ga0075434_100030130 3300006871 Bacteria 5342
105 Ga0075434_100075233 3300006871 Bacteria 3370
106 Ga0075434_100531590 3300006871 Unclassified 1196
107 Ga0075434_100739925 3300006871 Bacteria 1000
108 Ga0068865_100307963 3300006881 Bacteria 1270
109 Ga0068865_100403616 3300006881 Bacteria 1120
110 Ga0075436_100071616 3300006914 Bacteria 2397
111 Ga0097620_100181427 3300006931 Bacteria 2188
112 Ga0075435_100018129 3300007076 Bacteria 5342
113 Ga0075435_100056708 3300007076 Bacteria 3168
114 Ga0075435_100069580 3300007076 Bacteria 2870
115 Ga0075435_100583320 3300007076 Bacteria 969
116 Ga0105240_10043509 3300009093 Bacteria 5713
117 Ga0105240_10052634 3300009093 Bacteria 5116
118 Ga0105240_10691167 3300009093 Bacteria 1114
119 Ga0111539_10268427 3300009094 Bacteria 1986
120 Ga0105245_10049048 3300009098 Bacteria 3779
121 Ga0105245_10133451 3300009098 Bacteria 2331
122 Ga0105245_10386407 3300009098 Bacteria 1395
123 Ga0105245_11073938 3300009098 Bacteria 851
124 Ga0114129_10060303 3300009147 Bacteria 5305
125 Ga0105243_10045839 3300009148 Bacteria 3437
126 Ga0105243_10255441 3300009148 Bacteria 1567
127 Ga0105241_10083687 3300009174 Unclassified 2503
128 Ga0105242_10034315 3300009176 Bacteria 4067
129 Ga0105242_10077087 3300009176 Bacteria 2780
130 Ga0105242_10153474 3300009176 Bacteria 2010
131 Ga0105242_10324836 3300009176 Bacteria 1413
132 Ga0105242_10678394 3300009176 Bacteria 1005
133 Ga0105238_10113196 3300009551 Unclassified 2693
134 Ga0105238_10576086 3300009551 Bacteria 1132
135 Ga0105249_10006293 3300009553 Bacteria 10313
136 Ga0105239_10176624 3300010375 Bacteria 2389
137 Ga0105239_10410596 3300010375 Bacteria 1533
138 Ga0105239_10737580 3300010375 Bacteria 1127
139 Ga0105246_10285583 3300011119 Bacteria 1326
140 Ga0157373_10154458 3300013100 Bacteria 1615
141 Ga0157371_10346259 3300013102 Bacteria 1081
142 Ga0157370_10027506 3300013104 Bacteria 5607
143 Ga0157370_10098762 3300013104 Bacteria 2737
144 Ga0157370_10105605 3300013104 Bacteria 2636
145 Ga0157370_10133591 3300013104 Bacteria 2314
146 Ga0157370_10326330 3300013104 Bacteria 1415
147 Ga0157369_10022920 3300013105 Bacteria 6962
148 Ga0157369_10051321 3300013105 Bacteria 4463
149 Ga0157369_10092750 3300013105 Bacteria 3223
150 Ga0157369_10140483 3300013105 Bacteria 2556
151 Ga0157369_10217279 3300013105 Bacteria 2002
152 Ga0157369_10224181 3300013105 Bacteria 1967
153 Ga0157378_10159384 3300013297 Bacteria 2109
154 Ga0157378_10326523 3300013297 Bacteria 1492
155 Ga0163162_10006937 3300013306 Bacteria 10983
156 Ga0163162_10535886 3300013306 Bacteria 1300
157 Ga0157372_10162834 3300013307 Bacteria 2579
158 Ga0157372_10536955 3300013307 Bacteria 1363
159 Ga0157375_10140567 3300013308 Bacteria 2541
160 Ga0157375_10430221 3300013308 Bacteria 1486
161 Ga0163163_10165081 3300014325 Bacteria 2260
162 Ga0157380_10273576 3300014326 Bacteria 1541
163 Ga0157377_10004196 3300014745 Bacteria 6590
164 Ga0157376_10023540 3300014969 Bacteria 4821
165 Ga0197907_10209284 3300020069 Bacteria 4499
166 Ga0197907_10720309 3300020069 Bacteria 2178
167 Ga0206354_11238920 3300020081 Bacteria 1268
168 Ga0206353_10341784 3300020082 Bacteria 1637
169 Ga0206353_10875716 3300020082 Bacteria 6509
170 Ga0213871_10011190 3300021441 Bacteria 2055
171 Ga0207692_10207451 3300025898 Bacteria 1155
172 Ga0207692_10246530 3300025898 Bacteria 1069
173 Ga0207688_10011008 3300025901 Bacteria 4921
174 Ga0207680_10095239 3300025903 Unclassified 1902
175 Ga0207699_10160216 3300025906 Bacteria 1497
176 Ga0207699_10219744 3300025906 Bacteria 1296
177 Ga0207699_10461829 3300025906 Bacteria 912
178 Ga0207705_10026970 3300025909 Bacteria 4094
179 Ga0207705_10398182 3300025909 Bacteria 1065
180 Ga0207705_10456363 3300025909 Bacteria 991
181 Ga0207684_10493335 3300025910 Bacteria 1050
182 Ga0207684_10517342 3300025910 Bacteria 1022
183 Ga0207654_10036880 3300025911 Bacteria 2734
184 Ga0207707_10002326 3300025912 Bacteria 17116
185 Ga0207707_10014588 3300025912 Bacteria 6845
186 Ga0207707_10107205 3300025912 Bacteria 2442
187 Ga0207707_10172742 3300025912 Bacteria 1888
188 Ga0207707_10376387 3300025912 Bacteria 1221
189 Ga0207695_10374014 3300025913 Bacteria 1311
190 Ga0207693_10005822 3300025915 Bacteria 10230
191 Ga0207693_10045821 3300025915 Bacteria 3436
192 Ga0207693_10047070 3300025915 Bacteria 3389
193 Ga0207663_10017317 3300025916 Bacteria 4011
194 Ga0207663_10017939 3300025916 Bacteria 3953
195 Ga0207660_10176694 3300025917 Bacteria 1656
196 Ga0207657_10007822 3300025919 Bacteria 10909
197 Ga0207657_10013279 3300025919 Bacteria 8080
198 Ga0207657_10015482 3300025919 Bacteria 7387
199 Ga0207657_10018833 3300025919 Bacteria 6574
200 Ga0207657_10086618 3300025919 Bacteria 2621
201 Ga0207657_10093639 3300025919 Bacteria 2502
202 Ga0207657_10190800 3300025919 Bacteria 1653
203 Ga0207649_10053723 3300025920 Bacteria 2505
204 Ga0207649_10303479 3300025920 Bacteria 1168
205 Ga0207652_10007548 3300025921 Bacteria 8757
206 Ga0207646_10175714 3300025922 Bacteria 1934
207 Ga0207646_10329279 3300025922 Bacteria 1380
208 Ga0207646_10559186 3300025922 Bacteria 1028
209 Ga0207694_10497252 3300025924 Unclassified 1021
210 Ga0207659_10294337 3300025926 Bacteria 1331
211 Ga0207687_10126356 3300025927 Bacteria 1920
212 Ga0207687_10184562 3300025927 Bacteria 1618
213 Ga0207687_10314410 3300025927 Bacteria 1266
214 Ga0207664_10021446 3300025929 Bacteria 4804
215 Ga0207664_10082453 3300025929 Bacteria 2619
216 Ga0207690_10038797 3300025932 Bacteria 3102
217 Ga0207690_10040878 3300025932 Bacteria 3034
218 Ga0207690_10218469 3300025932 Bacteria 1457
219 Ga0207706_10016293 3300025933 Bacteria 6712
220 Ga0207686_10010261 3300025934 Bacteria 5096
221 Ga0207686_10032916 3300025934 Bacteria 3089
222 Ga0207670_10068940 3300025936 Bacteria 2438
223 Ga0207669_10006120 3300025937 Bacteria 5468
224 Ga0207704_10186710 3300025938 Bacteria 1504
225 Ga0207704_10424260 3300025938 Bacteria 1055
226 Ga0207665_10001916 3300025939 Bacteria 14032
227 Ga0207665_10040250 3300025939 Bacteria 3117
228 Ga0207665_10334706 3300025939 Bacteria 1139
229 Ga0207691_10201648 3300025940 Bacteria 1731
230 Ga0207661_10103517 3300025944 Bacteria 2396
231 Ga0207661_10193909 3300025944 Bacteria 1782
232 Ga0207661_10422173 3300025944 Bacteria 1211
233 Ga0207679_10537083 3300025945 Bacteria 1048
234 Ga0207667_10055184 3300025949 Bacteria 4177
235 Ga0207667_10079538 3300025949 Bacteria 3397
236 Ga0207667_10119381 3300025949 Bacteria 2717
237 Ga0207667_10189284 3300025949 Bacteria 2112
238 Ga0207667_10357403 3300025949 Bacteria 1489
239 Ga0207667_10629109 3300025949 Bacteria 1080
240 Ga0207668_10003092 3300025972 Bacteria 9758
241 Ga0207640_10189441 3300025981 Bacteria 1549
242 Ga0207639_10043629 3300026041 Bacteria 3368
243 Ga0207639_10106488 3300026041 Bacteria 2276
244 Ga0207639_10765943 3300026041 Bacteria 898
245 Ga0207678_10012020 3300026067 Bacteria 7602
246 Ga0207678_10133887 3300026067 Bacteria 2114
247 Ga0207708_10006686 3300026075 Bacteria 8528
248 Ga0207708_10351248 3300026075 Bacteria 1210
