F461334

General Info

Members Datasets Scaffolds Average Seq Length
541 251 1082 111

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100288606|Ga0070665_1002886062
Length 118
Sequence MPVRGSRQDRIELLQGTLDLLILQTLQWGPQHGYGIGNAIRAHSGELLQVETGSLYPALHRLARQGWVKSEWKQTEAGQRAKFYRLTAAGKKQLLSERSRWEQLVGAMTGVLSRKTEA

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
110 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
111 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
166 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
168 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
170 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
171 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
172 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
173 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
174 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
175 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
176 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
178 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
179 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
183 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
184 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
185 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
186 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
187 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
188 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
189 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
190 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
191 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
192 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
195 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
196 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
197 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
198 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
199 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
200 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
201 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
202 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
203 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
204 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
205 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
206 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
207 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
208 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
209 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
210 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
211 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
212 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
213 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
214 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
215 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
216 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
217 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
218 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
219 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
220 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
221 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
222 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
223 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
229 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
230 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
231 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
232 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
233 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
234 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
235 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
236 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
237 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
241 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
242 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
243 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
244 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
245 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
246 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
247 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
248 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
249 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
250 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
251 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.14
Rhizosphere 93.35
Stem 0
Stem Tuber 0
Unclassified 39.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100288606 3300005548 Unclassified 1643
2 Ga0065714_10330814 3300005288 Unclassified 631
3 Ga0065712_10079718 3300005290 Bacteria 3186
4 Ga0065712_10127733 3300005290 Bacteria 1572
5 Ga0065715_10221334 3300005293 Unclassified 1271
6 Ga0070658_10934067 3300005327 Unclassified 754
7 Ga0070683_100000062 3300005329 Bacteria 80629
8 Ga0070683_100000833 3300005329 Bacteria 22863
9 Ga0070683_100103944 3300005329 Unclassified 2677
10 Ga0070683_100635100 3300005329 Unclassified 1022
11 Ga0070670_100027286 3300005331 Bacteria 4912
12 Ga0070670_100043203 3300005331 Bacteria 3875
13 Ga0070670_100627941 3300005331 Unclassified 963
14 Ga0068869_100998342 3300005334 Unclassified 729
15 Ga0070666_10165722 3300005335 Unclassified 1546
16 Ga0070682_101077687 3300005337 Unclassified 671
17 Ga0068868_100515890 3300005338 Unclassified 1049
18 Ga0070660_101896603 3300005339 Unclassified 508
19 Ga0070689_100807460 3300005340 Bacteria 825
20 Ga0070689_101128079 3300005340 Unclassified 702
21 Ga0070689_101834293 3300005340 Unclassified 553
