F461006

General Info

Members Datasets Scaffolds Average Seq Length
538 209 1076 294

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_10151150|Ga0105247_101511502
Length 331
Sequence MRDGSHSLPFHADWQGGCRFFCCKSKKRMATITSANVANAIVKLVAVDALPALMGNLVMGNLVNRDYEPVLAQAGDTVNVPIPPTMVANNIAEGGSVQLQSPNLGNAQIVLNTHAEATFQIPDVTKVLAVPDLLRLYMQPAMVALAERIETDLLNTYAQFTANGVVGTGGTALSEASIDLAETALFNAKVPASMPKYLVVDPTAYSAIRQIVRFSEYQTAGDAGLRALIDGSVGKMKDFYIFRSQFVPKTGSGPATTHNLAFTKDALGLVIRRLPQPLPGTGAIAEYAEIGNFGMRVTMSYQPNTLAQQFTVDVLYGVGVLRNNHGLHVVS

Samples

Sample ID Description Type Environment
1 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
74 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
77 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
111 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
112 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
113 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
114 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
115 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
116 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
117 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
118 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
119 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
120 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
121 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
122 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
123 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
124 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
125 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
134 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
135 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
136 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
137 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
138 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
139 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
140 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
141 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
142 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
143 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
144 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
145 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
146 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
147 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
148 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
149 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
150 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
151 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
152 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
153 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
154 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
155 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
156 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
157 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
158 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
159 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
162 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
163 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
164 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
165 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
166 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
167 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
168 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
169 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
170 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
171 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
172 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
173 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
179 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
192 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
193 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
194 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
195 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
196 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
197 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
198 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
199 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
200 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
201 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
204 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
205 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
206 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
207 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
208 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
209 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.88
Metatranscriptomes 1.12
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.19
Nodule 0
Rhizoplane 0.74
Rhizosphere 88.66
Stem 0
Stem Tuber 0
Unclassified 10.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105247_10151150 3300009101 Unclassified 1530
2 Ga0070658_10040575 3300005327 Viruses 3755
3 Ga0070658_10067840 3300005327 Viruses 2915
4 Ga0070658_10201336 3300005327 Bacteria 1680
5 Ga0070658_10435857 3300005327 Bacteria 1128
6 Ga0070683_100000021 3300005329 Bacteria 183486
7 Ga0070683_100002584 3300005329 Bacteria 14475
8 Ga0070683_100160713 3300005329 Bacteria 2131
9 Ga0070683_100181596 3300005329 Bacteria 1997