249 Ga0207702_10253443 3300026078 Bacteria 1654
250 Ga0207674_10153313 3300026116 Bacteria 2260
251 Ga0207675_100001857 3300026118 Bacteria 21157
252 Ga0207675_100056521 3300026118 Bacteria 3660
253 Ga0207683_10001825 3300026121 Bacteria 18827
254 Ga0207683_10005063 3300026121 Bacteria 11305
255 Ga0207683_10036267 3300026121 Bacteria 4293
256 Ga0207683_10069932 3300026121 Bacteria 3100
257 Ga0207698_10255063 3300026142 Bacteria 1607
258 Ga0268266_10691908 3300028379 Bacteria 982
259 Ga0265337_1041241 3300028556 Bacteria 1328
260 Ga0265326_10007725 3300028558 Bacteria 3281
261 Ga0265319_1009258 3300028563 Bacteria 4216
262 Ga0265319_1031619 3300028563 Bacteria 1842
263 Ga0265319_1034046 3300028563 Bacteria 1755
264 Ga0265334_10010181 3300028573 Bacteria 3970
265 Ga0265334_10018147 3300028573 Bacteria 2901
266 Ga0265334_10031091 3300028573 Bacteria 2134
267 Ga0265318_10000309 3300028577 Bacteria 39338
268 Ga0265318_10037010 3300028577 Bacteria 1870
269 Ga0265323_10044126 3300028653 Bacteria 1607
270 Ga0265322_10013664 3300028654 Bacteria 2351
271 Ga0265322_10018793 3300028654 Unclassified 1985
272 Ga0265322_10023286 3300028654 Bacteria 1771
273 Ga0265338_10005865 3300028800 Bacteria 15841
274 Ga0265338_10044225 3300028800 Bacteria 4115
275 Ga0265330_10000870 3300031235 Bacteria 18861
276 Ga0265330_10069744 3300031235 Bacteria 1521
277 Ga0265330_10118488 3300031235 Bacteria 1128
278 Ga0265332_10002376 3300031238 Bacteria 9597
279 Ga0265332_10041555 3300031238 Bacteria 1989
280 Ga0265328_10012325 3300031239 Bacteria 3404
281 Ga0265320_10050362 3300031240 Bacteria 2025
282 Ga0265325_10017489 3300031241 Bacteria 3983
283 Ga0265325_10038629 3300031241 Bacteria 2518
284 Ga0265325_10085301 3300031241 Bacteria 1565
285 Ga0265329_10004530 3300031242 Bacteria 5763
286 Ga0265329_10017967 3300031242 Bacteria 2425
287 Ga0265340_10001918 3300031247 Bacteria 11878
288 Ga0265339_10004868 3300031249 Bacteria 9061
289 Ga0265339_10124460 3300031249 Bacteria 1323
290 Ga0265331_10043121 3300031250 Bacteria 2186
291 Ga0265327_10008952 3300031251 Bacteria 7338
292 Ga0265327_10017100 3300031251 Bacteria 4567
293 Ga0265316_10006271 3300031344 Bacteria 11397
294 Ga0265316_10007810 3300031344 Bacteria 10013
295 Ga0265316_10011079 3300031344 Bacteria 8166
296 Ga0265316_10042434 3300031344 Bacteria 3636
297 Ga0265313_10002480 3300031595 Bacteria 15906
298 Ga0265314_10011637 3300031711 Bacteria 7242
299 Ga0265314_10060102 3300031711 Bacteria 2595
300 Ga0265314_10099542 3300031711 Bacteria 1872
301 Ga0265342_10008532 3300031712 Bacteria 7333
302 Ga0373948_0017895 3300034817 Bacteria 1325
303 Ga0373958_0001625 3300034819 Bacteria 3047
304 Ga0373958_0016169 3300034819 Bacteria 1327
305 Ga0373959_0004094 3300034820 Bacteria 2338
306 Ga0373928_0015804 3300035084 Unclassified 1539
307 Ga0373949_0000814 3300035090 Bacteria 9946
308 Ga0373951_0003259 3300035091 Bacteria 3970
309 Ga0373951_0040757 3300035091 Unclassified 1119
310 Ga0373952_0023321 3300035092 Bacteria 1321
311 Ga0373932_0002704 3300035112 Bacteria 4412
312 Ga0373936_0024748 3300035113 Bacteria 2346
313 Ga0373941_0001643 3300035115 Bacteria 4770
314 Ga0373941_0014494 3300035115 Bacteria 2107
315 Ga0373945_0001307 3300035116 Bacteria 7556
316 Ga0373960_0007650 3300035121 Bacteria 2567
317 Ga0373960_0076097 3300035121 Bacteria 1047
318 Ga0373955_0146037 3300035172 Bacteria 1390
319 Ga0373961_0001622 3300035241 Bacteria 6350
320 Ga0373961_0006149 3300035241 Bacteria 2885
321 Ga0373931_0008057 3300035691 Bacteria 4985
322 Ga0373931_0008554 3300035691 Bacteria 4858
323 Ga0373935_0032325 3300035692 Bacteria 3252
324 Ga0373947_0008210 3300035725 Bacteria 6022
325 Ga0373925_0027015 3300037068 Bacteria 4202
326 Ga0395899_0018595 3300037312 Bacteria 5280
327 Ga0395899_0025973 3300037312 Bacteria 4420
328 Ga0395899_0258470 3300037312 Bacteria 1192
329 Ga0395900_0124732 3300037418 Bacteria 2641
330 Ga0395900_0194218 3300037418 Unclassified 2057
331 Ga0395900_0522391 3300037418 Bacteria 1135
332 Ga0395898_0004841 3300037466 Bacteria 14635
333 Ga0395898_0065835 3300037466 Bacteria 3513
334 Ga0395898_0105046 3300037466 Bacteria 2708
335 Ga0395898_0224192 3300037466 Bacteria 1793
336 Ga0395898_0342885 3300037466 Bacteria 1425
337 Ga0395898_0512484 3300037466 Bacteria 1141
338 Ga0395905_0027947 3300037471 Bacteria 5319
339 Ga0436364_0818372 3300037853 Bacteria 1598
340 Ga0436364_0958456 3300037853 Unclassified 942
341 Ga0395901_0012209 3300038443 Bacteria 8718
342 Ga0395901_0229077 3300038443 Bacteria 1940
343 Ga0395901_0561279 3300038443 Bacteria 1156
344 Ga0436365_0636617 3300039437 Bacteria 1942
345 Ga0436360_0546867 3300039438 Bacteria 17506
346 Ga0436360_1360884 3300039438 Bacteria 2722
347 Ga0436363_0706773 3300039450 Bacteria 2280
348 Ga0466969_0036211 3300044656 Bacteria 2494
349 Ga0466966_0006197 3300044684 Bacteria 7908
350 Ga0466966_0054166 3300044684 Bacteria 2543
351 Ga0466961_0019108 3300044693 Bacteria 4409
352 Ga0466961_0150549 3300044693 Unclassified 1453
353 Ga0466961_0376808 3300044693 Bacteria 862
354 Ga0466963_0006255 3300044694 Bacteria 7035
355 Ga0466963_0057101 3300044694 Bacteria 2599
356 Ga0466963_0112075 3300044694 Bacteria 1873
357 Ga0466963_0126509 3300044694 Bacteria 1762
358 Ga0466963_0133964 3300044694 Bacteria 1713
359 Ga0466963_0191244 3300044694 Bacteria 1430
360 Ga0466968_0019512 3300044735 Bacteria 2729
361 Ga0466968_0023638 3300044735 Bacteria 2506
362 Ga0466959_0004473 3300045049 Bacteria 9363
363 Ga0466959_0007161 3300045049 Bacteria 7807
364 Ga0466959_0289847 3300045049 Bacteria 1122
365 Ga0466958_0046677 3300045836 Bacteria 2614
366 Ga0466967_0000274 3300045976 Bacteria 22748
367 Ga0466967_0004211 3300045976 Bacteria 9644
368 Ga0466967_0009135 3300045976 Bacteria 7332
369 Ga0466967_0017774 3300045976 Bacteria 5659
370 Ga0466967_0037850 3300045976 Bacteria 4133
371 Ga0466967_0123550 3300045976 Bacteria 2395
372 Ga0466967_0139411 3300045976 Bacteria 2258
373 Ga0466967_0419584 3300045976 Bacteria 1304
374 Ga0495627_052207 3300046453 Unclassified 1227
375 Ga0495591_052200 3300046458 Bacteria 1113
376 Ga0495605_0159123 3300046474 Bacteria 1003
377 Ga0495628_0234175 3300046516 Bacteria 1376
378 Ga0495656_0071220 3300046615 Bacteria 1545
379 Ga0495599_0121597 3300046678 Bacteria 1623
380 Ga0495581_0156513 3300047315 Bacteria 1332
381 Ga0496100_0005099 3300048903 Bacteria 7035
382 Ga0496101_0003495 3300048904 Bacteria 9803
383 Ga0496101_0020212 3300048904 Bacteria 4553
384 Ga0496101_0029442 3300048904 Bacteria 3840
385 Ga0496102_0013964 3300048905 Bacteria 6972
386 Ga0496102_0764870 3300048905 Bacteria 889
387 Ga0496103_0011692 3300048906 Bacteria 5205
388 Ga0496103_0042576 3300048906 Bacteria 2795
389 Ga0496103_0060498 3300048906 Bacteria 2354
390 Ga0496104_0001632 3300048907 Bacteria 19365
391 Ga0496104_0060621 3300048907 Bacteria 3584
392 Ga0496104_0188676 3300048907 Bacteria 1972
393 Ga0496105_0001516 3300048908 Bacteria 16418
394 Ga0496106_0005968 3300048909 Bacteria 8998
395 Ga0496106_0190475 3300048909 Bacteria 1630