22 Ga0070687_100801899 3300005343 Unclassified 667
23 Ga0070661_100017522 3300005344 Bacteria 5083
24 Ga0070692_10909421 3300005345 Unclassified 609
25 Ga0070668_100147091 3300005347 Bacteria 1902
26 Ga0070669_100105605 3300005353 Bacteria 2131
27 Ga0070675_100030333 3300005354 Bacteria 4366
28 Ga0070675_100797554 3300005354 Bacteria 863
29 Ga0070671_100057246 3300005355 Bacteria 3244
30 Ga0070671_100895531 3300005355 Unclassified 775
31 Ga0070674_100650271 3300005356 Bacteria 896
32 Ga0070673_100153591 3300005364 Bacteria 1951
33 Ga0070673_100253423 3300005364 Bacteria 1535
34 Ga0070673_100742167 3300005364 Unclassified 904
35 Ga0070688_100033525 3300005365 Bacteria 3105
36 Ga0070688_100452710 3300005365 Unclassified 960
37 Ga0070688_101727302 3300005365 Unclassified 513
38 Ga0070659_100052322 3300005366 Bacteria 3211
39 Ga0070667_100228910 3300005367 Bacteria 1657
40 Ga0070709_10369586 3300005434 Bacteria 1064
41 Ga0070714_100025618 3300005435 Bacteria 4869
42 Ga0070714_100479069 3300005435 Bacteria 1185
43 Ga0070713_100876805 3300005436 Unclassified 862
44 Ga0070713_101466660 3300005436 Unclassified 662
45 Ga0070713_101718798 3300005436 Unclassified 609
46 Ga0070701_10419677 3300005438 Unclassified 852
47 Ga0070701_11411247 3300005438 Unclassified 501
48 Ga0070711_101259479 3300005439 Unclassified 641
49 Ga0070700_100507153 3300005441 Bacteria 929
50 Ga0070700_100974120 3300005441 Unclassified 695
51 Ga0070708_100139379 3300005445 Bacteria 2248
52 Ga0070663_100262097 3300005455 Unclassified 1371
53 Ga0070678_101313961 3300005456 Unclassified 673
54 Ga0070662_100065139 3300005457 Bacteria 2671
55 Ga0070662_100919800 3300005457 Bacteria 747
56 Ga0070681_10131505 3300005458 Bacteria 2435
57 Ga0070681_10893532 3300005458 Bacteria 807
58 Ga0070681_11857317 3300005458 Unclassified 530
59 Ga0068867_100700494 3300005459 Bacteria 894
60 Ga0068867_100893844 3300005459 Bacteria 799
61 Ga0068867_101147543 3300005459 Bacteria 711
62 Ga0070685_11500290 3300005466 Bacteria 519
63 Ga0070706_101116757 3300005467 Bacteria 726
64 Ga0070707_100049432 3300005468 Bacteria 4031
65 Ga0070707_100281991 3300005468 Bacteria 1614
66 Ga0070698_100003038 3300005471 Bacteria 18493
67 Ga0070698_100542459 3300005471 Unclassified 1102
68 Ga0070699_100243024 3300005518 Bacteria 1607
69 Ga0070699_100251896 3300005518 Bacteria 1578
70 Ga0070699_100708599 3300005518 Unclassified 920
71 Ga0070699_100745422 3300005518 Unclassified 896
72 Ga0070679_100159976 3300005530 Bacteria 2226
73 Ga0070679_100260285 3300005530 Unclassified 1690
74 Ga0070684_100000227 3300005535 Bacteria 39007
75 Ga0070684_100003925 3300005535 Bacteria 11266
76 Ga0070684_100186753 3300005535 Bacteria 1885
77 Ga0070697_100739840 3300005536 Bacteria 869
78 Ga0068853_102352030 3300005539 Unclassified 516
79 Ga0070672_100210857 3300005543 Bacteria 1627
80 Ga0070695_100113160 3300005545 Unclassified 1845
81 Ga0070695_101574222 3300005545 Bacteria 548
82 Ga0070696_100989435 3300005546 Unclassified 702
83 Ga0070665_100079501 3300005548 Bacteria 3285
84 Ga0070665_100306239 3300005548 Unclassified 1592
85 Ga0070665_100376385 3300005548 Unclassified 1427
86 Ga0070665_100435393 3300005548 Bacteria 1320
87 Ga0070665_100476310 3300005548 Bacteria 1259
88 Ga0070665_101076316 3300005548 Bacteria 816
89 Ga0070665_101181758 3300005548 Bacteria 776
90 Ga0070665_101627672 3300005548 Unclassified 653
91 Ga0070704_101652874 3300005549 Unclassified 591
92 Ga0068855_100141341 3300005563 Bacteria 2744
93 Ga0068855_101792873 3300005563 Unclassified 624
94 Ga0070664_100043876 3300005564 Bacteria 3775
95 Ga0070664_100071451 3300005564 Bacteria 2974
96 Ga0068857_101177365 3300005577 Bacteria 742
97 Ga0068854_100907181 3300005578 Bacteria 775
98 Ga0068856_101489055 3300005614 Bacteria 691
99 Ga0068852_100716518 3300005616 Unclassified 1011
100 Ga0068852_101837320 3300005616 Unclassified 628
101 Ga0068859_100406799 3300005617 Unclassified 1457
102 Ga0068859_100775073 3300005617 Unclassified 1047
103 Ga0068859_101607181 3300005617 Bacteria 718
104 Ga0068859_102532400 3300005617 Bacteria 565
105 Ga0068864_100691679 3300005618 Bacteria 996
106 Ga0068864_101515393 3300005618 Unclassified 674
107 Ga0068864_102012651 3300005618 Bacteria 584
108 Ga0068851_10537044 3300005834 Unclassified 705
109 Ga0068870_10191990 3300005840 Bacteria 1233
110 Ga0068863_100262245 3300005841 Bacteria 1671
111 Ga0068858_100425480 3300005842 Bacteria 1277
112 Ga0068860_100532672 3300005843 Bacteria 1175
113 Ga0068860_100581955 3300005843 Bacteria 1124
114 Ga0068860_101063038 3300005843 Bacteria 828
115 Ga0068862_100038561 3300005844 Bacteria 4053
116 Ga0068862_100694824 3300005844 Bacteria 985
117 Ga0068862_101040156 3300005844 Bacteria 811
118 Ga0068862_101111636 3300005844 Bacteria 786
119 Ga0068862_101979463 3300005844 Bacteria 593
120 Ga0081455_10043986 3300005937 Bacteria 3901
121 Ga0081455_10108658 3300005937 Bacteria 2208
122 Ga0081455_10396922 3300005937 Unclassified 958
123 Ga0081455_10446848 3300005937 Bacteria 884
124 Ga0081540_1164594 3300005983 Bacteria 855
125 Ga0070717_10155357 3300006028 Bacteria 1982
126 Ga0070717_10277103 3300006028 Bacteria 1487
127 Ga0070717_10285419 3300006028 Bacteria 1465
128 Ga0070716_100203467 3300006173 Unclassified 1318
129 Ga0070712_101086896 3300006175 Unclassified 694
130 Ga0097621_100024411 3300006237 Unclassified 4720
131 Ga0097621_101486282 3300006237 Unclassified 643
132 Ga0068871_100060884 3300006358 Bacteria 3080
133 Ga0068871_100407947 3300006358 Unclassified 1211
134 Ga0068871_101424126 3300006358 Bacteria 654
135 Ga0068871_101815760 3300006358 Bacteria 579
136 Ga0068871_102007271 3300006358 Unclassified 551