10 Ga0070683_100215736 3300005329 Bacteria 1823
11 Ga0070683_100325733 3300005329 Bacteria 1463
12 Ga0070680_100109285 3300005336 Bacteria 2301
13 Ga0070680_100123453 3300005336 Viruses 2163
14 Ga0070660_100122592 3300005339 Bacteria 2075
15 Ga0070660_100130009 3300005339 Viruses 2014
16 Ga0070660_100263055 3300005339 Viruses 1409
17 Ga0070692_10143281 3300005345 Bacteria 1354
18 Ga0070692_10209110 3300005345 Unclassified 1147
19 Ga0070669_100368911 3300005353 Bacteria 1169
20 Ga0070688_100045422 3300005365 Bacteria 2714
21 Ga0070659_100072686 3300005366 Viruses 2737
22 Ga0070659_100328190 3300005366 Viruses 1280
23 Ga0070659_100415507 3300005366 Bacteria 1137
24 Ga0070667_100442996 3300005367 Unclassified 1186
25 Ga0070714_100144685 3300005435 Viruses 2137
26 Ga0070713_100000052 3300005436 Bacteria 72337
27 Ga0070713_100019312 3300005436 Bacteria 5200
28 Ga0070713_100027678 3300005436 Viruses 4466
29 Ga0070713_100167518 3300005436 Bacteria 1966
30 Ga0070713_100362562 3300005436 Bacteria 1347
31 Ga0070713_100410191 3300005436 Bacteria 1267
32 Ga0070713_100529663 3300005436 Bacteria 1114
33 Ga0070678_100170548 3300005456 Bacteria 1772
34 Ga0070681_10007838 3300005458 Bacteria 10443
35 Ga0070681_10106535 3300005458 Bacteria 2745
36 Ga0070681_10118146 3300005458 Bacteria 2588
37 Ga0070681_10153115 3300005458 Viruses 2231
38 Ga0070681_10155564 3300005458 Unclassified 2211
39 Ga0070681_10437341 3300005458 Viruses 1220
40 Ga0070681_10512958 3300005458 Bacteria 1112
41 Ga0068867_100159683 3300005459 Bacteria 1777
42 Ga0070706_100232479 3300005467 Bacteria 1721
43 Ga0070698_100138441 3300005471 Bacteria 2387
44 Ga0070679_100037406 3300005530 Viruses 4821
45 Ga0070679_100078228 3300005530 Unclassified 3296
46 Ga0070679_100141743 3300005530 Viruses 2382
47 Ga0070679_100307080 3300005530 Bacteria 1537
48 Ga0070679_100402053 3300005530 Bacteria 1315
49 Ga0070684_100000010 3300005535 Bacteria 183486
50 Ga0070684_100097899 3300005535 Unclassified 2617
51 Ga0070684_100127366 3300005535 Unclassified 2295
52 Ga0070684_100157652 3300005535 Viruses 2058
53 Ga0070697_100017702 3300005536 Bacteria 5613
54 Ga0068853_100420068 3300005539 Unclassified 1254
55 Ga0070695_100035955 3300005545 Viruses 3115
56 Ga0070665_100016122 3300005548 Bacteria 7499
57 Ga0070665_100236573 3300005548 Bacteria 1827
58 Ga0070665_100424822 3300005548 Unclassified 1338
59 Ga0068855_100010241 3300005563 Viruses 11302
60 Ga0068855_100017350 3300005563 Bacteria 8661
61 Ga0068855_100040225 3300005563 Bacteria 5549
62 Ga0068855_100052860 3300005563 Bacteria 4781
63 Ga0068855_100088883 3300005563 Viruses 3568
64 Ga0068855_100239178 3300005563 Bacteria 2030
65 Ga0070664_100089159 3300005564 Bacteria 2668
66 Ga0070664_100116539 3300005564 Bacteria 2336
67 Ga0068857_100004408 3300005577 Bacteria 11899
68 Ga0068857_100015452 3300005577 Bacteria 6668
69 Ga0068857_100050456 3300005577 Bacteria 3691
70 Ga0068856_100009053 3300005614 Bacteria 9688
71 Ga0068856_100023663 3300005614 Bacteria 5973
72 Ga0068856_100137194 3300005614 Bacteria 2452
73 Ga0070702_100003481 3300005615 Bacteria 7043
74 Ga0068852_100004822 3300005616 Viruses 9582
75 Ga0068852_100187377 3300005616 Viruses 1950
76 Ga0068852_100482831 3300005616 Unclassified 1232
77 Ga0068852_100653411 3300005616 Unclassified 1059
78 Ga0068859_100239505 3300005617 Bacteria 1903
79 Ga0068859_100340889 3300005617 Bacteria 1593
80 Ga0068859_100354044 3300005617 Unclassified 1563
81 Ga0068863_100023684 3300005841 Bacteria 5859
82 Ga0068863_100029066 3300005841 Bacteria 5280
83 Ga0068863_100068421 3300005841 Bacteria 3359
84 Ga0068858_100059195 3300005842 Viruses 3541
85 Ga0068858_100259365 3300005842 Bacteria 1652
86 Ga0081539_10011092 3300005985 Bacteria 7196
87 Ga0070717_10007000 3300006028 Viruses 8346
88 Ga0070717_10190528 3300006028 Viruses 1792
89 Ga0070717_10221656 3300006028 Bacteria 1662
90 Ga0070717_10487526 3300006028 Bacteria 1113
91 Ga0070715_10092320 3300006163 Bacteria 1396
92 Ga0097621_100151557 3300006237 Viruses 1988
93 Ga0068871_100025188 3300006358 Viruses 4625
94 Ga0068871_100075657 3300006358 Bacteria 2780
95 Ga0068871_100252075 3300006358 Bacteria 1538
96 Ga0075428_100171941 3300006844 Bacteria 2348
97 Ga0075430_100038050 3300006846 Viruses 4077
98 Ga0075430_100231453 3300006846 Unclassified 1532
99 Ga0075431_100070068 3300006847 Viruses 3618
100 Ga0068865_100335894 3300006881 Bacteria 1220
101 Ga0075436_100311809 3300006914 Bacteria 1129
102 Ga0097620_100239503 3300006931 Bacteria 1903
103 Ga0097620_100340868 3300006931 Bacteria 1593
104 Ga0097620_100354013 3300006931 Unclassified 1563
105 Ga0105240_10001936 3300009093 Bacteria 34342
106 Ga0105240_10003354 3300009093 Bacteria 24916
107 Ga0105240_10011842 3300009093 Bacteria 12110
108 Ga0105240_10032340 3300009093 Bacteria 6775
109 Ga0105240_10070844 3300009093 Unclassified 4312
110 Ga0105240_10102829 3300009093 Bacteria 3471
111 Ga0105240_10452626 3300009093 Viruses 1436
112 Ga0111539_10309575 3300009094 Bacteria 1838
113 Ga0105245_10017410 3300009098 Bacteria 6269
114 Ga0105245_10023366 3300009098 Bacteria 5425
115 Ga0105245_10029511 3300009098 Viruses 4846
116 Ga0105245_10115768 3300009098 Unclassified 2499
117 Ga0105245_10290320 3300009098 Bacteria 1602
118 Ga0114129_10074402 3300009147 Viruses 4732
119 Ga0105243_10303998 3300009148 Bacteria 1447
120 Ga0105241_10012259 3300009174 Bacteria 6290
121 Ga0105241_10105399 3300009174 Bacteria 2249