396 Ga0496107_0003768 3300048910 Bacteria 10180
397 Ga0496107_0008722 3300048910 Bacteria 7024
398 Ga0496107_0012913 3300048910 Bacteria 5837
399 Ga0496108_0008962 3300048911 Bacteria 8109
400 Ga0496108_0416414 3300048911 Unclassified 1173
401 Ga0496109_0012997 3300048912 Bacteria 7198
402 Ga0496109_0047394 3300048912 Bacteria 3907
403 Ga0496109_0818226 3300048912 Bacteria 869
404 Ga0496110_0014389 3300048913 Bacteria 6569
405 Ga0496110_0065042 3300048913 Bacteria 3224
406 Ga0496110_0161408 3300048913 Bacteria 2032
407 Ga0496110_0298900 3300048913 Bacteria 1466
408 Ga0496111_0063770 3300048914 Bacteria 2672
409 Ga0496112_0023915 3300048915 Bacteria 5844
410 Ga0496112_0030821 3300048915 Bacteria 5195
411 Ga0496112_0043208 3300048915 Bacteria 4412
412 Ga0496112_0062230 3300048915 Bacteria 3681
413 Ga0496112_0128426 3300048915 Bacteria 2505
414 Ga0496112_0203143 3300048915 Bacteria 1940
415 Ga0496112_0547826 3300048915 Bacteria 1091
416 Ga0496113_0073506 3300048916 Bacteria 2605
417 Ga0496113_0127893 3300048916 Unclassified 1991
418 Ga0496113_0337194 3300048916 Bacteria 1209
419 Ga0496114_0008381 3300048917 Bacteria 8188
420 Ga0496114_0244892 3300048917 Unclassified 1577
421 Ga0496115_0003191 3300048918 Bacteria 11773
422 Ga0496115_0165554 3300048918 Bacteria 1828
423 Ga0501031_0008249 3300049568 Bacteria 6774
424 Ga0501033_0051980 3300049570 Unclassified 3037
425 Ga0501034_0837392 3300049571 Bacteria 811
426 Ga0501036_0003201 3300049572 Bacteria 13072
427 Ga0501036_0470244 3300049572 Bacteria 1047
428 Ga0501037_0116581 3300049573 Bacteria 1922
429 Ga0501038_0044567 3300049574 Unclassified 3852
430 Ga0501039_0000813 3300049575 Bacteria 22530
431 Ga0501039_0107346 3300049575 Bacteria 2181
432 Ga0501039_0125910 3300049575 Bacteria 2010
433 Ga0501040_0025885 3300049576 Unclassified 3947
434 Ga0501040_0040040 3300049576 Bacteria 3188
435 Ga0501040_0114159 3300049576 Unclassified 1891
436 Ga0501040_0200529 3300049576 Bacteria 1417
437 Ga0501041_0021520 3300049577 Bacteria 3863
438 Ga0501041_0059376 3300049577 Bacteria 2341
439 Ga0501041_0092869 3300049577 Unclassified 1864
440 Ga0501041_0210868 3300049577 Unclassified 1218
441 Ga0501041_0305840 3300049577 Bacteria 1002
442 Ga0501042_0031079 3300049578 Bacteria 3778
443 Ga0501043_0049330 3300049579 Unclassified 3310
444 Ga0501046_0005021 3300049580 Bacteria 11877
445 Ga0501046_0683599 3300049580 Unclassified 724
446 Ga0501048_0007353 3300049582 Bacteria 8348
447 Ga0501048_0068642 3300049582 Bacteria 2504
448 Ga0501048_0114404 3300049582 Unclassified 1906
449 Ga0501067_0000043 3300049583 Bacteria 75533
450 Ga0501067_0127964 3300049583 Bacteria 1413
451 Ga0501068_0009376 3300049584 Bacteria 5474
452 Ga0501068_0010101 3300049584 Bacteria 5297
453 Ga0501068_0031253 3300049584 Bacteria 3162
454 Ga0501069_0000188 3300049585 Bacteria 27727
455 Ga0501069_0058607 3300049585 Bacteria 2148
456 Ga0501069_0122748 3300049585 Bacteria 1484
457 Ga0501070_0001185 3300049586 Bacteria 23305
458 Ga0501070_0062413 3300049586 Bacteria 3087
459 Ga0501070_0623664 3300049586 Unclassified 858
460 Ga0501071_0002003 3300049587 Bacteria 12177
461 Ga0501071_0015118 3300049587 Bacteria 5293
462 Ga0501071_0021661 3300049587 Bacteria 4479
463 Ga0501071_0029079 3300049587 Unclassified 3898
464 Ga0501071_0064691 3300049587 Unclassified 2654
465 Ga0501071_0101057 3300049587 Bacteria 2126
466 Ga0501071_0574698 3300049587 Unclassified 866
467 Ga0501071_0592691 3300049587 Bacteria 852
468 Ga0501072_0001289 3300049588 Bacteria 18747
469 Ga0501072_0002381 3300049588 Bacteria 14110
470 Ga0501072_0022249 3300049588 Bacteria 4918
471 Ga0501072_0024179 3300049588 Bacteria 4724
472 Ga0501074_0028236 3300049590 Bacteria 4066
473 Ga0501074_0112404 3300049590 Unclassified 1949
474 Ga0501074_0191400 3300049590 Bacteria 1458
475 Ga0501074_0548480 3300049590 Bacteria 818
476 Ga0501075_0004991 3300049591 Bacteria 9052
477 Ga0501075_0007456 3300049591 Bacteria 7586
478 Ga0501075_0038730 3300049591 Unclassified 3565
479 Ga0501075_0039497 3300049591 Bacteria 3532
480 Ga0501075_0067772 3300049591 Unclassified 2695
481 Ga0501075_0068735 3300049591 Unclassified 2677
482 Ga0501075_0171701 3300049591 Bacteria 1655
483 Ga0501075_0216170 3300049591 Bacteria 1462
484 Ga0501075_0232002 3300049591 Bacteria 1407
485 Ga0501075_0281175 3300049591 Bacteria 1268
486 Ga0501076_0012517 3300049592 Bacteria 6345
487 Ga0501076_0014450 3300049592 Bacteria 5947
488 Ga0501076_0072510 3300049592 Unclassified 2756
489 Ga0501076_0100482 3300049592 Unclassified 2331
490 Ga0501076_0697061 3300049592 Bacteria 838
491 Ga0501077_0011731 3300049593 Bacteria 5478
492 Ga0501077_0035477 3300049593 Unclassified 3175
493 Ga0501077_0061174 3300049593 Unclassified 2390
494 Ga0501079_0020211 3300049741 Bacteria 5090
495 Ga0501079_0067639 3300049741 Bacteria 2757
496 Ga0501079_0084612 3300049741 Unclassified 2454
497 Ga0501079_0178036 3300049741 Unclassified 1659
498 Ga0501079_0185189 3300049741 Bacteria 1625
499 Ga0501079_0187656 3300049741 Bacteria 1614
500 Ga0501080_0354313 3300049742 Bacteria 1325
501 Ga0501080_0375812 3300049742 Bacteria 1281
502 Ga0501080_0398398 3300049742 Bacteria 1238
503 Ga0501081_0001923 3300049743 Bacteria 12892
504 Ga0501081_0024278 3300049743 Bacteria 4070
505 Ga0501081_0036689 3300049743 Unclassified 3343
506 Ga0501081_0114303 3300049743 Bacteria 1918
507 Ga0501081_0120828 3300049743 Unclassified 1866
508 Ga0501081_0151650 3300049743 Unclassified 1665
509 Ga0501083_0047328 3300049744 Bacteria 2906
510 Ga0501045_0012691 3300049824 Bacteria 5932
511 Ga0501045_0023536 3300049824 Bacteria 4417
512 Ga0501045_0075614 3300049824 Unclassified 2481
513 Ga0501045_0108660 3300049824 Unclassified 2056
514 Ga0501045_0149883 3300049824 Bacteria 1735
515 nmdc:mga05p37_75827_c1 3300050507 Bacteria 4140
516 nmdc:mga05p37_873642_c1 3300050507 Bacteria 973
517 nmdc:mga06r32_25872_c1 3300050510 Bacteria 5464
518 nmdc:mga0n895_166540_c1 3300050512 Bacteria 2236
519 nmdc:mga0n895_267436_c1 3300050512 Bacteria 1734
520 nmdc:mga0n895_3167_c1 3300050512 Bacteria 13149
521 nmdc:mga0n895_3940_c1 3300050512 Bacteria 12066
522 nmdc:mga0n895_72807_c1 3300050512 Bacteria 3410
523 nmdc:mga0rr50_16878_c1 3300050513 Bacteria 4861
524 nmdc:mga0rr50_4008_c1 3300050513 Bacteria 8588
525 nmdc:mga0rr50_7317_c1 3300050513 Bacteria 6795
526 nmdc:mga08x19_74181_c1 3300050514 Bacteria 2222
527 nmdc:mga0a205_269499_c1 3300050515 Bacteria 1580
528 Ga0495601_0443431 3300053077 Bacteria 840
529 Ga0495655_0131456 3300053083 Bacteria 771
530 Ga0501084_0004379 3300054114 Bacteria 11515
531 Ga0501084_0028493 3300054114 Bacteria 4669
532 Ga0501084_0068326 3300054114 Unclassified 2975
533 Ga0501084_0154946 3300054114 Unclassified 1932
534 Ga0501084_0200844 3300054114 Unclassified 1682
535 Ga0501082_0011225 3300060353 Bacteria 7697
536 Ga0501082_0223556 3300060353 Unclassified 1638
537 Ga0530510_0001083 3300061734 Bacteria 18083
538 Ga0530510_0001483 3300061734 Bacteria 15762
539 Ga0530510_0003992 3300061734 Bacteria 10185
540 Ga0530510_0009880 3300061734 Bacteria 6694