137 Ga0068871_102043247 3300006358 Unclassified 546
138 Ga0075428_100004937 3300006844 Bacteria 14811
139 Ga0075428_100014900 3300006844 Bacteria 8638
140 Ga0075428_100162826 3300006844 Unclassified 2421
141 Ga0075428_100887701 3300006844 Unclassified 946
142 Ga0075430_100043972 3300006846 Bacteria 3777
143 Ga0075430_100173364 3300006846 Unclassified 1795
144 Ga0075430_100499793 3300006846 Bacteria 1004
145 Ga0075430_100693629 3300006846 Unclassified 839
146 Ga0075431_100010890 3300006847 Bacteria 9148
147 Ga0075431_100086164 3300006847 Unclassified 3241
148 Ga0075431_100155209 3300006847 Bacteria 2355
149 Ga0075431_101003137 3300006847 Unclassified 802
150 Ga0075431_101216766 3300006847 Bacteria 716
151 Ga0075434_100016876 3300006871 Bacteria 7023
152 Ga0075434_100538947 3300006871 Bacteria 1187
153 Ga0075434_100668227 3300006871 Bacteria 1057
154 Ga0075434_101643438 3300006871 Unclassified 651
155 Ga0075429_100023077 3300006880 Bacteria 5395
156 Ga0075429_100107187 3300006880 Bacteria 2442
157 Ga0075429_101535206 3300006880 Bacteria 579
158 Ga0075436_100748444 3300006914 Unclassified 726
159 Ga0075436_101548069 3300006914 Unclassified 504
160 Ga0097620_100406827 3300006931 Unclassified 1457
161 Ga0097620_100775004 3300006931 Unclassified 1047
162 Ga0097620_101607608 3300006931 Bacteria 718
163 Ga0097620_102532807 3300006931 Bacteria 565
164 Ga0075435_100186804 3300007076 Unclassified 1753
165 Ga0105240_10000903 3300009093 Bacteria 53014
166 Ga0105240_10019360 3300009093 Bacteria 9096
167 Ga0105240_10079222 3300009093 Unclassified 4043
168 Ga0105240_12421883 3300009093 Unclassified 543
169 Ga0111539_10004149 3300009094 Bacteria 18996
170 Ga0111539_11295626 3300009094 Unclassified 846
171 Ga0111539_11805160 3300009094 Unclassified 709
172 Ga0105245_10002114 3300009098 Bacteria 17985
173 Ga0105245_10323105 3300009098 Bacteria 1521
174 Ga0105245_10485935 3300009098 Bacteria 1249
175 Ga0105245_10494182 3300009098 Bacteria 1239
176 Ga0105245_10944115 3300009098 Bacteria 905
177 Ga0105245_10960805 3300009098 Bacteria 898
178 Ga0105245_11131187 3300009098 Unclassified 830
179 Ga0105245_11261916 3300009098 Bacteria 787
180 Ga0105247_10300241 3300009101 Bacteria 1114
181 Ga0105247_11027673 3300009101 Bacteria 645
182 Ga0114129_10044417 3300009147 Bacteria 6251
183 Ga0114129_10129968 3300009147 Bacteria 3460
184 Ga0114129_10318540 3300009147 Bacteria 2068
185 Ga0114129_11614198 3300009147 Bacteria 794
186 Ga0114129_11956832 3300009147 Unclassified 710
187 Ga0114129_12890655 3300009147 Bacteria 568
188 Ga0105243_11497738 3300009148 Bacteria 698
189 Ga0105241_10048005 3300009174 Bacteria 3247
190 Ga0105241_10906488 3300009174 Unclassified 819
191 Ga0105241_10931096 3300009174 Bacteria 809
192 Ga0105241_10978018 3300009174 Bacteria 790
193 Ga0105241_11734848 3300009174 Unclassified 608
194 Ga0105241_11771275 3300009174 Bacteria 602
195 Ga0105241_12261043 3300009174 Bacteria 540
196 Ga0105241_12671883 3300009174 Unclassified 502
197 Ga0105242_10029983 3300009176 Unclassified 4342
198 Ga0105242_10110360 3300009176 Bacteria 2343
199 Ga0105242_11458001 3300009176 Bacteria 714
200 Ga0105242_11484053 3300009176 Bacteria 708
201 Ga0105248_10036603 3300009177 Bacteria 5489
202 Ga0105248_10257635 3300009177 Unclassified 1964
203 Ga0105248_11011042 3300009177 Bacteria 939
204 Ga0105248_11551337 3300009177 Bacteria 750
205 Ga0105248_11683975 3300009177 Bacteria 719
206 Ga0105248_11758577 3300009177 Bacteria 703
207 Ga0105237_10010866 3300009545 Bacteria 9659
208 Ga0105237_10151013 3300009545 Bacteria 2319
209 Ga0105237_10494802 3300009545 Bacteria 1229
210 Ga0105237_10686319 3300009545 Unclassified 1031
211 Ga0105237_11205768 3300009545 Unclassified 763
212 Ga0105237_12170779 3300009545 Unclassified 565
213 Ga0105238_10113081 3300009551 Bacteria 2695
214 Ga0105238_10115292 3300009551 Bacteria 2666
215 Ga0105238_10140343 3300009551 Unclassified 2393
216 Ga0105238_10894729 3300009551 Bacteria 906
217 Ga0105238_10905676 3300009551 Bacteria 900
218 Ga0105238_11684801 3300009551 Bacteria 665
219 Ga0105238_11706757 3300009551 Bacteria 661
220 Ga0105249_10078059 3300009553 Unclassified 3072
221 Ga0105249_11323037 3300009553 Bacteria 792
222 Ga0105249_11779795 3300009553 Unclassified 689
223 Ga0105239_10156027 3300010375 Bacteria 2549
224 Ga0105239_10246312 3300010375 Bacteria 2007
225 Ga0105239_12447636 3300010375 Unclassified 608
226 Ga0105239_13529485 3300010375 Unclassified 508
227 Ga0105246_11174347 3300011119 Bacteria 705
228 Ga0105246_11983911 3300011119 Bacteria 561
229 Ga0157341_1051974 3300012494 Unclassified 504
230 Ga0157371_10706963 3300013102 Bacteria 755
231 Ga0157371_11248942 3300013102 Bacteria 574
232 Ga0157370_10154697 3300013104 Bacteria 2134
233 Ga0157370_10407261 3300013104 Bacteria 1251
234 Ga0157369_10438128 3300013105 Bacteria 1354
235 Ga0157369_11143763 3300013105 Unclassified 795
236 Ga0157374_10025324 3300013296 Bacteria 5325
237 Ga0157374_10449250 3300013296 Bacteria 1290
238 Ga0157374_10908101 3300013296 Unclassified 898
239 Ga0157374_10969536 3300013296 Unclassified 869
240 Ga0157374_11364666 3300013296 Unclassified 731
241 Ga0157378_10009171 3300013297 Bacteria 8613
242 Ga0157378_10099141 3300013297 Bacteria 2658
243 Ga0157378_11150485 3300013297 Bacteria 814
244 Ga0157378_11180489 3300013297 Bacteria 804
245 Ga0163162_10390366 3300013306 Bacteria 1525
246 Ga0163162_10981428 3300013306 Unclassified 955
247 Ga0163162_11146948 3300013306 Bacteria 881
248 Ga0163162_12498037 3300013306 Bacteria 594
249 Ga0157372_10016762 3300013307 Bacteria 7866
250 Ga0157372_10053336 3300013307 Bacteria 4507
251 Ga0157372_10191216 3300013307 Unclassified 2371