122 Ga0105241_10351814 3300009174 Bacteria 1279
123 Ga0105242_10023648 3300009176 Bacteria 4843
124 Ga0105242_10156729 3300009176 Viruses 1990
125 Ga0105242_10341807 3300009176 Bacteria 1379
126 Ga0105242_10513240 3300009176 Bacteria 1142
127 Ga0105248_10016464 3300009177 Bacteria 8138
128 Ga0105248_10038620 3300009177 Bacteria 5344
129 Ga0105248_10131544 3300009177 Viruses 2823
130 Ga0105248_10249987 3300009177 Viruses 1996
131 Ga0105248_10381055 3300009177 Unclassified 1588
132 Ga0105248_10642411 3300009177 Bacteria 1197
133 Ga0105248_10773773 3300009177 Bacteria 1083
134 Ga0105237_10034181 3300009545 Bacteria 5149
135 Ga0105237_10047385 3300009545 Bacteria 4321
136 Ga0105237_10171722 3300009545 Viruses 2168
137 Ga0105237_10443256 3300009545 Unclassified 1304
138 Ga0105237_10802322 3300009545 Bacteria 948
139 Ga0105238_10013787 3300009551 Bacteria 8171
140 Ga0105238_10086542 3300009551 Viruses 3121
141 Ga0105238_10157825 3300009551 Viruses 2244
142 Ga0105238_10255060 3300009551 Bacteria 1733
143 Ga0105238_10424285 3300009551 Bacteria 1325
144 Ga0105238_10593680 3300009551 Unclassified 1115
145 Ga0105249_10010055 3300009553 Bacteria 8302
146 Ga0105249_10156889 3300009553 Viruses 2195
147 Ga0105239_10004321 3300010375 Bacteria 17037
148 Ga0105239_10035080 3300010375 Bacteria 5509
149 Ga0105239_10431468 3300010375 Unclassified 1494
150 Ga0105246_10000845 3300011119 Bacteria 17503
151 Ga0105246_10081719 3300011119 Bacteria 2304
152 Ga0105246_10172131 3300011119 Bacteria 1659
153 Ga0157373_10011248 3300013100 Bacteria 6584
154 Ga0157370_10001347 3300013104 Bacteria 30496
155 Ga0157370_10012148 3300013104 Viruses 8955
156 Ga0157370_10027230 3300013104 Bacteria 5636
157 Ga0157370_10062978 3300013104 Bacteria 3516
158 Ga0157370_10095712 3300013104 Bacteria 2785
159 Ga0157370_10151955 3300013104 Bacteria 2154
160 Ga0157370_10189699 3300013104 Bacteria 1908
161 Ga0157369_10003125 3300013105 Bacteria 19791
162 Ga0157369_10011045 3300013105 Bacteria 10276
163 Ga0157369_10030508 3300013105 Viruses 5946
164 Ga0157369_10045981 3300013105 Viruses 4745
165 Ga0157369_10086904 3300013105 Bacteria 3339
166 Ga0157369_10089729 3300013105 Viruses 3282
167 Ga0157369_10105454 3300013105 Bacteria 3001
168 Ga0157369_10252381 3300013105 Bacteria 1841
169 Ga0157369_10273507 3300013105 Bacteria 1760
170 Ga0157369_10407099 3300013105 Unclassified 1411
171 Ga0157374_10017829 3300013296 Bacteria 6256
172 Ga0157374_10136644 3300013296 Bacteria 2377
173 Ga0157374_10144755 3300013296 Bacteria 2308
174 Ga0157378_10031917 3300013297 Bacteria 4652
175 Ga0157378_10422913 3300013297 Bacteria 1317
176 Ga0157378_10545766 3300013297 Bacteria 1164
177 Ga0163162_10002580 3300013306 Bacteria 17147
178 Ga0163162_10133036 3300013306 Bacteria 2597
179 Ga0163162_10243469 3300013306 Viruses 1930
180 Ga0163162_10296228 3300013306 Unclassified 1749
181 Ga0157372_10142444 3300013307 Unclassified 2763
182 Ga0157372_10183407 3300013307 Bacteria 2423
183 Ga0157372_10277921 3300013307 Viruses 1947
184 Ga0157372_10306166 3300013307 Bacteria 1849
185 Ga0157372_10384951 3300013307 Bacteria 1634
186 Ga0157372_10605008 3300013307 Bacteria 1278
187 Ga0157372_10747312 3300013307 Bacteria 1137
188 Ga0157375_10003291 3300013308 Bacteria 13991
189 Ga0157375_10111251 3300013308 Bacteria 2838
190 Ga0157375_10418908 3300013308 Bacteria 1505
191 Ga0157375_10732717 3300013308 Bacteria 1141
192 Ga0163163_10000931 3300014325 Bacteria 24846
193 Ga0163163_10063679 3300014325 Bacteria 3657
194 Ga0163163_10220305 3300014325 Unclassified 1946
195 Ga0163163_10307115 3300014325 Bacteria 1639
196 Ga0157379_10546487 3300014968 Unclassified 1077
197 Ga0157376_10004803 3300014969 Bacteria 9411
198 Ga0157376_10027377 3300014969 Viruses 4517
199 Ga0157376_10282458 3300014969 Bacteria 1564
200 Ga0197907_10848964 3300020069 Unclassified 964
201 Ga0197907_11293215 3300020069 Viruses 2522
202 Ga0206356_10867179 3300020070 Viruses 2275
203 Ga0206349_1434759 3300020075 Viruses 1476
204 Ga0206352_11301967 3300020078 Viruses 1785
205 Ga0206350_11157929 3300020080 Viruses 2395
206 Ga0213872_10001062 3300021361 Bacteria 19023
207 Ga0213874_10013300 3300021377 Bacteria 2129
208 Ga0213874_10025875 3300021377 Viruses 1658
209 Ga0213876_10001717 3300021384 Bacteria 13299
210 Ga0213876_10003711 3300021384 Bacteria 8660
211 Ga0213876_10006903 3300021384 Bacteria 6186
212 Ga0213876_10046193 3300021384 Viruses 2303
213 Ga0213875_10000055 3300021388 Bacteria 139636
214 Ga0213875_10000062 3300021388 Bacteria 130710
215 Ga0213875_10003392 3300021388 Bacteria 9072
216 Ga0213875_10010921 3300021388 Bacteria 4536
217 Ga0213875_10029019 3300021388 Viruses 2623
218 Ga0213875_10044469 3300021388 Viruses 2085
219 Ga0213875_10059426 3300021388 Viruses 1789
220 Ga0213875_10083152 3300021388 Unclassified 1494
221 Ga0213875_10086373 3300021388 Bacteria 1463
222 Ga0213875_10102135 3300021388 Viruses 1338
223 Ga0213875_10123597 3300021388 Bacteria 1209
224 Ga0213875_10142370 3300021388 Bacteria 1123
225 Ga0207685_10092119 3300025905 Bacteria 1278
226 Ga0207643_10050966 3300025908 Bacteria 2349
227 Ga0207705_10189332 3300025909 Unclassified 1555
228 Ga0207705_10213484 3300025909 Bacteria 1464
229 Ga0207654_10040307 3300025911 Bacteria 2631
230 Ga0207654_10042888 3300025911 Viruses 2562
231 Ga0207707_10007586 3300025912 Bacteria 9454
232 Ga0207707_10041661 3300025912 Bacteria 4010
233 Ga0207707_10098718 3300025912 Bacteria 2552