541 Ga0530510_0112589 3300061734 Bacteria 1994

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_0837392 Ga0501034_0837392_11_610 194
2 3300049580 Ga0501046_0683599 Ga0501046_0683599_95_694 194
3 3300049587 Ga0501071_0592691 Ga0501071_0592691_243_842 194
4 3300049572 Ga0501036_0470244 Ga0501036_0470244_134_811 220
5 3300049577 Ga0501041_0059376 Ga0501041_0059376_265_942 220
6 3300049582 Ga0501048_0114404 Ga0501048_0114404_994_1671 220
7 3300049588 Ga0501072_0024179 Ga0501072_0024179_3416_4093 220
8 3300049591 Ga0501075_0039497 Ga0501075_0039497_303_980 220
9 3300049741 Ga0501079_0067639 Ga0501079_0067639_1536_2213 220
10 3300049742 Ga0501080_0354313 Ga0501080_0354313_503_1180 220
11 3300049743 Ga0501081_0151650 Ga0501081_0151650_166_843 220
12 3300054114 Ga0501084_0200844 Ga0501084_0200844_813_1490 220
13 3300061734 Ga0530510_0003992 Ga0530510_0003992_4588_5265 220
14 3300028573 Ga0265334_10018147 Ga0265334_100181471 231
15 3300028653 Ga0265323_10044126 Ga0265323_100441261 231
16 3300028654 Ga0265322_10023286 Ga0265322_100232862 231
17 3300031235 Ga0265330_10118488 Ga0265330_101184881 231
18 3300031241 Ga0265325_10085301 Ga0265325_100853012 231
19 3300031249 Ga0265339_10124460 Ga0265339_101244602 231
20 3300031344 Ga0265316_10007810 Ga0265316_100078108 231
21 3300053083 Ga0495655_0131456 Ga0495655_0131456_20_733 231
22 3300048917 Ga0496114_0244892 Ga0496114_0244892_490_1215 233
23 3300049741 Ga0501079_0185189 Ga0501079_0185189_11_727 233
24 3300049583 Ga0501067_0127964 Ga0501067_0127964_80_844 239
25 3300049584 Ga0501068_0031253 Ga0501068_0031253_1191_1955 239
26 3300005344 Ga0070661_100420800 Ga0070661_1004208002 241
27 3300005435 Ga0070714_100363878 Ga0070714_1003638781 241
28 3300005518 Ga0070699_100502390 Ga0070699_1005023902 241
29 3300025906 Ga0207699_10219744 Ga0207699_102197442 241
30 3300025929 Ga0207664_10021446 Ga0207664_100214466 241
31 3300039438 Ga0436360_1360884 Ga0436360_1360884_1709_2434 241
32 3300049575 Ga0501039_0125910 Ga0501039_0125910_69_809 241
33 3300049576 Ga0501040_0114159 Ga0501040_0114159_137_907 241
34 3300005337 Ga0070682_100029952 Ga0070682_1000299522 242
35 3300005434 Ga0070709_10037155 Ga0070709_100371552 242
36 3300005436 Ga0070713_100027322 Ga0070713_1000273224 242
37 3300005439 Ga0070711_100007896 Ga0070711_1000078964 242
38 3300005439 Ga0070711_100122110 Ga0070711_1001221102 242
39 3300005444 Ga0070694_100012612 Ga0070694_1000126123 242
40 3300005445 Ga0070708_100048888 Ga0070708_1000488885 242
41 3300005455 Ga0070663_100111222 Ga0070663_1001112222 242
42 3300005456 Ga0070678_100033479 Ga0070678_1000334794 242
43 3300005468 Ga0070707_100057082 Ga0070707_1000570824 242
44 3300005468 Ga0070707_100418420 Ga0070707_1004184202 242
45 3300005518 Ga0070699_100081894 Ga0070699_1000818942 242
46 3300005518 Ga0070699_100242084 Ga0070699_1002420842 242
47 3300005536 Ga0070697_100167309 Ga0070697_1001673092 242
48 3300005536 Ga0070697_100234632 Ga0070697_1002346322 242
49 3300005544 Ga0070686_100109195 Ga0070686_1001091952 242
50 3300005564 Ga0070664_100434627 Ga0070664_1004346272 242
51 3300005615 Ga0070702_100138605 Ga0070702_1001386052 242
52 3300006028 Ga0070717_10106028 Ga0070717_101060283 242
53 3300006163 Ga0070715_10091897 Ga0070715_100918972 242
54 3300006173 Ga0070716_100089394 Ga0070716_1000893943 242
55 3300006173 Ga0070716_100121551 Ga0070716_1001215512 242
56 3300006175 Ga0070712_100001811 Ga0070712_10000181114 242
57 3300006237 Ga0097621_100279823 Ga0097621_1002798232 242
58 3300006358 Ga0068871_100011692 Ga0068871_1000116925 242
59 3300006844 Ga0075428_100038150 Ga0075428_1000381506 242
60 3300006847 Ga0075431_100149835 Ga0075431_1001498352 242
61 3300006852 Ga0075433_10048087 Ga0075433_100480874 242
62 3300006871 Ga0075434_100030130 Ga0075434_1000301304 242
63 3300006871 Ga0075434_100531590 Ga0075434_1005315902 242
64 3300006871 Ga0075434_100739925 Ga0075434_1007399252 242
65 3300007076 Ga0075435_100018129 Ga0075435_1000181294 242
66 3300007076 Ga0075435_100069580 Ga0075435_1000695803 242
67 3300009094 Ga0111539_10268427 Ga0111539_102684273 242
68 3300009098 Ga0105245_11073938 Ga0105245_110739381 242
69 3300009147 Ga0114129_10060303 Ga0114129_100603037 242
70 3300009148 Ga0105243_10255441 Ga0105243_102554412 242
71 3300009174 Ga0105241_10083687 Ga0105241_100836874 242
72 3300009176 Ga0105242_10153474 Ga0105242_101534742 242
73 3300013308 Ga0157375_10430221 Ga0157375_104302212 242
74 3300014969 Ga0157376_10023540 Ga0157376_100235402 242
75 3300025898 Ga0207692_10207451 Ga0207692_102074512 242
76 3300025903 Ga0207680_10095239 Ga0207680_100952393 242
77 3300025906 Ga0207699_10160216 Ga0207699_101602161 242
78 3300025910 Ga0207684_10493335 Ga0207684_104933352 242
79 3300025911 Ga0207654_10036880 Ga0207654_100368803 242
80 3300025915 Ga0207693_10005822 Ga0207693_100058222 242
81 3300025915 Ga0207693_10047070 Ga0207693_100470703 242
82 3300025916 Ga0207663_10017317 Ga0207663_100173172 242
83 3300025916 Ga0207663_10017939 Ga0207663_100179394 242
84 3300025922 Ga0207646_10175714 Ga0207646_101757142 242
85 3300025922 Ga0207646_10329279 Ga0207646_103292792 242
86 3300025922 Ga0207646_10559186 Ga0207646_105591862 242
87 3300025927 Ga0207687_10184562 Ga0207687_101845622 242
88 3300025929 Ga0207664_10082453 Ga0207664_100824532 242
89 3300025938 Ga0207704_10186710 Ga0207704_101867102 242
90 3300025939 Ga0207665_10001916 Ga0207665_1000191610 242
91 3300025939 Ga0207665_10334706 Ga0207665_103347062 242
92 3300026067 Ga0207678_10012020 Ga0207678_100120204 242
93 3300026121 Ga0207683_10001825 Ga0207683_1000182515 242
94 3300026121 Ga0207683_10005063 Ga0207683_100050639 242
95 3300034817 Ga0373948_0017895 Ga0373948_0017895_224_976 242
96 3300034819 Ga0373958_0001625 Ga0373958_0001625_629_1381 242
97 3300034819 Ga0373958_0016169 Ga0373958_0016169_372_1121 242
98 3300034820 Ga0373959_0004094 Ga0373959_0004094_89_841 242
99 3300035084 Ga0373928_0015804 Ga0373928_0015804_517_1266 242
100 3300035090 Ga0373949_0000814 Ga0373949_0000814_398_1150 242
101 3300035091 Ga0373951_0003259 Ga0373951_0003259_75_827 242
102 3300035091 Ga0373951_0040757 Ga0373951_0040757_13_762 242
103 3300035092 Ga0373952_0023321 Ga0373952_0023321_98_850 242
104 3300035112 Ga0373932_0002704 Ga0373932_0002704_2937_3689 242
105 3300035115 Ga0373941_0001643 Ga0373941_0001643_3570_4322 242
106 3300035115 Ga0373941_0014494 Ga0373941_0014494_976_1725 242
107 3300035121 Ga0373960_0007650 Ga0373960_0007650_736_1485 242
108 3300035121 Ga0373960_0076097 Ga0373960_0076097_49_801 242
109 3300035241 Ga0373961_0001622 Ga0373961_0001622_5268_6020 242
110 3300035241 Ga0373961_0006149 Ga0373961_0006149_579_1328 242
111 3300035691 Ga0373931_0008057 Ga0373931_0008057_629_1381 242
112 3300035691 Ga0373931_0008554 Ga0373931_0008554_2353_3102 242
113 3300037312 Ga0395899_0025973 Ga0395899_0025973_3430_4158 242
114 3300037466 Ga0395898_0105046 Ga0395898_0105046_129_857 242
115 3300038443 Ga0395901_0229077 Ga0395901_0229077_112_840 242
116 3300046453 Ga0495627_052207 Ga0495627_052207_293_1045 242