252 Ga0157372_10208856 3300013307 Bacteria 2262
253 Ga0157372_11455723 3300013307 Bacteria 789
254 Ga0157375_10371051 3300013308 Bacteria 1597
255 Ga0157375_10714523 3300013308 Bacteria 1155
256 Ga0157375_12480246 3300013308 Bacteria 619
257 Ga0163163_10049512 3300014325 Bacteria 4136
258 Ga0163163_10335240 3300014325 Unclassified 1567
259 Ga0163163_10432794 3300014325 Unclassified 1375
260 Ga0163163_10552669 3300014325 Bacteria 1214
261 Ga0163163_10628661 3300014325 Bacteria 1137
262 Ga0163163_10885227 3300014325 Bacteria 956
263 Ga0157380_10670507 3300014326 Bacteria 1037
264 Ga0182008_10098926 3300014497 Bacteria 1441
265 Ga0157377_10131180 3300014745 Unclassified 1531
266 Ga0157377_10174186 3300014745 Bacteria 1348
267 Ga0157377_10247717 3300014745 Bacteria 1153
268 Ga0157379_10064171 3300014968 Unclassified 3282
269 Ga0157379_10247515 3300014968 Unclassified 1618
270 Ga0157379_10790356 3300014968 Unclassified 895
271 Ga0157376_10008533 3300014969 Bacteria 7399
272 Ga0157376_10315283 3300014969 Unclassified 1485
273 Ga0157376_10484111 3300014969 Bacteria 1213
274 Ga0157376_12118734 3300014969 Bacteria 601
275 Ga0213874_10005334 3300021377 Unclassified 2990
276 Ga0213874_10359387 3300021377 Bacteria 559
277 Ga0213876_10284285 3300021384 Bacteria 879
278 Ga0213875_10007722 3300021388 Bacteria 5534
279 Ga0213875_10486269 3300021388 Bacteria 592
280 Ga0207697_10062424 3300025315 Bacteria 1551
281 Ga0207656_10427432 3300025321 Unclassified 668
282 Ga0207692_10401663 3300025898 Unclassified 854
283 Ga0207680_10050947 3300025903 Bacteria 2474
284 Ga0207685_10372821 3300025905 Bacteria 725
285 Ga0207699_10240589 3300025906 Unclassified 1243
286 Ga0207699_10997511 3300025906 Bacteria 619
287 Ga0207645_10995424 3300025907 Bacteria 568
288 Ga0207643_10229311 3300025908 Bacteria 1139
289 Ga0207654_10044953 3300025911 Bacteria 2511
290 Ga0207654_10550661 3300025911 Unclassified 819
291 Ga0207695_10008330 3300025913 Bacteria 12990
292 Ga0207695_10364812 3300025913 Bacteria 1331
293 Ga0207695_10602562 3300025913 Bacteria 980
294 Ga0207695_11690974 3300025913 Unclassified 514
295 Ga0207671_10197397 3300025914 Bacteria 1570
296 Ga0207671_10438803 3300025914 Unclassified 1039
297 Ga0207671_10510278 3300025914 Unclassified 959
298 Ga0207671_10828301 3300025914 Unclassified 733
299 Ga0207671_11112908 3300025914 Bacteria 620
300 Ga0207693_10420111 3300025915 Bacteria 1045
301 Ga0207693_10602427 3300025915 Unclassified 855
302 Ga0207693_10733095 3300025915 Bacteria 764
303 Ga0207693_11188389 3300025915 Unclassified 576
304 Ga0207663_10050811 3300025916 Bacteria 2578
305 Ga0207663_10982825 3300025916 Unclassified 677
306 Ga0207649_10171238 3300025920 Bacteria 1513
307 Ga0207649_10690965 3300025920 Unclassified 791
308 Ga0207652_10359090 3300025921 Bacteria 1315
309 Ga0207652_11087955 3300025921 Unclassified 700
310 Ga0207646_10009010 3300025922 Bacteria 9920
311 Ga0207646_10481407 3300025922 Unclassified 1119
312 Ga0207646_10548004 3300025922 Unclassified 1040
313 Ga0207694_10044738 3300025924 Bacteria 3418
314 Ga0207694_10391336 3300025924 Unclassified 1155
315 Ga0207694_10698611 3300025924 Bacteria 855
316 Ga0207694_10765575 3300025924 Unclassified 815
317 Ga0207694_11727571 3300025924 Unclassified 526
318 Ga0207650_10030704 3300025925 Bacteria 3874
319 Ga0207650_10929623 3300025925 Bacteria 739
320 Ga0207659_10167102 3300025926 Bacteria 1732
321 Ga0207687_10000567 3300025927 Bacteria 24931
322 Ga0207687_10685824 3300025927 Bacteria 868
323 Ga0207687_11050146 3300025927 Unclassified 699
324 Ga0207687_11060674 3300025927 Bacteria 695
325 Ga0207700_10338440 3300025928 Bacteria 1308
326 Ga0207700_10369842 3300025928 Bacteria 1251
327 Ga0207700_10470083 3300025928 Bacteria 1110
328 Ga0207700_11646712 3300025928 Unclassified 567
329 Ga0207700_12030458 3300025928 Unclassified 502
330 Ga0207664_10149736 3300025929 Unclassified 1981
331 Ga0207664_10582847 3300025929 Bacteria 1004
332 Ga0207664_10645031 3300025929 Bacteria 952
333 Ga0207664_10809160 3300025929 Unclassified 843
334 Ga0207644_10088129 3300025931 Unclassified 2308
335 Ga0207690_10549820 3300025932 Bacteria 938
336 Ga0207706_10079739 3300025933 Bacteria 2879
337 Ga0207706_10194114 3300025933 Bacteria 1781
338 Ga0207686_10018553 3300025934 Bacteria 3941
339 Ga0207670_10114277 3300025936 Bacteria 1951
340 Ga0207670_11107211 3300025936 Unclassified 669
341 Ga0207704_11925027 3300025938 Unclassified 509
342 Ga0207665_10215701 3300025939 Bacteria 1404
343 Ga0207665_10350428 3300025939 Unclassified 1114
344 Ga0207665_11053664 3300025939 Bacteria 648
345 Ga0207691_10216243 3300025940 Bacteria 1663
346 Ga0207691_10263843 3300025940 Bacteria 1484
347 Ga0207711_10094524 3300025941 Bacteria 2635
348 Ga0207711_10107323 3300025941 Bacteria 2479
349 Ga0207711_10486796 3300025941 Bacteria 1149
350 Ga0207711_10844528 3300025941 Unclassified 852
351 Ga0207711_11142062 3300025941 Unclassified 720
352 Ga0207689_10617810 3300025942 Unclassified 912
353 Ga0207661_10000071 3300025944 Bacteria 69410
354 Ga0207661_10003420 3300025944 Bacteria 11011
355 Ga0207661_10633586 3300025944 Unclassified 982
356 Ga0207661_12133655 3300025944 Unclassified 506
357 Ga0207679_10006343 3300025945 Bacteria 7473
358 Ga0207667_10673933 3300025949 Bacteria 1038
359 Ga0207651_11121911 3300025960 Unclassified 705
360 Ga0207668_10035076 3300025972 Bacteria 3337
361 Ga0207640_10099371 3300025981 Bacteria 2037
362 Ga0207658_10367104 3300025986 Unclassified 1257
363 Ga0207677_10678820 3300026023 Bacteria 912
364 Ga0207677_11987586 3300026023 Unclassified 540
365 Ga0207703_10398241 3300026035 Unclassified 1277
366 Ga0207703_11020689 3300026035 Unclassified 794