234 Ga0207707_10114980 3300025912 Unclassified 2351
235 Ga0207695_10004081 3300025913 Bacteria 20068
236 Ga0207695_10006730 3300025913 Bacteria 14833
237 Ga0207695_10006762 3300025913 Bacteria 14787
238 Ga0207695_10007118 3300025913 Bacteria 14328
239 Ga0207695_10023474 3300025913 Bacteria 6967
240 Ga0207695_10023502 3300025913 Bacteria 6962
241 Ga0207695_10047793 3300025913 Bacteria 4524
242 Ga0207695_10051654 3300025913 Unclassified 4313
243 Ga0207695_10574851 3300025913 Bacteria 1008
244 Ga0207671_10368572 3300025914 Bacteria 1140
245 Ga0207660_10166511 3300025917 Bacteria 1704
246 Ga0207660_10312973 3300025917 Bacteria 1252
247 Ga0207657_10010431 3300025919 Bacteria 9272
248 Ga0207657_10086539 3300025919 Viruses 2623
249 Ga0207657_10257527 3300025919 Bacteria 1389
250 Ga0207649_10048629 3300025920 Unclassified 2616
251 Ga0207652_10025806 3300025921 Viruses 4889
252 Ga0207652_10251838 3300025921 Bacteria 1592
253 Ga0207694_10015129 3300025924 Bacteria 5818
254 Ga0207694_10021508 3300025924 Viruses 4888
255 Ga0207694_10136649 3300025924 Bacteria 1969
256 Ga0207694_10286581 3300025924 Unclassified 1354
257 Ga0207687_10019706 3300025927 Viruses 4472
258 Ga0207687_10031034 3300025927 Bacteria 3610
259 Ga0207687_10223930 3300025927 Bacteria 1482
260 Ga0207700_10000497 3300025928 Bacteria 23004
261 Ga0207700_10008427 3300025928 Bacteria 6385
262 Ga0207700_10069954 3300025928 Bacteria 2696
263 Ga0207700_10197120 3300025928 Bacteria 1695
264 Ga0207644_10373487 3300025931 Bacteria 1162
265 Ga0207690_10051348 3300025932 Viruses 2757
266 Ga0207686_10006398 3300025934 Bacteria 6338
267 Ga0207704_10051783 3300025938 Viruses 2485
268 Ga0207711_10035950 3300025941 Bacteria 4201
269 Ga0207711_10293497 3300025941 Unclassified 1499
270 Ga0207711_10447475 3300025941 Bacteria 1202
271 Ga0207661_10000012 3300025944 Bacteria 354345
272 Ga0207661_10013805 3300025944 Bacteria 5904
273 Ga0207661_10425711 3300025944 Bacteria 1206
274 Ga0207667_10012222 3300025949 Bacteria 9917
275 Ga0207667_10016934 3300025949 Viruses 8221
276 Ga0207667_10018236 3300025949 Bacteria 7876
277 Ga0207667_10030331 3300025949 Bacteria 5851
278 Ga0207667_10110463 3300025949 Bacteria 2836
279 Ga0207667_10112237 3300025949 Viruses 2811
280 Ga0207667_10123615 3300025949 Viruses 2666
281 Ga0207667_10181806 3300025949 Bacteria 2159
282 Ga0207712_10009241 3300025961 Bacteria 6241
283 Ga0207677_10141839 3300026023 Bacteria 1841
284 Ga0207703_10030748 3300026035 Viruses 4243
285 Ga0207703_10163938 3300026035 Bacteria 1949
286 Ga0207703_10206919 3300026035 Bacteria 1747
287 Ga0207639_10020225 3300026041 Viruses 4761
288 Ga0207639_10079276 3300026041 Bacteria 2595
289 Ga0207678_10021605 3300026067 Bacteria 5642
290 Ga0207678_10574782 3300026067 Unclassified 987
291 Ga0207702_10012407 3300026078 Bacteria 7096
292 Ga0207702_10104038 3300026078 Unclassified 2512
293 Ga0207702_10335250 3300026078 Unclassified 1444
294 Ga0207641_10104562 3300026088 Bacteria 2500
295 Ga0207641_10446856 3300026088 Bacteria 1249
296 Ga0207641_10513889 3300026088 Bacteria 1164
297 Ga0207648_10204316 3300026089 Bacteria 1753
298 Ga0207674_10002397 3300026116 Bacteria 23692
299 Ga0207674_10021885 3300026116 Bacteria 6878
300 Ga0207674_10356122 3300026116 Bacteria 1415
301 Ga0207683_10105533 3300026121 Bacteria 2518
302 Ga0207698_10063295 3300026142 Viruses 2894
303 Ga0207698_10318766 3300026142 Bacteria 1455
304 Ga0207698_10669943 3300026142 Bacteria 1030
305 Ga0268266_10022833 3300028379 Bacteria 5326
306 Ga0268266_10046968 3300028379 Bacteria 3697
307 Ga0268266_10296608 3300028379 Bacteria 1507
308 Ga0265338_10074458 3300028800 Bacteria 2888
309 Ga0265338_10078142 3300028800 Viruses 2793
310 Ga0265330_10109465 3300031235 Bacteria 1181
311 Ga0265328_10010773 3300031239 Bacteria 3672
312 Ga0265340_10028977 3300031247 Bacteria 2782
313 Ga0265331_10024603 3300031250 Viruses 3045
314 Ga0265316_10001075 3300031344 Bacteria 29538
315 Ga0265316_10009194 3300031344 Bacteria 9102
316 Ga0265316_10012300 3300031344 Bacteria 7680
317 Ga0265316_10030557 3300031344 Unclassified 4414
318 Ga0265316_10041450 3300031344 Bacteria 3684
319 Ga0265316_10053989 3300031344 Bacteria 3146
320 Ga0265316_10120251 3300031344 Bacteria 1984
321 Ga0265316_10239314 3300031344 Bacteria 1335
322 Ga0265316_10260985 3300031344 Bacteria 1270
323 Ga0307509_10262113 3300031507 Unclassified 1503
324 Ga0265313_10005023 3300031595 Bacteria 9879
325 Ga0265314_10001918 3300031711 Bacteria 22212
326 Ga0265314_10002232 3300031711 Bacteria 20152
327 Ga0265314_10010825 3300031711 Bacteria 7583
328 Ga0265314_10019196 3300031711 Bacteria 5301
329 Ga0265314_10131065 3300031711 Bacteria 1564
330 Ga0265342_10092106 3300031712 Bacteria 1737
331 Ga0373926_0059192 3300035083 Bacteria 1394
332 Ga0373934_0057896 3300035086 Viruses 1542
333 Ga0373954_0052069 3300035118 Bacteria 1924
334 Ga0373954_0103337 3300035118 Bacteria 1375
335 Ga0373931_0273367 3300035691 Bacteria 1035
336 Ga0373927_0001438 3300035695 Bacteria 17966
337 Ga0373927_0013216 3300035695 Bacteria 5490
338 Ga0373933_0272913 3300035724 Bacteria 1092
339 Ga0373947_0073156 3300035725 Bacteria 2106
340 Ga0373947_0083554 3300035725 Bacteria 1980
341 Ga0373947_0171016 3300035725 Unclassified 1410
342 Ga0373937_0038922 3300036401 Viruses 4333
343 Ga0373937_0078272 3300036401 Bacteria 3056
344 Ga0373937_0165269 3300036401 Archaea 2075
345 Ga0373937_0390209 3300036401 Bacteria 1321