117 3300046458 Ga0495591_052200 Ga0495591_052200_231_983 242
118 3300048904 Ga0496101_0029442 Ga0496101_0029442_824_1576 242
119 3300048906 Ga0496103_0011692 Ga0496103_0011692_269_1018 242
120 3300048907 Ga0496104_0001632 Ga0496104_0001632_575_1327 242
121 3300048907 Ga0496104_0188676 Ga0496104_0188676_740_1489 242
122 3300048909 Ga0496106_0190475 Ga0496106_0190475_377_1129 242
123 3300048910 Ga0496107_0012913 Ga0496107_0012913_696_1448 242
124 3300048911 Ga0496108_0416414 Ga0496108_0416414_159_908 242
125 3300048912 Ga0496109_0047394 Ga0496109_0047394_712_1464 242
126 3300048913 Ga0496110_0161408 Ga0496110_0161408_310_1059 242
127 3300048915 Ga0496112_0043208 Ga0496112_0043208_2322_3071 242
128 3300048915 Ga0496112_0128426 Ga0496112_0128426_399_1151 242
129 3300048916 Ga0496113_0127893 Ga0496113_0127893_679_1428 242
130 3300048918 Ga0496115_0165554 Ga0496115_0165554_157_906 242
131 3300049591 Ga0501075_0281175 Ga0501075_0281175_358_1101 242
132 3300050507 nmdc:mga05p37_75827_c1 nmdc:mga05p37_75827_c1_1451_2203 242
133 3300050510 nmdc:mga06r32_25872_c1 nmdc:mga06r32_25872_c1_481_1239 242
134 3300050512 nmdc:mga0n895_166540_c1 nmdc:mga0n895_166540_c1_636_1388 242
135 3300050512 nmdc:mga0n895_3167_c1 nmdc:mga0n895_3167_c1_4119_4877 242
136 3300050513 nmdc:mga0rr50_4008_c1 nmdc:mga0rr50_4008_c1_7350_8108 242
137 3300050515 nmdc:mga0a205_269499_c1 nmdc:mga0a205_269499_c1_283_1041 242
138 3300005327 Ga0070658_10037509 Ga0070658_100375094 243
139 3300005329 Ga0070683_100039173 Ga0070683_1000391735 243
140 3300005329 Ga0070683_100137158 Ga0070683_1001371581 243
141 3300005329 Ga0070683_100339916 Ga0070683_1003399162 243
142 3300005331 Ga0070670_100078262 Ga0070670_1000782622 243
143 3300005336 Ga0070680_100444660 Ga0070680_1004446602 243
144 3300005337 Ga0070682_100219685 Ga0070682_1002196852 243
145 3300005339 Ga0070660_100002536 Ga0070660_1000025364 243
146 3300005339 Ga0070660_100059265 Ga0070660_1000592654 243
147 3300005339 Ga0070660_100080287 Ga0070660_1000802873 243
148 3300005339 Ga0070660_100460132 Ga0070660_1004601321 243
149 3300005340 Ga0070689_100200122 Ga0070689_1002001222 243
150 3300005344 Ga0070661_100053256 Ga0070661_1000532562 243
151 3300005347 Ga0070668_100006034 Ga0070668_10000603411 243
152 3300005355 Ga0070671_100165482 Ga0070671_1001654823 243
153 3300005355 Ga0070671_100303330 Ga0070671_1003033302 243
154 3300005355 Ga0070671_100475298 Ga0070671_1004752981 243
155 3300005356 Ga0070674_100002662 Ga0070674_1000026625 243
156 3300005356 Ga0070674_100103761 Ga0070674_1001037612 243
157 3300005365 Ga0070688_100006185 Ga0070688_1000061855 243
158 3300005434 Ga0070709_10543970 Ga0070709_105439701 243
159 3300005435 Ga0070714_100045100 Ga0070714_1000451003 243
160 3300005435 Ga0070714_100262081 Ga0070714_1002620812 243
161 3300005440 Ga0070705_100126675 Ga0070705_1001266752 243
162 3300005441 Ga0070700_100018616 Ga0070700_1000186162 243
163 3300005441 Ga0070700_100338249 Ga0070700_1003382492 243
164 3300005444 Ga0070694_100340565 Ga0070694_1003405652 243
165 3300005445 Ga0070708_100439031 Ga0070708_1004390311 243
166 3300005455 Ga0070663_100126861 Ga0070663_1001268612 243
167 3300005456 Ga0070678_100216357 Ga0070678_1002163572 243
168 3300005457 Ga0070662_100012390 Ga0070662_1000123903 243
169 3300005458 Ga0070681_10000568 Ga0070681_100005688 243
170 3300005458 Ga0070681_10016731 Ga0070681_100167313 243
171 3300005458 Ga0070681_10039602 Ga0070681_100396025 243
172 3300005458 Ga0070681_10137606 Ga0070681_101376062 243
173 3300005459 Ga0068867_100315744 Ga0068867_1003157442 243
174 3300005530 Ga0070679_100065848 Ga0070679_1000658482 243
175 3300005530 Ga0070679_100255875 Ga0070679_1002558752 243
176 3300005530 Ga0070679_100271822 Ga0070679_1002718223 243
177 3300005535 Ga0070684_100050693 Ga0070684_1000506933 243
178 3300005535 Ga0070684_100146792 Ga0070684_1001467923 243
179 3300005539 Ga0068853_100071880 Ga0068853_1000718802 243
180 3300005539 Ga0068853_100386489 Ga0068853_1003864892 243
181 3300005543 Ga0070672_100099257 Ga0070672_1000992572 243
182 3300005544 Ga0070686_100033242 Ga0070686_1000332424 243
183 3300005546 Ga0070696_100052533 Ga0070696_1000525334 243
184 3300005546 Ga0070696_100293999 Ga0070696_1002939992 243
185 3300005548 Ga0070665_100018342 Ga0070665_1000183423 243
186 3300005548 Ga0070665_100023734 Ga0070665_1000237342 243
187 3300005563 Ga0068855_100005379 Ga0068855_1000053798 243
188 3300005563 Ga0068855_100089909 Ga0068855_1000899096 243
189 3300005563 Ga0068855_100117772 Ga0068855_1001177722 243
190 3300005563 Ga0068855_100228924 Ga0068855_1002289242 243
191 3300005563 Ga0068855_100311297 Ga0068855_1003112973 243
192 3300005564 Ga0070664_100329845 Ga0070664_1003298452 243
193 3300005577 Ga0068857_100139125 Ga0068857_1001391252 243
194 3300005578 Ga0068854_100173581 Ga0068854_1001735812 243
195 3300005614 Ga0068856_100112734 Ga0068856_1001127342 243
196 3300005614 Ga0068856_100188089 Ga0068856_1001880894 243
197 3300005614 Ga0068856_100216498 Ga0068856_1002164982 243
198 3300005614 Ga0068856_100999603 Ga0068856_1009996031 243
199 3300005616 Ga0068852_100346430 Ga0068852_1003464301 243
200 3300005617 Ga0068859_100181417 Ga0068859_1001814172 243
201 3300005719 Ga0068861_100059776 Ga0068861_1000597762 243
202 3300005842 Ga0068858_100275674 Ga0068858_1002756742 243
203 3300005985 Ga0081539_10004194 Ga0081539_1000419414 243
204 3300006173 Ga0070716_100103431 Ga0070716_1001034312 243
205 3300006175 Ga0070712_100163211 Ga0070712_1001632112 243
206 3300006175 Ga0070712_100164223 Ga0070712_1001642232 243
207 3300006358 Ga0068871_100231697 Ga0068871_1002316971 243
208 3300006847 Ga0075431_100407517 Ga0075431_1004075172 243
209 3300006871 Ga0075434_100004672 Ga0075434_1000046727 243
210 3300006871 Ga0075434_100075233 Ga0075434_1000752332 243
211 3300006881 Ga0068865_100307963 Ga0068865_1003079632 243
212 3300006881 Ga0068865_100403616 Ga0068865_1004036162 243
213 3300006914 Ga0075436_100071616 Ga0075436_1000716162 243
214 3300006931 Ga0097620_100181427 Ga0097620_1001814273 243
215 3300007076 Ga0075435_100056708 Ga0075435_1000567082 243
216 3300007076 Ga0075435_100583320 Ga0075435_1005833201 243
217 3300009093 Ga0105240_10043509 Ga0105240_100435096 243
218 3300009093 Ga0105240_10052634 Ga0105240_100526344 243
219 3300009093 Ga0105240_10691167 Ga0105240_106911672 243
220 3300009098 Ga0105245_10049048 Ga0105245_100490482 243
221 3300009098 Ga0105245_10133451 Ga0105245_101334513 243
222 3300009098 Ga0105245_10386407 Ga0105245_103864072 243
223 3300009148 Ga0105243_10045839 Ga0105243_100458391 243
224 3300009176 Ga0105242_10034315 Ga0105242_100343154 243
225 3300009176 Ga0105242_10077087 Ga0105242_100770873 243
226 3300009176 Ga0105242_10324836 Ga0105242_103248362 243
227 3300009176 Ga0105242_10678394 Ga0105242_106783942 243
228 3300009551 Ga0105238_10113196 Ga0105238_101131962 243
229 3300009551 Ga0105238_10576086 Ga0105238_105760861 243
230 3300009553 Ga0105249_10006293 Ga0105249_100062933 243
231 3300010375 Ga0105239_10176624 Ga0105239_101766242 243