367 Ga0207678_10126326 3300026067 Bacteria 2182
368 Ga0207708_10040258 3300026075 Bacteria 3562
369 Ga0207708_10281601 3300026075 Bacteria 1347
370 Ga0207708_11449393 3300026075 Unclassified 603
371 Ga0207702_11898267 3300026078 Bacteria 587
372 Ga0207641_10105058 3300026088 Unclassified 2494
373 Ga0207641_10459622 3300026088 Bacteria 1231
374 Ga0207648_10654340 3300026089 Bacteria 971
375 Ga0207648_11122527 3300026089 Bacteria 738
376 Ga0207676_11815107 3300026095 Unclassified 608
377 Ga0207674_10276923 3300026116 Bacteria 1626
378 Ga0207674_11676357 3300026116 Unclassified 604
379 Ga0207674_11684955 3300026116 Unclassified 602
380 Ga0207675_100058310 3300026118 Bacteria 3603
381 Ga0207698_11604608 3300026142 Unclassified 666
382 Ga0207428_10005452 3300027907 Bacteria 11863
383 Ga0207428_10773934 3300027907 Unclassified 683
384 Ga0268266_10101379 3300028379 Bacteria 2538
385 Ga0268266_10379517 3300028379 Bacteria 1333
386 Ga0268266_10728233 3300028379 Bacteria 957
387 Ga0268266_11131540 3300028379 Unclassified 757
388 Ga0268265_10103670 3300028380 Bacteria 2304
389 Ga0268265_11014459 3300028380 Bacteria 820
390 Ga0268265_11836588 3300028380 Bacteria 613
391 Ga0268265_12015252 3300028380 Unclassified 584
392 Ga0268265_12183967 3300028380 Bacteria 561
393 Ga0265338_10448419 3300028800 Viruses 914
394 Ga0265760_10191247 3300031090 Unclassified 688
395 Ga0265331_10072316 3300031250 Bacteria 1612
396 Ga0373923_0268075 3300035111 Bacteria 802
397 Ga0373945_0224020 3300035116 Unclassified 787
398 Ga0373953_0021413 3300035117 Unclassified 2426
399 Ga0373953_0293933 3300035117 Bacteria 709
400 Ga0373954_0218939 3300035118 Unclassified 936
401 Ga0373956_0309499 3300035119 Unclassified 753
402 Ga0373943_0355690 3300035170 Unclassified 840
403 Ga0373943_0404174 3300035170 Bacteria 789
404 Ga0373946_0174356 3300035171 Bacteria 1017
405 Ga0373955_0324634 3300035172 Unclassified 930
406 Ga0373935_1419198 3300035692 Bacteria 519
407 Ga0373927_0083210 3300035695 Bacteria 2075
408 Ga0373927_0399599 3300035695 Bacteria 907
409 Ga0373927_0775055 3300035695 Unclassified 634
410 Ga0373933_0059509 3300035724 Unclassified 2301
411 Ga0373933_0176308 3300035724 Bacteria 1362
412 Ga0373933_0784090 3300035724 Bacteria 627
413 Ga0373947_0408350 3300035725 Unclassified 917
414 Ga0373947_0757963 3300035725 Bacteria 662
415 Ga0373937_0001905 3300036401 Bacteria 17509
416 Ga0373937_0024393 3300036401 Bacteria 5455
417 Ga0373937_1326497 3300036401 Unclassified 667
418 Ga0373937_2171372 3300036401 Unclassified 501
419 Ga0373925_0003221 3300037068 Bacteria 12751
420 Ga0373925_0039889 3300037068 Bacteria 3475
421 Ga0373925_0131313 3300037068 Bacteria 1953
422 Ga0436364_0056795 3300037853 Bacteria 1026
423 Ga0436364_0066919 3300037853 Unclassified 504
424 Ga0436364_0463141 3300037853 Unclassified 1344
425 Ga0436364_0500247 3300037853 Bacteria 3291
426 Ga0436364_0613783 3300037853 Bacteria 2521
427 Ga0436364_0685038 3300037853 Bacteria 22299
428 Ga0436364_1003254 3300037853 Bacteria 757
429 Ga0436364_1408406 3300037853 Bacteria 966
430 Ga0436365_0278283 3300039437 Unclassified 1821
431 Ga0436365_1614015 3300039437 Bacteria 2099
432 Ga0436360_0413004 3300039438 Unclassified 525
433 Ga0436361_0193372 3300039447 Unclassified 519
434 Ga0436361_0575636 3300039447 Bacteria 623
435 Ga0436363_0180491 3300039450 Unclassified 550
436 Ga0436363_0196240 3300039450 Bacteria 2539
437 Ga0436363_1561269 3300039450 Bacteria 4314
438 Ga0436362_0779015 3300039453 Bacteria 554
439 Ga0451802_1502397 3300041460 Bacteria 590
440 Ga0451839_1021128 3300041496 Unclassified 575
441 Ga0453683_0979160 3300044673 Bacteria 561
442 Ga0466961_0415730 3300044693 Bacteria 815
443 Ga0466959_0200174 3300045049 Bacteria 1391
444 Ga0451576_0004883 3300045051 Bacteria 17138
445 Ga0451576_0250395 3300045051 Bacteria 1851
446 Ga0451576_0961612 3300045051 Bacteria 895
447 Ga0451576_1595795 3300045051 Unclassified 677
448 Ga0466958_0734829 3300045836 Bacteria 643
449 Ga0495592_0787059 3300046454 Unclassified 566
450 Ga0495629_0370427 3300046459 Bacteria 975
451 Ga0495651_0136576 3300046462 Unclassified 1783
452 Ga0495651_0854628 3300046462 Unclassified 559
453 Ga0495580_0033652 3300046472 Bacteria 3691
454 Ga0495580_0101996 3300046472 Bacteria 1995
455 Ga0495580_0376104 3300046472 Unclassified 960
456 Ga0495580_0646317 3300046472 Bacteria 696
457 Ga0495580_0975254 3300046472 Bacteria 541
458 Ga0495582_0049008 3300046473 Unclassified 2326
459 Ga0495582_0608130 3300046473 Unclassified 632
460 Ga0495664_0280617 3300046477 Bacteria 1007
461 Ga0495608_0645170 3300046511 Bacteria 633
462 Ga0495630_0042610 3300046517 Unclassified 3390
463 Ga0495630_0365279 3300046517 Unclassified 1105
464 Ga0495666_0064988 3300046526 Unclassified 1741
465 Ga0495642_0380469 3300046528 Unclassified 622
466 Ga0495652_0271341 3300046529 Unclassified 1247
467 Ga0495665_0064855 3300046531 Bacteria 1928
468 Ga0495665_0259210 3300046531 Unclassified 894
469 Ga0495640_0034977 3300046533 Unclassified 3558
470 Ga0495586_0162182 3300046535 Bacteria 1261
471 Ga0495645_0074514 3300046543 Bacteria 2444
472 Ga0495645_0265974 3300046543 Archaea 1133
473 Ga0495667_0132151 3300046559 Unclassified 1610
474 Ga0495667_0845262 3300046559 Bacteria 563
475 Ga0495634_0216670 3300046642 Bacteria 1183
476 Ga0495588_0295687 3300046674 Unclassified 853
477 Ga0495647_0520676 3300046681 Bacteria 554
478 Ga0495658_0011236 3300046683 Bacteria 4497
479 Ga0495669_0095357 3300046684 Unclassified 1378
480 Ga0495613_0023626 3300046689 Unclassified 4582
481 Ga0495613_0405118 3300046689 Unclassified 930
482 Ga0495600_0293529 3300046809 Bacteria 1027
483 Ga0495604_0432170 3300047317 Unclassified 863