346 Ga0373937_0392743 3300036401 Bacteria 1316
347 Ga0373925_0049438 3300037068 Bacteria 3134
348 Ga0373925_0159987 3300037068 Bacteria 1773
349 Ga0373925_0236187 3300037068 Bacteria 1463
350 Ga0373925_0271635 3300037068 Bacteria 1364
351 Ga0395900_0135762 3300037418 Bacteria 2520
352 Ga0395898_0081676 3300037466 Viruses 3116
353 Ga0436364_0134410 3300037853 Bacteria 2093
354 Ga0436364_0205846 3300037853 Bacteria 1589
355 Ga0436364_0206857 3300037853 Viruses 6475
356 Ga0436364_0336103 3300037853 Bacteria 5215
357 Ga0436364_0362621 3300037853 Bacteria 5134
358 Ga0436364_0402182 3300037853 Bacteria 6487
359 Ga0436364_0427912 3300037853 Viruses 1328
360 Ga0436364_0459004 3300037853 Bacteria 4892
361 Ga0436364_0494238 3300037853 Bacteria 2212
362 Ga0436364_0516615 3300037853 Bacteria 15775
363 Ga0436364_0516951 3300037853 Unclassified 1116
364 Ga0436364_0596581 3300037853 Bacteria 5297
365 Ga0436364_0697082 3300037853 Bacteria 3072
366 Ga0436364_0730731 3300037853 Bacteria 6705
367 Ga0436364_0732260 3300037853 Bacteria 5276
368 Ga0436364_0887224 3300037853 Viruses 4129
369 Ga0436364_0904557 3300037853 Unclassified 1334
370 Ga0436364_0911604 3300037853 Bacteria 1331
371 Ga0436364_0996957 3300037853 Bacteria 9063
372 Ga0436364_1135269 3300037853 Bacteria 21600
373 Ga0436364_1144799 3300037853 Bacteria 7398
374 Ga0436364_1150305 3300037853 Bacteria 8632
375 Ga0436364_1213202 3300037853 Viruses 895
376 Ga0436364_1424606 3300037853 Bacteria 107493
377 Ga0436364_1528714 3300037853 Bacteria 88642
378 Ga0436365_0253319 3300039437 Bacteria 2231
379 Ga0436365_0277001 3300039437 Bacteria 3867
380 Ga0436365_0462737 3300039437 Bacteria 2465
381 Ga0436365_0824019 3300039437 Bacteria 1366
382 Ga0436365_0879659 3300039437 Bacteria 13317
383 Ga0436365_0936518 3300039437 Bacteria 1873
384 Ga0436365_1082485 3300039437 Bacteria 3953
385 Ga0436365_1098231 3300039437 Bacteria 13732
386 Ga0436365_1593876 3300039437 Bacteria 996
387 Ga0436365_1639965 3300039437 Viruses 3117
388 Ga0436365_1855365 3300039437 Bacteria 34389
389 Ga0436360_1261606 3300039438 Bacteria 23783
390 Ga0436361_0283828 3300039447 Bacteria 41401
391 Ga0436361_0832642 3300039447 Viruses 2852
392 Ga0436362_0174705 3300039453 Bacteria 9173
393 Ga0436362_0480956 3300039453 Bacteria 9333
394 Ga0436362_0866268 3300039453 Bacteria 2118
395 Ga0451577_0640769 3300042876 Unclassified 964
396 Ga0466961_0238184 3300044693 Viruses 1119
397 Ga0466960_0131124 3300044901 Bacteria 1323
398 Ga0466959_0222897 3300045049 Viruses 1307
399 Ga0451576_0177311 3300045051 Unclassified 2225
400 Ga0451576_0517744 3300045051 Bacteria 1253
401 Ga0466967_0313350 3300045976 Viruses 1512
402 Ga0495592_0001943 3300046454 Bacteria 14571
403 Ga0495592_0194246 3300046454 Bacteria 1374
404 Ga0495629_0236849 3300046459 Bacteria 1257
405 Ga0495651_0007442 3300046462 Bacteria 8373
406 Ga0495651_0016175 3300046462 Bacteria 5777
407 Ga0495651_0244817 3300046462 Bacteria 1228
408 Ga0495653_0136182 3300046463 Bacteria 1732
409 Ga0495580_0030627 3300046472 Bacteria 3894
410 Ga0495580_0043301 3300046472 Bacteria 3204
411 Ga0495580_0149124 3300046472 Unclassified 1620
412 Ga0495662_0013882 3300046476 Bacteria 3920
413 Ga0495662_0083279 3300046476 Bacteria 1557
414 Ga0495664_0001850 3300046477 Bacteria 11247
415 Ga0495664_0006420 3300046477 Bacteria 6493
416 Ga0495594_0217710 3300046499 Bacteria 1089
417 Ga0495608_0012917 3300046511 Bacteria 5796
418 Ga0495608_0155758 3300046511 Bacteria 1454
419 Ga0495618_0036127 3300046514 Bacteria 3100
420 Ga0495628_0044618 3300046516 Bacteria 3525
421 Ga0495630_0109768 3300046517 Bacteria 2089
422 Ga0495630_0236435 3300046517 Bacteria 1396
423 Ga0495630_0307126 3300046517 Bacteria 1212
424 Ga0495652_0009354 3300046529 Bacteria 8906
425 Ga0495652_0193334 3300046529 Bacteria 1551
426 Ga0495665_0084816 3300046531 Bacteria 1665
427 Ga0495665_0107699 3300046531 Bacteria 1462
428 Ga0495665_0128303 3300046531 Bacteria 1328
429 Ga0495640_0028582 3300046533 Bacteria 4013
430 Ga0495640_0108958 3300046533 Bacteria 1811
431 Ga0495645_0046607 3300046543 Bacteria 3159
432 Ga0495667_0005757 3300046559 Bacteria 8393
433 Ga0495667_0009160 3300046559 Bacteria 6723
434 Ga0495667_0120338 3300046559 Bacteria 1695
435 Ga0495634_0042110 3300046642 Bacteria 3099
436 Ga0495635_0006647 3300046663 Bacteria 8073
437 Ga0495599_0004821 3300046678 Bacteria 8024
438 Ga0495599_0096050 3300046678 Bacteria 1848
439 Ga0495599_0162089 3300046678 Bacteria 1382
440 Ga0495623_0003483 3300046679 Bacteria 10425
441 Ga0495623_0018905 3300046679 Viruses 4449
442 Ga0495623_0072345 3300046679 Bacteria 2144
443 Ga0495623_0194417 3300046679 Bacteria 1170
444 Ga0495646_0006655 3300046680 Bacteria 7327
445 Ga0495658_0073890 3300046683 Bacteria 1986
446 Ga0495613_0035690 3300046689 Bacteria 3688
447 Ga0495613_0181962 3300046689 Bacteria 1488
448 Ga0495600_0019623 3300046809 Bacteria 4319
449 Ga0495600_0165579 3300046809 Bacteria 1428
450 Ga0495600_0296735 3300046809 Bacteria 1020
451 Ga0495581_0150539 3300047315 Bacteria 1359
452 Ga0495581_0236225 3300047315 Bacteria 1069
453 Ga0495604_0004291 3300047317 Bacteria 11290
454 Ga0495604_0075903 3300047317 Bacteria 2529
455 Ga0495604_0078585 3300047317 Bacteria 2476
456 Ga0495674_0006826 3300047319 Bacteria 10929
457 Ga0495674_0035792 3300047319 Bacteria 4475
458 Ga0495674_0076837 3300047319 Bacteria 2872
459 Ga0495674_0230208 3300047319 Bacteria 1529
460 Ga0495680_0050658 3300047322 Bacteria 3245