232 3300010375 Ga0105239_10410596 Ga0105239_104105962 243
233 3300010375 Ga0105239_10737580 Ga0105239_107375802 243
234 3300011119 Ga0105246_10285583 Ga0105246_102855831 243
235 3300013100 Ga0157373_10154458 Ga0157373_101544583 243
236 3300013102 Ga0157371_10346259 Ga0157371_103462592 243
237 3300013104 Ga0157370_10027506 Ga0157370_100275066 243
238 3300013104 Ga0157370_10098762 Ga0157370_100987622 243
239 3300013104 Ga0157370_10105605 Ga0157370_101056051 243
240 3300013104 Ga0157370_10133591 Ga0157370_101335912 243
241 3300013104 Ga0157370_10326330 Ga0157370_103263303 243
242 3300013105 Ga0157369_10022920 Ga0157369_100229203 243
243 3300013105 Ga0157369_10051321 Ga0157369_100513216 243
244 3300013105 Ga0157369_10092750 Ga0157369_100927503 243
245 3300013105 Ga0157369_10140483 Ga0157369_101404831 243
246 3300013105 Ga0157369_10217279 Ga0157369_102172794 243
247 3300013105 Ga0157369_10224181 Ga0157369_102241813 243
248 3300013297 Ga0157378_10159384 Ga0157378_101593842 243
249 3300013297 Ga0157378_10326523 Ga0157378_103265232 243
250 3300013306 Ga0163162_10006937 Ga0163162_1000693713 243
251 3300013306 Ga0163162_10535886 Ga0163162_105358862 243
252 3300013307 Ga0157372_10162834 Ga0157372_101628343 243
253 3300013307 Ga0157372_10536955 Ga0157372_105369552 243
254 3300013308 Ga0157375_10140567 Ga0157375_101405673 243
255 3300014325 Ga0163163_10165081 Ga0163163_101650812 243
256 3300014326 Ga0157380_10273576 Ga0157380_102735762 243
257 3300014745 Ga0157377_10004196 Ga0157377_100041963 243
258 3300020069 Ga0197907_10209284 Ga0197907_102092842 243
259 3300020069 Ga0197907_10720309 Ga0197907_107203093 243
260 3300020081 Ga0206354_11238920 Ga0206354_112389201 243
261 3300020082 Ga0206353_10341784 Ga0206353_103417842 243
262 3300020082 Ga0206353_10875716 Ga0206353_108757162 243
263 3300021441 Ga0213871_10011190 Ga0213871_100111904 243
264 3300025898 Ga0207692_10246530 Ga0207692_102465302 243
265 3300025901 Ga0207688_10011008 Ga0207688_100110083 243
266 3300025906 Ga0207699_10461829 Ga0207699_104618292 243
267 3300025909 Ga0207705_10026970 Ga0207705_100269704 243
268 3300025909 Ga0207705_10398182 Ga0207705_103981822 243
269 3300025909 Ga0207705_10456363 Ga0207705_104563631 243
270 3300025910 Ga0207684_10517342 Ga0207684_105173422 243
271 3300025912 Ga0207707_10002326 Ga0207707_100023268 243
272 3300025912 Ga0207707_10014588 Ga0207707_100145883 243
273 3300025912 Ga0207707_10107205 Ga0207707_101072053 243
274 3300025912 Ga0207707_10172742 Ga0207707_101727424 243
275 3300025912 Ga0207707_10376387 Ga0207707_103763872 243
276 3300025913 Ga0207695_10374014 Ga0207695_103740142 243
277 3300025915 Ga0207693_10045821 Ga0207693_100458212 243
278 3300025917 Ga0207660_10176694 Ga0207660_101766942 243
279 3300025919 Ga0207657_10007822 Ga0207657_100078226 243
280 3300025919 Ga0207657_10013279 Ga0207657_100132793 243
281 3300025919 Ga0207657_10015482 Ga0207657_100154828 243
282 3300025919 Ga0207657_10018833 Ga0207657_100188332 243
283 3300025919 Ga0207657_10086618 Ga0207657_100866183 243
284 3300025919 Ga0207657_10093639 Ga0207657_100936392 243
285 3300025919 Ga0207657_10190800 Ga0207657_101908002 243
286 3300025920 Ga0207649_10053723 Ga0207649_100537232 243
287 3300025920 Ga0207649_10303479 Ga0207649_103034792 243
288 3300025921 Ga0207652_10007548 Ga0207652_100075483 243
289 3300025924 Ga0207694_10497252 Ga0207694_104972522 243
290 3300025926 Ga0207659_10294337 Ga0207659_102943372 243
291 3300025927 Ga0207687_10126356 Ga0207687_101263561 243
292 3300025927 Ga0207687_10314410 Ga0207687_103144102 243
293 3300025932 Ga0207690_10038797 Ga0207690_100387975 243
294 3300025932 Ga0207690_10040878 Ga0207690_100408784 243
295 3300025932 Ga0207690_10218469 Ga0207690_102184692 243
296 3300025933 Ga0207706_10016293 Ga0207706_100162932 243
297 3300025934 Ga0207686_10010261 Ga0207686_100102613 243
298 3300025934 Ga0207686_10032916 Ga0207686_100329163 243
299 3300025936 Ga0207670_10068940 Ga0207670_100689403 243
300 3300025937 Ga0207669_10006120 Ga0207669_100061202 243
301 3300025938 Ga0207704_10424260 Ga0207704_104242601 243
302 3300025939 Ga0207665_10040250 Ga0207665_100402503 243
303 3300025940 Ga0207691_10201648 Ga0207691_102016482 243
304 3300025944 Ga0207661_10103517 Ga0207661_101035172 243
305 3300025944 Ga0207661_10193909 Ga0207661_101939092 243
306 3300025944 Ga0207661_10422173 Ga0207661_104221732 243
307 3300025945 Ga0207679_10537083 Ga0207679_105370832 243
308 3300025949 Ga0207667_10055184 Ga0207667_100551843 243
309 3300025949 Ga0207667_10079538 Ga0207667_100795381 243
310 3300025949 Ga0207667_10119381 Ga0207667_101193812 243
311 3300025949 Ga0207667_10189284 Ga0207667_101892842 243
312 3300025949 Ga0207667_10357403 Ga0207667_103574032 243
313 3300025949 Ga0207667_10629109 Ga0207667_106291092 243
314 3300025972 Ga0207668_10003092 Ga0207668_100030922 243
315 3300025981 Ga0207640_10189441 Ga0207640_101894412 243
316 3300026041 Ga0207639_10043629 Ga0207639_100436292 243
317 3300026041 Ga0207639_10106488 Ga0207639_101064882 243
318 3300026041 Ga0207639_10765943 Ga0207639_107659431 243
319 3300026067 Ga0207678_10133887 Ga0207678_101338872 243
320 3300026075 Ga0207708_10006686 Ga0207708_100066867 243
321 3300026075 Ga0207708_10351248 Ga0207708_103512482 243
322 3300026078 Ga0207702_10253443 Ga0207702_102534432 243
323 3300026116 Ga0207674_10153313 Ga0207674_101533132 243
324 3300026118 Ga0207675_100001857 Ga0207675_10000185715 243
325 3300026118 Ga0207675_100056521 Ga0207675_1000565213 243
326 3300026121 Ga0207683_10036267 Ga0207683_100362673 243
327 3300026121 Ga0207683_10069932 Ga0207683_100699323 243
328 3300026142 Ga0207698_10255063 Ga0207698_102550632 243
329 3300028379 Ga0268266_10691908 Ga0268266_106919081 243
330 3300028556 Ga0265337_1041241 Ga0265337_10412411 243
331 3300028558 Ga0265326_10007725 Ga0265326_100077251 243
332 3300028563 Ga0265319_1009258 Ga0265319_10092586 243
333 3300028563 Ga0265319_1031619 Ga0265319_10316192 243
334 3300028563 Ga0265319_1034046 Ga0265319_10340464 243
335 3300028573 Ga0265334_10010181 Ga0265334_100101813 243
336 3300028573 Ga0265334_10031091 Ga0265334_100310912 243
337 3300028577 Ga0265318_10000309 Ga0265318_1000030912 243
338 3300028577 Ga0265318_10037010 Ga0265318_100370103 243
339 3300028654 Ga0265322_10013664 Ga0265322_100136643 243
340 3300028654 Ga0265322_10018793 Ga0265322_100187933 243
341 3300028800 Ga0265338_10005865 Ga0265338_100058652 243
342 3300028800 Ga0265338_10044225 Ga0265338_100442252 243
343 3300031235 Ga0265330_10000870 Ga0265330_1000087014 243
344 3300031235 Ga0265330_10069744 Ga0265330_100697443 243
345 3300031238 Ga0265332_10002376 Ga0265332_100023769 243
346 3300031238 Ga0265332_10041555 Ga0265332_100415552 243
347 3300031239 Ga0265328_10012325 Ga0265328_100123254 243
348 3300031240 Ga0265320_10050362 Ga0265320_100503625 243
349 3300031241 Ga0265325_10017489 Ga0265325_100174892 243
350 3300031241 Ga0265325_10038629 Ga0265325_100386292 243
351 3300031242 Ga0265329_10004530 Ga0265329_100045304 243