484 Ga0495604_0556735 3300047317 Bacteria 739
485 Ga0495674_0046898 3300047319 Unclassified 3834
486 Ga0495674_0217061 3300047319 Bacteria 1582
487 Ga0495684_0017189 3300047471 Bacteria 5569
488 Ga0495684_0023875 3300047471 Bacteria 4702
489 Ga0495684_0969752 3300047471 Bacteria 542
490 Ga0495602_0733848 3300048088 Unclassified 668
491 Ga0495614_0045586 3300048089 Unclassified 1880
492 Ga0495614_0479296 3300048089 Bacteria 591
493 Ga0496101_0312003 3300048904 Unclassified 1233
494 Ga0496102_1157352 3300048905 Unclassified 693
495 Ga0496102_1276521 3300048905 Unclassified 653
496 Ga0496103_0603473 3300048906 Bacteria 699
497 Ga0496104_0013395 3300048907 Bacteria 7389
498 Ga0496106_1057239 3300048909 Unclassified 637
499 Ga0496107_0643312 3300048910 Unclassified 782
500 Ga0496108_0011956 3300048911 Bacteria 7061
501 Ga0496109_0009870 3300048912 Bacteria 8150
502 Ga0496110_0002922 3300048913 Bacteria 12938
503 Ga0496111_0109674 3300048914 Unclassified 2032
504 Ga0496112_0004780 3300048915 Bacteria 11551
505 Ga0496112_0062740 3300048915 Unclassified 3666
506 Ga0496113_0123157 3300048916 Bacteria 2029
507 Ga0496114_0638504 3300048917 Unclassified 937
508 Ga0496115_0022986 3300048918 Unclassified 4835
509 Ga0501040_0713647 3300049576 Bacteria 725
510 Ga0501041_0512473 3300049577 Unclassified 763
511 Ga0501048_1129149 3300049582 Bacteria 564
512 Ga0501073_0194630 3300049589 Unclassified 1402
513 nmdc:mga05p37_1838959_c1 3300050507 Unclassified 582
514 nmdc:mga05p37_2149629_c1 3300050507 Bacteria 521
515 nmdc:mga05p37_22010_c1 3300050507 Bacteria 7724
516 nmdc:mga05p37_350374_c1 3300050507 Unclassified 1739
517 nmdc:mga09592_1334151_c1 3300050508 Bacteria 589
518 nmdc:mga09592_21532_c1 3300050508 Bacteria 5313
519 nmdc:mga09592_576056_c1 3300050508 Bacteria 966
520 nmdc:mga0qj67_264270_c1 3300050509 Unclassified 1396
521 nmdc:mga0qj67_388259_c1 3300050509 Bacteria 1127
522 nmdc:mga0qj67_51416_c1 3300050509 Bacteria 3259
523 nmdc:mga06r32_1039367_c1 3300050510 Bacteria 770
524 nmdc:mga06r32_170966_c1 3300050510 Unclassified 2157
525 nmdc:mga06r32_4069_c1 3300050510 Bacteria 13103
526 nmdc:mga06r32_43128_c1 3300050510 Bacteria 4291
527 nmdc:mga06r32_43442_c1 3300050510 Bacteria 4277
528 nmdc:mga08y16_1416350_c1 3300050511 Unclassified 658
529 nmdc:mga08y16_3039_c1 3300050511 Bacteria 17327
530 nmdc:mga0n895_130838_c1 3300050512 Unclassified 2534
531 nmdc:mga0n895_1391046_c1 3300050512 Unclassified 670
532 nmdc:mga0n895_1686955_c1 3300050512 Unclassified 596
533 nmdc:mga0n895_2106951_c1 3300050512 Unclassified 520
534 nmdc:mga0n895_903956_c1 3300050512 Unclassified 868
535 nmdc:mga0rr50_471722_c1 3300050513 Bacteria 1065
536 nmdc:mga08x19_989525_c1 3300050514 Unclassified 597
537 nmdc:mga0a205_530755_c1 3300050515 Bacteria 1033
538 nmdc:mga0a205_65709_c1 3300050515 Bacteria 3505
539 Ga0501082_0000199 3300060353 Bacteria 52195
540 Ga0501082_1151878 3300060353 Unclassified 678
541 Ga0530510_0827767 3300061734 Bacteria 707
542 Ga0070665_100288606
543 Ga0065714_10330814
544 Ga0065712_10079718
545 Ga0065712_10127733
546 Ga0065715_10221334
547 Ga0070658_10934067
548 Ga0070683_100000062
549 Ga0070683_100000833
550 Ga0070683_100103944
551 Ga0070683_100635100
552 Ga0070670_100027286
553 Ga0070670_100043203
554 Ga0070670_100627941
555 Ga0068869_100998342
556 Ga0070666_10165722
557 Ga0070682_101077687
558 Ga0068868_100515890
559 Ga0070660_101896603
560 Ga0070689_100807460
561 Ga0070689_101128079
562 Ga0070689_101834293
563 Ga0070687_100801899
564 Ga0070661_100017522
565 Ga0070692_10909421
566 Ga0070668_100147091
567 Ga0070669_100105605
568 Ga0070675_100030333
569 Ga0070675_100797554
570 Ga0070671_100057246
571 Ga0070671_100895531
572 Ga0070674_100650271
573 Ga0070673_100153591
574 Ga0070673_100253423
575 Ga0070673_100742167
576 Ga0070688_100033525
577 Ga0070688_100452710
578 Ga0070688_101727302
579 Ga0070659_100052322
580 Ga0070667_100228910
581 Ga0070709_10369586
582 Ga0070714_100025618
583 Ga0070714_100479069
584 Ga0070713_100876805
585 Ga0070713_101466660
586 Ga0070713_101718798
587 Ga0070701_10419677
588 Ga0070701_11411247
589 Ga0070711_101259479
590 Ga0070700_100507153
591 Ga0070700_100974120
592 Ga0070708_100139379
593 Ga0070663_100262097
594 Ga0070678_101313961
595 Ga0070662_100065139
596 Ga0070662_100919800
597 Ga0070681_10131505
598 Ga0070681_10893532
599 Ga0070681_11857317
600 Ga0068867_100700494
601 Ga0068867_100893844
602 Ga0068867_101147543
603 Ga0070685_11500290
604 Ga0070706_101116757
605 Ga0070707_100049432
606 Ga0070707_100281991
607 Ga0070698_100003038
608 Ga0070698_100542459
609 Ga0070699_100243024
610 Ga0070699_100251896
611 Ga0070699_100708599
612 Ga0070699_100745422
613 Ga0070679_100159976
614 Ga0070679_100260285
615 Ga0070684_100000227
616 Ga0070684_100003925
617 Ga0070684_100186753
618 Ga0070697_100739840
619 Ga0068853_102352030
620 Ga0070672_100210857
621 Ga0070695_100113160
622 Ga0070695_101574222
623 Ga0070696_100989435
624 Ga0070665_100079501
625 Ga0070665_100306239
626 Ga0070665_100376385
627 Ga0070665_100435393
628 Ga0070665_100476310
629 Ga0070665_101076316
630 Ga0070665_101181758
631 Ga0070665_101627672
632 Ga0070704_101652874
633 Ga0068855_100141341
634 Ga0068855_101792873
635 Ga0070664_100043876
636 Ga0070664_100071451
637 Ga0068857_101177365
638 Ga0068854_100907181
639 Ga0068856_101489055
640 Ga0068852_100716518
641 Ga0068852_101837320
642 Ga0068859_100406799
643 Ga0068859_100775073
644 Ga0068859_101607181
645 Ga0068859_102532400
646 Ga0068864_100691679
647 Ga0068864_101515393
648 Ga0068864_102012651
649 Ga0068851_10537044
650 Ga0068870_10191990
651 Ga0068863_100262245
652 Ga0068858_100425480
653 Ga0068860_100532672
654 Ga0068860_100581955