461 Ga0495675_0013710 3300047444 Bacteria 5123
462 Ga0495675_0057399 3300047444 Bacteria 2468
463 Ga0495675_0076112 3300047444 Bacteria 2115
464 Ga0495684_0000387 3300047471 Bacteria 35887
465 Ga0495602_0039330 3300048088 Viruses 4357
466 Ga0495602_0089056 3300048088 Viruses 2567
467 Ga0495602_0106898 3300048088 Bacteria 2283
468 Ga0496104_0369486 3300048907 Bacteria 1347
469 Ga0496108_0170870 3300048911 Viruses 1881
470 Ga0496112_0006898 3300048915 Bacteria 10019
471 Ga0496115_0059568 3300048918 Bacteria 3075
472 Ga0496126_0065702 3300048929 Bacteria 3246
473 Ga0501031_0008133 3300049568 Bacteria 6831
474 Ga0501032_0003438 3300049569 Bacteria 12122
475 Ga0501033_0067785 3300049570 Bacteria 2624
476 Ga0501033_0146061 3300049570 Bacteria 1708
477 Ga0501034_0026272 3300049571 Bacteria 5930
478 Ga0501034_0111377 3300049571 Bacteria 2727
479 Ga0501036_0000295 3300049572 Bacteria 34600
480 Ga0501036_0303205 3300049572 Bacteria 1336
481 Ga0501037_0031334 3300049573 Viruses 3925
482 Ga0501037_0218391 3300049573 Unclassified 1342
483 Ga0501038_0020090 3300049574 Bacteria 6010
484 Ga0501038_0081394 3300049574 Bacteria 2728
485 Ga0501038_0114047 3300049574 Unclassified 2235
486 Ga0501039_0004528 3300049575 Bacteria 10497
487 Ga0501043_0032502 3300049579 Bacteria 4103
488 Ga0501043_0056620 3300049579 Unclassified 3079
489 Ga0501046_0002357 3300049580 Bacteria 17782
490 Ga0501046_0062390 3300049580 Bacteria 2912
491 Ga0501046_0090960 3300049580 Bacteria 2347
492 Ga0501047_0000470 3300049581 Bacteria 43862
493 Ga0501047_0069129 3300049581 Bacteria 3401
494 Ga0501047_0074006 3300049581 Bacteria 3279
495 Ga0501047_0174250 3300049581 Unclassified 2019
496 Ga0501047_0337086 3300049581 Unclassified 1346
497 Ga0501048_0074030 3300049582 Bacteria 2403
498 Ga0501048_0128178 3300049582 Unclassified 1794
499 Ga0501067_0004928 3300049583 Bacteria 7421
500 Ga0501068_0001097 3300049584 Bacteria 14341
501 Ga0501070_0011941 3300049586 Bacteria 7336
502 Ga0501070_0051811 3300049586 Bacteria 3406
503 Ga0501070_0134517 3300049586 Bacteria 2041
504 Ga0501072_0003952 3300049588 Bacteria 11214
505 Ga0501073_0021752 3300049589 Viruses 4620
506 Ga0501073_0024763 3300049589 Bacteria 4309
507 Ga0501073_0085644 3300049589 Bacteria 2192
508 Ga0501073_0151856 3300049589 Bacteria 1605
509 Ga0501076_0072183 3300049592 Viruses 2762
510 Ga0501077_0022336 3300049593 Viruses 4007
511 Ga0501079_0005250 3300049741 Bacteria 9629
512 Ga0501079_0364211 3300049741 Bacteria 1133
513 Ga0501080_0000017 3300049742 Bacteria 96079
514 Ga0501080_0000207 3300049742 Bacteria 43471
515 Ga0501080_0006250 3300049742 Bacteria 10689
516 Ga0501083_0075934 3300049744 Unclassified 2230
517 Ga0501035_0023389 3300049822 Bacteria 5668
518 Ga0501035_0042127 3300049822 Viruses 4119
519 Ga0501035_0072832 3300049822 Viruses 3040
520 Ga0501035_0143567 3300049822 Bacteria 2074
521 Ga0501044_0000736 3300049823 Bacteria 39492
522 Ga0501044_0002076 3300049823 Bacteria 23081
523 Ga0501044_0002490 3300049823 Bacteria 21012
524 Ga0501044_0038141 3300049823 Bacteria 5018
525 Ga0501044_0050831 3300049823 Bacteria 4276
526 Ga0501044_0054541 3300049823 Unclassified 4108
527 Ga0501044_0389140 3300049823 Unclassified 1308
528 Ga0501044_0532612 3300049823 Unclassified 1073
529 nmdc:mga0qj67_216186_c1 3300050509 Unclassified 1556
530 nmdc:mga0qj67_33568_c1 3300050509 Viruses 4005
531 nmdc:mga06r32_71521_c1 3300050510 Viruses 3357
532 nmdc:mga0rr50_304547_c1 3300050513 Bacteria 1333
533 Ga0500604_0051828 3300053151 Unclassified 1268
534 Ga0501084_0014657 3300054114 Bacteria 6499
535 Ga0501082_0002252 3300060353 Bacteria 16888
536 Ga0501082_0002738 3300060353 Bacteria 15401
537 Ga0501082_0331204 3300060353 Bacteria 1327
538 Ga0530510_0070867 3300061734 Viruses 2530
539 Ga0105247_10151150
540 Ga0070658_10040575
541 Ga0070658_10067840
542 Ga0070658_10201336
543 Ga0070658_10435857
544 Ga0070683_100000021
545 Ga0070683_100002584
546 Ga0070683_100160713
547 Ga0070683_100181596
548 Ga0070683_100215736
549 Ga0070683_100325733
550 Ga0070680_100109285
551 Ga0070680_100123453
552 Ga0070660_100122592
553 Ga0070660_100130009
554 Ga0070660_100263055
555 Ga0070692_10143281
556 Ga0070692_10209110
557 Ga0070669_100368911
558 Ga0070688_100045422
559 Ga0070659_100072686
560 Ga0070659_100328190
561 Ga0070659_100415507
562 Ga0070667_100442996
563 Ga0070714_100144685
564 Ga0070713_100000052
565 Ga0070713_100019312
566 Ga0070713_100027678
567 Ga0070713_100167518
568 Ga0070713_100362562
569 Ga0070713_100410191
570 Ga0070713_100529663
571 Ga0070678_100170548
572 Ga0070681_10007838
573 Ga0070681_10106535
574 Ga0070681_10118146
575 Ga0070681_10153115
576 Ga0070681_10155564
577 Ga0070681_10437341
578 Ga0070681_10512958
579 Ga0068867_100159683
580 Ga0070706_100232479
581 Ga0070698_100138441
582 Ga0070679_100037406
583 Ga0070679_100078228
584 Ga0070679_100141743
585 Ga0070679_100307080
586 Ga0070679_100402053
587 Ga0070684_100000010
588 Ga0070684_100097899
589 Ga0070684_100127366
590 Ga0070684_100157652
591 Ga0070697_100017702
592 Ga0068853_100420068
593 Ga0070695_100035955
594 Ga0070665_100016122
595 Ga0070665_100236573
596 Ga0070665_100424822
597 Ga0068855_100010241
598 Ga0068855_100017350
599 Ga0068855_100040225
600 Ga0068855_100052860
601 Ga0068855_100088883
602 Ga0068855_100239178
603 Ga0070664_100089159
604 Ga0070664_100116539
605 Ga0068857_100004408
606 Ga0068857_100015452
607 Ga0068857_100050456
608 Ga0068856_100009053
609 Ga0068856_100023663