352 3300031242 Ga0265329_10017967 Ga0265329_100179674 243
353 3300031247 Ga0265340_10001918 Ga0265340_100019188 243
354 3300031249 Ga0265339_10004868 Ga0265339_100048683 243
355 3300031250 Ga0265331_10043121 Ga0265331_100431213 243
356 3300031251 Ga0265327_10008952 Ga0265327_100089527 243
357 3300031251 Ga0265327_10017100 Ga0265327_100171004 243
358 3300031344 Ga0265316_10006271 Ga0265316_1000627111 243
359 3300031344 Ga0265316_10011079 Ga0265316_100110798 243
360 3300031344 Ga0265316_10042434 Ga0265316_100424343 243
361 3300031595 Ga0265313_10002480 Ga0265313_1000248012 243
362 3300031711 Ga0265314_10011637 Ga0265314_100116379 243
363 3300031711 Ga0265314_10060102 Ga0265314_100601021 243
364 3300031711 Ga0265314_10099542 Ga0265314_100995422 243
365 3300031712 Ga0265342_10008532 Ga0265342_100085325 243
366 3300035113 Ga0373936_0024748 Ga0373936_0024748_265_1014 243
367 3300035116 Ga0373945_0001307 Ga0373945_0001307_3932_4681 243
368 3300035172 Ga0373955_0146037 Ga0373955_0146037_157_906 243
369 3300035692 Ga0373935_0032325 Ga0373935_0032325_1090_1839 243
370 3300035725 Ga0373947_0008210 Ga0373947_0008210_3486_4235 243
371 3300037068 Ga0373925_0027015 Ga0373925_0027015_846_1595 243
372 3300037312 Ga0395899_0018595 Ga0395899_0018595_2692_3423 243
373 3300037312 Ga0395899_0258470 Ga0395899_0258470_290_1021 243
374 3300037418 Ga0395900_0124732 Ga0395900_0124732_1231_2058 243
375 3300037418 Ga0395900_0194218 Ga0395900_0194218_866_1597 243
376 3300037418 Ga0395900_0522391 Ga0395900_0522391_342_1094 243
377 3300037466 Ga0395898_0004841 Ga0395898_0004841_2344_3075 243
378 3300037466 Ga0395898_0065835 Ga0395898_0065835_278_1048 243
379 3300037466 Ga0395898_0224192 Ga0395898_0224192_1001_1732 243
380 3300037466 Ga0395898_0342885 Ga0395898_0342885_50_799 243
381 3300037466 Ga0395898_0512484 Ga0395898_0512484_268_1020 243
382 3300037471 Ga0395905_0027947 Ga0395905_0027947_1323_2054 243
383 3300037853 Ga0436364_0818372 Ga0436364_0818372_231_962 243
384 3300037853 Ga0436364_0958456 Ga0436364_0958456_197_928 243
385 3300038443 Ga0395901_0012209 Ga0395901_0012209_4234_4965 243
386 3300038443 Ga0395901_0561279 Ga0395901_0561279_92_841 243
387 3300039437 Ga0436365_0636617 Ga0436365_0636617_658_1389 243
388 3300039438 Ga0436360_0546867 Ga0436360_0546867_394_1125 243
389 3300039450 Ga0436363_0706773 Ga0436363_0706773_267_998 243
390 3300044656 Ga0466969_0036211 Ga0466969_0036211_145_876 243
391 3300044684 Ga0466966_0006197 Ga0466966_0006197_762_1493 243
392 3300044684 Ga0466966_0054166 Ga0466966_0054166_1250_2005 243
393 3300044693 Ga0466961_0019108 Ga0466961_0019108_3384_4133 243
394 3300044693 Ga0466961_0150549 Ga0466961_0150549_198_929 243
395 3300044693 Ga0466961_0376808 Ga0466961_0376808_88_837 243
396 3300044694 Ga0466963_0006255 Ga0466963_0006255_4669_5400 243
397 3300044694 Ga0466963_0057101 Ga0466963_0057101_72_821 243
398 3300044694 Ga0466963_0112075 Ga0466963_0112075_564_1313 243
399 3300044694 Ga0466963_0126509 Ga0466963_0126509_235_966 243
400 3300044694 Ga0466963_0133964 Ga0466963_0133964_121_882 243
401 3300044694 Ga0466963_0191244 Ga0466963_0191244_489_1220 243
402 3300044735 Ga0466968_0019512 Ga0466968_0019512_973_1722 243
403 3300044735 Ga0466968_0023638 Ga0466968_0023638_748_1479 243
404 3300045049 Ga0466959_0004473 Ga0466959_0004473_5551_6282 243
405 3300045049 Ga0466959_0007161 Ga0466959_0007161_2568_3299 243
406 3300045049 Ga0466959_0289847 Ga0466959_0289847_127_858 243
407 3300045836 Ga0466958_0046677 Ga0466958_0046677_636_1385 243
408 3300045976 Ga0466967_0000274 Ga0466967_0000274_4401_5150 243
409 3300045976 Ga0466967_0004211 Ga0466967_0004211_4500_5249 243
410 3300045976 Ga0466967_0009135 Ga0466967_0009135_4918_5667 243
411 3300045976 Ga0466967_0017774 Ga0466967_0017774_650_1399 243
412 3300045976 Ga0466967_0037850 Ga0466967_0037850_92_823 243
413 3300045976 Ga0466967_0123550 Ga0466967_0123550_35_787 243
414 3300045976 Ga0466967_0139411 Ga0466967_0139411_1042_1773 243
415 3300045976 Ga0466967_0419584 Ga0466967_0419584_256_987 243
416 3300046474 Ga0495605_0159123 Ga0495605_0159123_179_928 243
417 3300046516 Ga0495628_0234175 Ga0495628_0234175_478_1227 243
418 3300046615 Ga0495656_0071220 Ga0495656_0071220_666_1418 243
419 3300046678 Ga0495599_0121597 Ga0495599_0121597_276_1025 243
420 3300047315 Ga0495581_0156513 Ga0495581_0156513_274_1023 243
421 3300048903 Ga0496100_0005099 Ga0496100_0005099_5654_6385 243
422 3300048904 Ga0496101_0003495 Ga0496101_0003495_2209_2958 243
423 3300048904 Ga0496101_0020212 Ga0496101_0020212_1968_2699 243
424 3300048905 Ga0496102_0013964 Ga0496102_0013964_4448_5197 243
425 3300048905 Ga0496102_0764870 Ga0496102_0764870_101_850 243
426 3300048906 Ga0496103_0042576 Ga0496103_0042576_1503_2252 243
427 3300048906 Ga0496103_0060498 Ga0496103_0060498_1092_1841 243
428 3300048907 Ga0496104_0060621 Ga0496104_0060621_791_1522 243
429 3300048908 Ga0496105_0001516 Ga0496105_0001516_10797_11528 243
430 3300048909 Ga0496106_0005968 Ga0496106_0005968_1731_2480 243
431 3300048910 Ga0496107_0003768 Ga0496107_0003768_5617_6348 243
432 3300048910 Ga0496107_0008722 Ga0496107_0008722_3794_4543 243
433 3300048911 Ga0496108_0008962 Ga0496108_0008962_2905_3636 243
434 3300048912 Ga0496109_0012997 Ga0496109_0012997_3381_4112 243
435 3300048912 Ga0496109_0818226 Ga0496109_0818226_94_846 243
436 3300048913 Ga0496110_0014389 Ga0496110_0014389_1736_2467 243
437 3300048913 Ga0496110_0065042 Ga0496110_0065042_1604_2356 243
438 3300048913 Ga0496110_0298900 Ga0496110_0298900_28_777 243
439 3300048914 Ga0496111_0063770 Ga0496111_0063770_548_1279 243
440 3300048915 Ga0496112_0023915 Ga0496112_0023915_4226_4975 243
441 3300048915 Ga0496112_0030821 Ga0496112_0030821_107_856 243
442 3300048915 Ga0496112_0062230 Ga0496112_0062230_2692_3441 243
443 3300048915 Ga0496112_0203143 Ga0496112_0203143_921_1652 243
444 3300048915 Ga0496112_0547826 Ga0496112_0547826_194_943 243
445 3300048916 Ga0496113_0073506 Ga0496113_0073506_774_1523 243
446 3300048916 Ga0496113_0337194 Ga0496113_0337194_234_965 243
447 3300048917 Ga0496114_0008381 Ga0496114_0008381_2506_3237 243
448 3300048918 Ga0496115_0003191 Ga0496115_0003191_4332_5063 243
449 3300049568 Ga0501031_0008249 Ga0501031_0008249_4029_4775 243
450 3300049570 Ga0501033_0051980 Ga0501033_0051980_131_877 243
451 3300049572 Ga0501036_0003201 Ga0501036_0003201_11416_12162 243
452 3300049573 Ga0501037_0116581 Ga0501037_0116581_1160_1906 243
453 3300049574 Ga0501038_0044567 Ga0501038_0044567_2429_3175 243
454 3300049575 Ga0501039_0000813 Ga0501039_0000813_9033_9779 243
455 3300049575 Ga0501039_0107346 Ga0501039_0107346_375_1121 243
456 3300049576 Ga0501040_0025885 Ga0501040_0025885_1466_2212 243
457 3300049576 Ga0501040_0040040 Ga0501040_0040040_1638_2384 243
458 3300049576 Ga0501040_0200529 Ga0501040_0200529_642_1394 243
459 3300049577 Ga0501041_0021520 Ga0501041_0021520_1693_2439 243
460 3300049577 Ga0501041_0092869 Ga0501041_0092869_441_1187 243
461 3300049577 Ga0501041_0210868 Ga0501041_0210868_431_1177 243
462 3300049577 Ga0501041_0305840 Ga0501041_0305840_176_922 243