655 Ga0068860_101063038
656 Ga0068862_100038561
657 Ga0068862_100694824
658 Ga0068862_101040156
659 Ga0068862_101111636
660 Ga0068862_101979463
661 Ga0081455_10043986
662 Ga0081455_10108658
663 Ga0081455_10396922
664 Ga0081455_10446848
665 Ga0081540_1164594
666 Ga0070717_10155357
667 Ga0070717_10277103
668 Ga0070717_10285419
669 Ga0070716_100203467
670 Ga0070712_101086896
671 Ga0097621_100024411
672 Ga0097621_101486282
673 Ga0068871_100060884
674 Ga0068871_100407947
675 Ga0068871_101424126
676 Ga0068871_101815760
677 Ga0068871_102007271
678 Ga0068871_102043247
679 Ga0075428_100004937
680 Ga0075428_100014900
681 Ga0075428_100162826
682 Ga0075428_100887701
683 Ga0075430_100043972
684 Ga0075430_100173364
685 Ga0075430_100499793
686 Ga0075430_100693629
687 Ga0075431_100010890
688 Ga0075431_100086164
689 Ga0075431_100155209
690 Ga0075431_101003137
691 Ga0075431_101216766
692 Ga0075434_100016876
693 Ga0075434_100538947
694 Ga0075434_100668227
695 Ga0075434_101643438
696 Ga0075429_100023077
697 Ga0075429_100107187
698 Ga0075429_101535206
699 Ga0075436_100748444
700 Ga0075436_101548069
701 Ga0097620_100406827
702 Ga0097620_100775004
703 Ga0097620_101607608
704 Ga0097620_102532807
705 Ga0075435_100186804
706 Ga0105240_10000903
707 Ga0105240_10019360
708 Ga0105240_10079222
709 Ga0105240_12421883
710 Ga0111539_10004149
711 Ga0111539_11295626
712 Ga0111539_11805160
713 Ga0105245_10002114
714 Ga0105245_10323105
715 Ga0105245_10485935
716 Ga0105245_10494182
717 Ga0105245_10944115
718 Ga0105245_10960805
719 Ga0105245_11131187
720 Ga0105245_11261916
721 Ga0105247_10300241
722 Ga0105247_11027673
723 Ga0114129_10044417
724 Ga0114129_10129968
725 Ga0114129_10318540
726 Ga0114129_11614198
727 Ga0114129_11956832
728 Ga0114129_12890655
729 Ga0105243_11497738
730 Ga0105241_10048005
731 Ga0105241_10906488
732 Ga0105241_10931096
733 Ga0105241_10978018
734 Ga0105241_11734848
735 Ga0105241_11771275
736 Ga0105241_12261043
737 Ga0105241_12671883
738 Ga0105242_10029983
739 Ga0105242_10110360
740 Ga0105242_11458001
741 Ga0105242_11484053
742 Ga0105248_10036603
743 Ga0105248_10257635
744 Ga0105248_11011042
745 Ga0105248_11551337
746 Ga0105248_11683975
747 Ga0105248_11758577
748 Ga0105237_10010866
749 Ga0105237_10151013
750 Ga0105237_10494802
751 Ga0105237_10686319
752 Ga0105237_11205768
753 Ga0105237_12170779
754 Ga0105238_10113081
755 Ga0105238_10115292
756 Ga0105238_10140343
757 Ga0105238_10894729
758 Ga0105238_10905676
759 Ga0105238_11684801
760 Ga0105238_11706757
761 Ga0105249_10078059
762 Ga0105249_11323037
763 Ga0105249_11779795
764 Ga0105239_10156027
765 Ga0105239_10246312
766 Ga0105239_12447636
767 Ga0105239_13529485
768 Ga0105246_11174347
769 Ga0105246_11983911
770 Ga0157341_1051974
771 Ga0157371_10706963
772 Ga0157371_11248942
773 Ga0157370_10154697
774 Ga0157370_10407261
775 Ga0157369_10438128
776 Ga0157369_11143763
777 Ga0157374_10025324
778 Ga0157374_10449250
779 Ga0157374_10908101
780 Ga0157374_10969536
781 Ga0157374_11364666
782 Ga0157378_10009171
783 Ga0157378_10099141
784 Ga0157378_11150485
785 Ga0157378_11180489
786 Ga0163162_10390366
787 Ga0163162_10981428
788 Ga0163162_11146948
789 Ga0163162_12498037
790 Ga0157372_10016762
791 Ga0157372_10053336
792 Ga0157372_10191216
793 Ga0157372_10208856
794 Ga0157372_11455723
795 Ga0157375_10371051
796 Ga0157375_10714523
797 Ga0157375_12480246
798 Ga0163163_10049512
799 Ga0163163_10335240
800 Ga0163163_10432794
801 Ga0163163_10552669
802 Ga0163163_10628661
803 Ga0163163_10885227
804 Ga0157380_10670507
805 Ga0182008_10098926
806 Ga0157377_10131180
807 Ga0157377_10174186
808 Ga0157377_10247717
809 Ga0157379_10064171
810 Ga0157379_10247515
811 Ga0157379_10790356
812 Ga0157376_10008533
813 Ga0157376_10315283
814 Ga0157376_10484111
815 Ga0157376_12118734
816 Ga0213874_10005334
817 Ga0213874_10359387
818 Ga0213876_10284285
819 Ga0213875_10007722
820 Ga0213875_10486269
821 Ga0207697_10062424
822 Ga0207656_10427432
823 Ga0207692_10401663
824 Ga0207680_10050947
825 Ga0207685_10372821
826 Ga0207699_10240589
827 Ga0207699_10997511
828 Ga0207645_10995424
829 Ga0207643_10229311
830 Ga0207654_10044953
831 Ga0207654_10550661
832 Ga0207695_10008330
833 Ga0207695_10364812
834 Ga0207695_10602562
835 Ga0207695_11690974
836 Ga0207671_10197397
837 Ga0207671_10438803
838 Ga0207671_10510278
839 Ga0207671_10828301
840 Ga0207671_11112908
841 Ga0207693_10420111
842 Ga0207693_10602427
843 Ga0207693_10733095
844 Ga0207693_11188389
845 Ga0207663_10050811
846 Ga0207663_10982825
847 Ga0207649_10171238
848 Ga0207649_10690965
849 Ga0207652_10359090
850 Ga0207652_11087955
851 Ga0207646_10009010
852 Ga0207646_10481407
853 Ga0207646_10548004
854 Ga0207694_10044738
855 Ga0207694_10391336
856 Ga0207694_10698611
857 Ga0207694_10765575
858 Ga0207694_11727571
859 Ga0207650_10030704
860 Ga0207650_10929623
861 Ga0207659_10167102
862 Ga0207687_10000567
863 Ga0207687_10685824
864 Ga0207687_11050146
865 Ga0207687_11060674
866 Ga0207700_10338440
867 Ga0207700_10369842
868 Ga0207700_10470083
869 Ga0207700_11646712
870 Ga0207700_12030458
871 Ga0207664_10149736
872 Ga0207664_10582847
873 Ga0207664_10645031
874 Ga0207664_10809160
875 Ga0207644_10088129
876 Ga0207690_10549820
877 Ga0207706_10079739
878 Ga0207706_10194114
879 Ga0207686_10018553
880 Ga0207670_10114277
881 Ga0207670_11107211
882 Ga0207704_11925027
883 Ga0207665_10215701
884 Ga0207665_10350428
885 Ga0207665_11053664
886 Ga0207691_10216243
887 Ga0207691_10263843
888 Ga0207711_10094524
889 Ga0207711_10107323
890 Ga0207711_10486796
891 Ga0207711_10844528
892 Ga0207711_11142062
893 Ga0207689_10617810
894 Ga0207661_10000071
895 Ga0207661_10003420
896 Ga0207661_10633586
897 Ga0207661_12133655
898 Ga0207679_10006343