610 Ga0068856_100137194
611 Ga0070702_100003481
612 Ga0068852_100004822
613 Ga0068852_100187377
614 Ga0068852_100482831
615 Ga0068852_100653411
616 Ga0068859_100239505
617 Ga0068859_100340889
618 Ga0068859_100354044
619 Ga0068863_100023684
620 Ga0068863_100029066
621 Ga0068863_100068421
622 Ga0068858_100059195
623 Ga0068858_100259365
624 Ga0081539_10011092
625 Ga0070717_10007000
626 Ga0070717_10190528
627 Ga0070717_10221656
628 Ga0070717_10487526
629 Ga0070715_10092320
630 Ga0097621_100151557
631 Ga0068871_100025188
632 Ga0068871_100075657
633 Ga0068871_100252075
634 Ga0075428_100171941
635 Ga0075430_100038050
636 Ga0075430_100231453
637 Ga0075431_100070068
638 Ga0068865_100335894
639 Ga0075436_100311809
640 Ga0097620_100239503
641 Ga0097620_100340868
642 Ga0097620_100354013
643 Ga0105240_10001936
644 Ga0105240_10003354
645 Ga0105240_10011842
646 Ga0105240_10032340
647 Ga0105240_10070844
648 Ga0105240_10102829
649 Ga0105240_10452626
650 Ga0111539_10309575
651 Ga0105245_10017410
652 Ga0105245_10023366
653 Ga0105245_10029511
654 Ga0105245_10115768
655 Ga0105245_10290320
656 Ga0114129_10074402
657 Ga0105243_10303998
658 Ga0105241_10012259
659 Ga0105241_10105399
660 Ga0105241_10351814
661 Ga0105242_10023648
662 Ga0105242_10156729
663 Ga0105242_10341807
664 Ga0105242_10513240
665 Ga0105248_10016464
666 Ga0105248_10038620
667 Ga0105248_10131544
668 Ga0105248_10249987
669 Ga0105248_10381055
670 Ga0105248_10642411
671 Ga0105248_10773773
672 Ga0105237_10034181
673 Ga0105237_10047385
674 Ga0105237_10171722
675 Ga0105237_10443256
676 Ga0105237_10802322
677 Ga0105238_10013787
678 Ga0105238_10086542
679 Ga0105238_10157825
680 Ga0105238_10255060
681 Ga0105238_10424285
682 Ga0105238_10593680
683 Ga0105249_10010055
684 Ga0105249_10156889
685 Ga0105239_10004321
686 Ga0105239_10035080
687 Ga0105239_10431468
688 Ga0105246_10000845
689 Ga0105246_10081719
690 Ga0105246_10172131
691 Ga0157373_10011248
692 Ga0157370_10001347
693 Ga0157370_10012148
694 Ga0157370_10027230
695 Ga0157370_10062978
696 Ga0157370_10095712
697 Ga0157370_10151955
698 Ga0157370_10189699
699 Ga0157369_10003125
700 Ga0157369_10011045
701 Ga0157369_10030508
702 Ga0157369_10045981
703 Ga0157369_10086904
704 Ga0157369_10089729
705 Ga0157369_10105454
706 Ga0157369_10252381
707 Ga0157369_10273507
708 Ga0157369_10407099
709 Ga0157374_10017829
710 Ga0157374_10136644
711 Ga0157374_10144755
712 Ga0157378_10031917
713 Ga0157378_10422913
714 Ga0157378_10545766
715 Ga0163162_10002580
716 Ga0163162_10133036
717 Ga0163162_10243469
718 Ga0163162_10296228
719 Ga0157372_10142444
720 Ga0157372_10183407
721 Ga0157372_10277921
722 Ga0157372_10306166
723 Ga0157372_10384951
724 Ga0157372_10605008
725 Ga0157372_10747312
726 Ga0157375_10003291
727 Ga0157375_10111251
728 Ga0157375_10418908
729 Ga0157375_10732717
730 Ga0163163_10000931
731 Ga0163163_10063679
732 Ga0163163_10220305
733 Ga0163163_10307115
734 Ga0157379_10546487
735 Ga0157376_10004803
736 Ga0157376_10027377
737 Ga0157376_10282458
738 Ga0197907_10848964
739 Ga0197907_11293215
740 Ga0206356_10867179
741 Ga0206349_1434759
742 Ga0206352_11301967
743 Ga0206350_11157929
744 Ga0213872_10001062
745 Ga0213874_10013300
746 Ga0213874_10025875
747 Ga0213876_10001717
748 Ga0213876_10003711
749 Ga0213876_10006903
750 Ga0213876_10046193
751 Ga0213875_10000055
752 Ga0213875_10000062
753 Ga0213875_10003392
754 Ga0213875_10010921
755 Ga0213875_10029019
756 Ga0213875_10044469
757 Ga0213875_10059426
758 Ga0213875_10083152
759 Ga0213875_10086373
760 Ga0213875_10102135
761 Ga0213875_10123597
762 Ga0213875_10142370
763 Ga0207685_10092119
764 Ga0207643_10050966
765 Ga0207705_10189332
766 Ga0207705_10213484
767 Ga0207654_10040307
768 Ga0207654_10042888
769 Ga0207707_10007586
770 Ga0207707_10041661
771 Ga0207707_10098718
772 Ga0207707_10114980
773 Ga0207695_10004081
774 Ga0207695_10006730
775 Ga0207695_10006762
776 Ga0207695_10007118
777 Ga0207695_10023474
778 Ga0207695_10023502
779 Ga0207695_10047793
780 Ga0207695_10051654
781 Ga0207695_10574851
782 Ga0207671_10368572
783 Ga0207660_10166511
784 Ga0207660_10312973
785 Ga0207657_10010431
786 Ga0207657_10086539
787 Ga0207657_10257527
788 Ga0207649_10048629
789 Ga0207652_10025806
790 Ga0207652_10251838
791 Ga0207694_10015129
792 Ga0207694_10021508
793 Ga0207694_10136649
794 Ga0207694_10286581
795 Ga0207687_10019706
796 Ga0207687_10031034
797 Ga0207687_10223930
798 Ga0207700_10000497
799 Ga0207700_10008427
800 Ga0207700_10069954
801 Ga0207700_10197120
802 Ga0207644_10373487
803 Ga0207690_10051348
804 Ga0207686_10006398
805 Ga0207704_10051783
806 Ga0207711_10035950
807 Ga0207711_10293497
808 Ga0207711_10447475
809 Ga0207661_10000012
810 Ga0207661_10013805
811 Ga0207661_10425711
812 Ga0207667_10012222
813 Ga0207667_10016934
814 Ga0207667_10018236
815 Ga0207667_10030331
816 Ga0207667_10110463
817 Ga0207667_10112237
818 Ga0207667_10123615
819 Ga0207667_10181806
820 Ga0207712_10009241
821 Ga0207677_10141839
822 Ga0207703_10030748
823 Ga0207703_10163938
824 Ga0207703_10206919
825 Ga0207639_10020225
826 Ga0207639_10079276
827 Ga0207678_10021605
828 Ga0207678_10574782
829 Ga0207702_10012407
830 Ga0207702_10104038
831 Ga0207702_10335250
832 Ga0207641_10104562
833 Ga0207641_10446856
834 Ga0207641_10513889
835 Ga0207648_10204316
836 Ga0207674_10002397
837 Ga0207674_10021885
838 Ga0207674_10356122
839 Ga0207683_10105533
840 Ga0207698_10063295
841 Ga0207698_10318766
842 Ga0207698_10669943
843 Ga0268266_10022833