463 3300049578 Ga0501042_0031079 Ga0501042_0031079_2743_3489 243
464 3300049579 Ga0501043_0049330 Ga0501043_0049330_132_878 243
465 3300049580 Ga0501046_0005021 Ga0501046_0005021_10669_11415 243
466 3300049582 Ga0501048_0007353 Ga0501048_0007353_3927_4673 243
467 3300049582 Ga0501048_0068642 Ga0501048_0068642_870_1622 243
468 3300049583 Ga0501067_0000043 Ga0501067_0000043_61058_61816 243
469 3300049584 Ga0501068_0009376 Ga0501068_0009376_548_1306 243
470 3300049584 Ga0501068_0010101 Ga0501068_0010101_3535_4281 243
471 3300049585 Ga0501069_0000188 Ga0501069_0000188_19400_20158 243
472 3300049585 Ga0501069_0058607 Ga0501069_0058607_805_1551 243
473 3300049585 Ga0501069_0122748 Ga0501069_0122748_578_1336 243
474 3300049586 Ga0501070_0001185 Ga0501070_0001185_18772_19503 243
475 3300049586 Ga0501070_0062413 Ga0501070_0062413_427_1158 243
476 3300049586 Ga0501070_0623664 Ga0501070_0623664_74_820 243
477 3300049587 Ga0501071_0002003 Ga0501071_0002003_172_918 243
478 3300049587 Ga0501071_0015118 Ga0501071_0015118_2000_2746 243
479 3300049587 Ga0501071_0021661 Ga0501071_0021661_3151_3909 243
480 3300049587 Ga0501071_0029079 Ga0501071_0029079_2854_3600 243
481 3300049587 Ga0501071_0064691 Ga0501071_0064691_1691_2437 243
482 3300049587 Ga0501071_0101057 Ga0501071_0101057_1037_1783 243
483 3300049587 Ga0501071_0574698 Ga0501071_0574698_64_810 243
484 3300049588 Ga0501072_0001289 Ga0501072_0001289_13129_13875 243
485 3300049588 Ga0501072_0002381 Ga0501072_0002381_10771_11517 243
486 3300049588 Ga0501072_0022249 Ga0501072_0022249_37_783 243
487 3300049590 Ga0501074_0028236 Ga0501074_0028236_3185_3931 243
488 3300049590 Ga0501074_0112404 Ga0501074_0112404_361_1107 243
489 3300049590 Ga0501074_0191400 Ga0501074_0191400_20_766 243
490 3300049590 Ga0501074_0548480 Ga0501074_0548480_60_791 243
491 3300049591 Ga0501075_0004991 Ga0501075_0004991_4155_4901 243
492 3300049591 Ga0501075_0007456 Ga0501075_0007456_2668_3414 243
493 3300049591 Ga0501075_0038730 Ga0501075_0038730_1867_2613 243
494 3300049591 Ga0501075_0067772 Ga0501075_0067772_990_1736 243
495 3300049591 Ga0501075_0068735 Ga0501075_0068735_83_829 243
496 3300049591 Ga0501075_0171701 Ga0501075_0171701_330_1082 243
497 3300049591 Ga0501075_0216170 Ga0501075_0216170_46_792 243
498 3300049591 Ga0501075_0232002 Ga0501075_0232002_342_1088 243
499 3300049592 Ga0501076_0012517 Ga0501076_0012517_263_1009 243
500 3300049592 Ga0501076_0014450 Ga0501076_0014450_684_1430 243
501 3300049592 Ga0501076_0072510 Ga0501076_0072510_1846_2592 243
502 3300049592 Ga0501076_0100482 Ga0501076_0100482_895_1641 243
503 3300049592 Ga0501076_0697061 Ga0501076_0697061_42_809 243
504 3300049593 Ga0501077_0011731 Ga0501077_0011731_2434_3180 243
505 3300049593 Ga0501077_0035477 Ga0501077_0035477_1360_2106 243
506 3300049593 Ga0501077_0061174 Ga0501077_0061174_851_1597 243
507 3300049741 Ga0501079_0020211 Ga0501079_0020211_3230_3976 243
508 3300049741 Ga0501079_0084612 Ga0501079_0084612_12_758 243
509 3300049741 Ga0501079_0178036 Ga0501079_0178036_128_874 243
510 3300049741 Ga0501079_0187656 Ga0501079_0187656_512_1258 243
511 3300049742 Ga0501080_0375812 Ga0501080_0375812_413_1144 243
512 3300049742 Ga0501080_0398398 Ga0501080_0398398_352_1098 243
513 3300049743 Ga0501081_0001923 Ga0501081_0001923_10540_11286 243
514 3300049743 Ga0501081_0024278 Ga0501081_0024278_1506_2252 243
515 3300049743 Ga0501081_0036689 Ga0501081_0036689_53_799 243
516 3300049743 Ga0501081_0114303 Ga0501081_0114303_757_1524 243
517 3300049743 Ga0501081_0120828 Ga0501081_0120828_908_1654 243
518 3300049744 Ga0501083_0047328 Ga0501083_0047328_314_1060 243
519 3300049824 Ga0501045_0012691 Ga0501045_0012691_1735_2481 243
520 3300049824 Ga0501045_0023536 Ga0501045_0023536_1891_2637 243
521 3300049824 Ga0501045_0075614 Ga0501045_0075614_1090_1836 243
522 3300049824 Ga0501045_0108660 Ga0501045_0108660_705_1451 243
523 3300049824 Ga0501045_0149883 Ga0501045_0149883_157_909 243
524 3300050507 nmdc:mga05p37_873642_c1 nmdc:mga05p37_873642_c1_149_910 243
525 3300050512 nmdc:mga0n895_267436_c1 nmdc:mga0n895_267436_c1_62_823 243
526 3300050512 nmdc:mga0n895_3940_c1 nmdc:mga0n895_3940_c1_3593_4351 243
527 3300050512 nmdc:mga0n895_72807_c1 nmdc:mga0n895_72807_c1_1322_2071 243
528 3300050513 nmdc:mga0rr50_16878_c1 nmdc:mga0rr50_16878_c1_3956_4714 243
529 3300050513 nmdc:mga0rr50_7317_c1 nmdc:mga0rr50_7317_c1_4860_5609 243
530 3300050514 nmdc:mga08x19_74181_c1 nmdc:mga08x19_74181_c1_1314_2072 243
531 3300053077 Ga0495601_0443431 Ga0495601_0443431_23_775 243
532 3300054114 Ga0501084_0004379 Ga0501084_0004379_6427_7173 243
533 3300054114 Ga0501084_0028493 Ga0501084_0028493_3768_4514 243
534 3300054114 Ga0501084_0068326 Ga0501084_0068326_950_1696 243
535 3300054114 Ga0501084_0154946 Ga0501084_0154946_815_1561 243
536 3300060353 Ga0501082_0011225 Ga0501082_0011225_806_1552 243
537 3300060353 Ga0501082_0223556 Ga0501082_0223556_198_944 243
538 3300061734 Ga0530510_0001083 Ga0530510_0001083_10263_11021 243
539 3300061734 Ga0530510_0001483 Ga0530510_0001483_1297_2043 243
540 3300061734 Ga0530510_0009880 Ga0530510_0009880_4874_5620 243
541 3300061734 Ga0530510_0112589 Ga0530510_0112589_1037_1783 243

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

76

291

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f67-assembly1.cif.gz_A crystal structure of putative dienelactone hydrolase from klebsiella pneumoniae subsp. pneumoniae mgh 78578 0.8664 18 242
4zv9-assembly6.cif.gz_F 2.00 angstrom resolution crystal structure of an uncharacterized protein from escherichia coli o157:h7 str. sakai 0.8468 19 243
7jiz-assembly1.cif.gz_B dienelactone hydrolase family protein scdlh from solimonas sp. k1w22b-7 0.8356 18 242
4zi5-assembly1.cif.gz_B crystal structure of dienelactone hydrolase-like promiscuous phospotriesterase p91 from metagenomic libraries 0.8331 18 242
1din-assembly1.cif.gz_A dienelactone hydrolase at 2.8 angstroms 0.824 12 242
ID Description Score Start End Superfamily
af_Q5AI87_1_234_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.882 36 243 3.40.50.1820
af_A0A1P8AZN3_78_316_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8548 21 243 3.40.50.1820
af_Q18927_1_243_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8529 18 243 3.40.50.1820
3f67A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8502 18 242 3.40.50.1820
4zi5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8448 18 242 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A538GDI7-F1-model_v4 Dienelactone hydrolase family protein 0.9922 72 243 GO:0016787
AF-A0A2W4MFV4-F1-model_v4 Dienelactone hydrolase family protein 0.9885 115 243 GO:0016787
AF-A0A538GDI7-F1-model_v4 Dienelactone hydrolase family protein 0.9865 72 243 GO:0016787
AF-A0A6I1QIY9-F1-model_v4 Dienelactone hydrolase family protein 0.9771 1 239 GO:0016787
AF-A0A538DXJ4-F1-model_v4 Dienelactone hydrolase family protein 0.9762 1 210 GO:0016787

Feature Viewer

pLDDT pTM Quality
95.25 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map