899 Ga0207667_10673933
900 Ga0207651_11121911
901 Ga0207668_10035076
902 Ga0207640_10099371
903 Ga0207658_10367104
904 Ga0207677_10678820
905 Ga0207677_11987586
906 Ga0207703_10398241
907 Ga0207703_11020689
908 Ga0207678_10126326
909 Ga0207708_10040258
910 Ga0207708_10281601
911 Ga0207708_11449393
912 Ga0207702_11898267
913 Ga0207641_10105058
914 Ga0207641_10459622
915 Ga0207648_10654340
916 Ga0207648_11122527
917 Ga0207676_11815107
918 Ga0207674_10276923
919 Ga0207674_11676357
920 Ga0207674_11684955
921 Ga0207675_100058310
922 Ga0207698_11604608
923 Ga0207428_10005452
924 Ga0207428_10773934
925 Ga0268266_10101379
926 Ga0268266_10379517
927 Ga0268266_10728233
928 Ga0268266_11131540
929 Ga0268265_10103670
930 Ga0268265_11014459
931 Ga0268265_11836588
932 Ga0268265_12015252
933 Ga0268265_12183967
934 Ga0265338_10448419
935 Ga0265760_10191247
936 Ga0265331_10072316
937 Ga0373923_0268075
938 Ga0373945_0224020
939 Ga0373953_0021413
940 Ga0373953_0293933
941 Ga0373954_0218939
942 Ga0373956_0309499
943 Ga0373943_0355690
944 Ga0373943_0404174
945 Ga0373946_0174356
946 Ga0373955_0324634
947 Ga0373935_1419198
948 Ga0373927_0083210
949 Ga0373927_0399599
950 Ga0373927_0775055
951 Ga0373933_0059509
952 Ga0373933_0176308
953 Ga0373933_0784090
954 Ga0373947_0408350
955 Ga0373947_0757963
956 Ga0373937_0001905
957 Ga0373937_0024393
958 Ga0373937_1326497
959 Ga0373937_2171372
960 Ga0373925_0003221
961 Ga0373925_0039889
962 Ga0373925_0131313
963 Ga0436364_0056795
964 Ga0436364_0066919
965 Ga0436364_0463141
966 Ga0436364_0500247
967 Ga0436364_0613783
968 Ga0436364_0685038
969 Ga0436364_1003254
970 Ga0436364_1408406
971 Ga0436365_0278283
972 Ga0436365_1614015
973 Ga0436360_0413004
974 Ga0436361_0193372
975 Ga0436361_0575636
976 Ga0436363_0180491
977 Ga0436363_0196240
978 Ga0436363_1561269
979 Ga0436362_0779015
980 Ga0451802_1502397
981 Ga0451839_1021128
982 Ga0453683_0979160
983 Ga0466961_0415730
984 Ga0466959_0200174
985 Ga0451576_0004883
986 Ga0451576_0250395
987 Ga0451576_0961612
988 Ga0451576_1595795
989 Ga0466958_0734829
990 Ga0495592_0787059
991 Ga0495629_0370427
992 Ga0495651_0136576
993 Ga0495651_0854628
994 Ga0495580_0033652
995 Ga0495580_0101996
996 Ga0495580_0376104
997 Ga0495580_0646317
998 Ga0495580_0975254
999 Ga0495582_0049008
1000 Ga0495582_0608130
1001 Ga0495664_0280617
1002 Ga0495608_0645170
1003 Ga0495630_0042610
1004 Ga0495630_0365279
1005 Ga0495666_0064988
1006 Ga0495642_0380469
1007 Ga0495652_0271341
1008 Ga0495665_0064855
1009 Ga0495665_0259210
1010 Ga0495640_0034977
1011 Ga0495586_0162182
1012 Ga0495645_0074514
1013 Ga0495645_0265974
1014 Ga0495667_0132151
1015 Ga0495667_0845262
1016 Ga0495634_0216670
1017 Ga0495588_0295687
1018 Ga0495647_0520676
1019 Ga0495658_0011236
1020 Ga0495669_0095357
1021 Ga0495613_0023626
1022 Ga0495613_0405118
1023 Ga0495600_0293529
1024 Ga0495604_0432170
1025 Ga0495604_0556735
1026 Ga0495674_0046898
1027 Ga0495674_0217061
1028 Ga0495684_0017189
1029 Ga0495684_0023875
1030 Ga0495684_0969752
1031 Ga0495602_0733848
1032 Ga0495614_0045586
1033 Ga0495614_0479296
1034 Ga0496101_0312003
1035 Ga0496102_1157352
1036 Ga0496102_1276521
1037 Ga0496103_0603473
1038 Ga0496104_0013395
1039 Ga0496106_1057239
1040 Ga0496107_0643312
1041 Ga0496108_0011956
1042 Ga0496109_0009870
1043 Ga0496110_0002922
1044 Ga0496111_0109674
1045 Ga0496112_0004780
1046 Ga0496112_0062740
1047 Ga0496113_0123157
1048 Ga0496114_0638504
1049 Ga0496115_0022986
1050 Ga0501040_0713647
1051 Ga0501041_0512473
1052 Ga0501048_1129149
1053 Ga0501073_0194630
1054 nmdc:mga05p37_1838959_c1
1055 nmdc:mga05p37_2149629_c1
1056 nmdc:mga05p37_22010_c1
1057 nmdc:mga05p37_350374_c1
1058 nmdc:mga09592_1334151_c1
1059 nmdc:mga09592_21532_c1
1060 nmdc:mga09592_576056_c1
1061 nmdc:mga0qj67_264270_c1
1062 nmdc:mga0qj67_388259_c1
1063 nmdc:mga0qj67_51416_c1
1064 nmdc:mga06r32_1039367_c1
1065 nmdc:mga06r32_170966_c1
1066 nmdc:mga06r32_4069_c1
1067 nmdc:mga06r32_43128_c1
1068 nmdc:mga06r32_43442_c1
1069 nmdc:mga08y16_1416350_c1
1070 nmdc:mga08y16_3039_c1
1071 nmdc:mga0n895_130838_c1
1072 nmdc:mga0n895_1391046_c1
1073 nmdc:mga0n895_1686955_c1
1074 nmdc:mga0n895_2106951_c1
1075 nmdc:mga0n895_903956_c1
1076 nmdc:mga0rr50_471722_c1
1077 nmdc:mga08x19_989525_c1
1078 nmdc:mga0a205_530755_c1
1079 nmdc:mga0a205_65709_c1
1080 Ga0501082_0000199
1081 Ga0501082_1151878
1082 Ga0530510_0827767

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

22

96

0.98

PF13463

HTH_27

Winged helix DNA-binding domain

16

90

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9437 11 106
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9418 10 106
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9372 10 104
3l7w-assembly1.cif.gz_A-2 the crystal structure of smu.1704 from streptococcus mutans ua159 0.936 6 108
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9258 10 104
ID Description Score Start End Superfamily
af_Q2FUS4_1_110_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9343 10 102 1.10.10.10
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9258 10 104 1.10.10.10
af_I6X7F9_1_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9252 10 100 1.10.10.10
3l7wA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9107 6 106 1.10.10.10
5zqhA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8961 10 106 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7S7NR82-F1-model_v4 PadR family transcriptional regulator 1 16 107
AF-A0A3A5G5J2-F1-model_v4 deleted 0.9964 16 108
AF-A0A2V8EA09-F1-model_v4 PadR family transcriptional regulator 0.9953 10 88
AF-A0A537T4U9-F1-model_v4 PadR family transcriptional regulator 0.9948 5 109
AF-A0A5B9EGF4-F1-model_v4 PadR family transcriptional regulator 0.9941 16 107

Map