844 Ga0268266_10046968
845 Ga0268266_10296608
846 Ga0265338_10074458
847 Ga0265338_10078142
848 Ga0265330_10109465
849 Ga0265328_10010773
850 Ga0265340_10028977
851 Ga0265331_10024603
852 Ga0265316_10001075
853 Ga0265316_10009194
854 Ga0265316_10012300
855 Ga0265316_10030557
856 Ga0265316_10041450
857 Ga0265316_10053989
858 Ga0265316_10120251
859 Ga0265316_10239314
860 Ga0265316_10260985
861 Ga0307509_10262113
862 Ga0265313_10005023
863 Ga0265314_10001918
864 Ga0265314_10002232
865 Ga0265314_10010825
866 Ga0265314_10019196
867 Ga0265314_10131065
868 Ga0265342_10092106
869 Ga0373926_0059192
870 Ga0373934_0057896
871 Ga0373954_0052069
872 Ga0373954_0103337
873 Ga0373931_0273367
874 Ga0373927_0001438
875 Ga0373927_0013216
876 Ga0373933_0272913
877 Ga0373947_0073156
878 Ga0373947_0083554
879 Ga0373947_0171016
880 Ga0373937_0038922
881 Ga0373937_0078272
882 Ga0373937_0165269
883 Ga0373937_0390209
884 Ga0373937_0392743
885 Ga0373925_0049438
886 Ga0373925_0159987
887 Ga0373925_0236187
888 Ga0373925_0271635
889 Ga0395900_0135762
890 Ga0395898_0081676
891 Ga0436364_0134410
892 Ga0436364_0205846
893 Ga0436364_0206857
894 Ga0436364_0336103
895 Ga0436364_0362621
896 Ga0436364_0402182
897 Ga0436364_0427912
898 Ga0436364_0459004
899 Ga0436364_0494238
900 Ga0436364_0516615
901 Ga0436364_0516951
902 Ga0436364_0596581
903 Ga0436364_0697082
904 Ga0436364_0730731
905 Ga0436364_0732260
906 Ga0436364_0887224
907 Ga0436364_0904557
908 Ga0436364_0911604
909 Ga0436364_0996957
910 Ga0436364_1135269
911 Ga0436364_1144799
912 Ga0436364_1150305
913 Ga0436364_1213202
914 Ga0436364_1424606
915 Ga0436364_1528714
916 Ga0436365_0253319
917 Ga0436365_0277001
918 Ga0436365_0462737
919 Ga0436365_0824019
920 Ga0436365_0879659
921 Ga0436365_0936518
922 Ga0436365_1082485
923 Ga0436365_1098231
924 Ga0436365_1593876
925 Ga0436365_1639965
926 Ga0436365_1855365
927 Ga0436360_1261606
928 Ga0436361_0283828
929 Ga0436361_0832642
930 Ga0436362_0174705
931 Ga0436362_0480956
932 Ga0436362_0866268
933 Ga0451577_0640769
934 Ga0466961_0238184
935 Ga0466960_0131124
936 Ga0466959_0222897
937 Ga0451576_0177311
938 Ga0451576_0517744
939 Ga0466967_0313350
940 Ga0495592_0001943
941 Ga0495592_0194246
942 Ga0495629_0236849
943 Ga0495651_0007442
944 Ga0495651_0016175
945 Ga0495651_0244817
946 Ga0495653_0136182
947 Ga0495580_0030627
948 Ga0495580_0043301
949 Ga0495580_0149124
950 Ga0495662_0013882
951 Ga0495662_0083279
952 Ga0495664_0001850
953 Ga0495664_0006420
954 Ga0495594_0217710
955 Ga0495608_0012917
956 Ga0495608_0155758
957 Ga0495618_0036127
958 Ga0495628_0044618
959 Ga0495630_0109768
960 Ga0495630_0236435
961 Ga0495630_0307126
962 Ga0495652_0009354
963 Ga0495652_0193334
964 Ga0495665_0084816
965 Ga0495665_0107699
966 Ga0495665_0128303
967 Ga0495640_0028582
968 Ga0495640_0108958
969 Ga0495645_0046607
970 Ga0495667_0005757
971 Ga0495667_0009160
972 Ga0495667_0120338
973 Ga0495634_0042110
974 Ga0495635_0006647
975 Ga0495599_0004821
976 Ga0495599_0096050
977 Ga0495599_0162089
978 Ga0495623_0003483
979 Ga0495623_0018905
980 Ga0495623_0072345
981 Ga0495623_0194417
982 Ga0495646_0006655
983 Ga0495658_0073890
984 Ga0495613_0035690
985 Ga0495613_0181962
986 Ga0495600_0019623
987 Ga0495600_0165579
988 Ga0495600_0296735
989 Ga0495581_0150539
990 Ga0495581_0236225
991 Ga0495604_0004291
992 Ga0495604_0075903
993 Ga0495604_0078585
994 Ga0495674_0006826
995 Ga0495674_0035792
996 Ga0495674_0076837
997 Ga0495674_0230208
998 Ga0495680_0050658
999 Ga0495675_0013710
1000 Ga0495675_0057399
1001 Ga0495675_0076112
1002 Ga0495684_0000387
1003 Ga0495602_0039330
1004 Ga0495602_0089056
1005 Ga0495602_0106898
1006 Ga0496104_0369486
1007 Ga0496108_0170870
1008 Ga0496112_0006898
1009 Ga0496115_0059568
1010 Ga0496126_0065702
1011 Ga0501031_0008133
1012 Ga0501032_0003438
1013 Ga0501033_0067785
1014 Ga0501033_0146061
1015 Ga0501034_0026272
1016 Ga0501034_0111377
1017 Ga0501036_0000295
1018 Ga0501036_0303205
1019 Ga0501037_0031334
1020 Ga0501037_0218391
1021 Ga0501038_0020090
1022 Ga0501038_0081394
1023 Ga0501038_0114047
1024 Ga0501039_0004528
1025 Ga0501043_0032502
1026 Ga0501043_0056620
1027 Ga0501046_0002357
1028 Ga0501046_0062390
1029 Ga0501046_0090960
1030 Ga0501047_0000470
1031 Ga0501047_0069129
1032 Ga0501047_0074006
1033 Ga0501047_0174250
1034 Ga0501047_0337086
1035 Ga0501048_0074030
1036 Ga0501048_0128178
1037 Ga0501067_0004928
1038 Ga0501068_0001097
1039 Ga0501070_0011941
1040 Ga0501070_0051811
1041 Ga0501070_0134517
1042 Ga0501072_0003952
1043 Ga0501073_0021752
1044 Ga0501073_0024763
1045 Ga0501073_0085644
1046 Ga0501073_0151856
1047 Ga0501076_0072183
1048 Ga0501077_0022336
1049 Ga0501079_0005250
1050 Ga0501079_0364211
1051 Ga0501080_0000017
1052 Ga0501080_0000207
1053 Ga0501080_0006250
1054 Ga0501083_0075934
1055 Ga0501035_0023389
1056 Ga0501035_0042127
1057 Ga0501035_0072832
1058 Ga0501035_0143567
1059 Ga0501044_0000736
1060 Ga0501044_0002076
1061 Ga0501044_0002490
1062 Ga0501044_0038141
1063 Ga0501044_0050831
1064 Ga0501044_0054541
1065 Ga0501044_0389140
1066 Ga0501044_0532612
1067 nmdc:mga0qj67_216186_c1
1068 nmdc:mga0qj67_33568_c1
1069 nmdc:mga06r32_71521_c1
1070 nmdc:mga0rr50_304547_c1
1071 Ga0500604_0051828
1072 Ga0501084_0014657
1073 Ga0501082_0002252
1074 Ga0501082_0002738
1075 Ga0501082_0331204
1076 Ga0530510_0070867

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11651

P22_CoatProtein

P22 coat protein - gene protein 5

29

258

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d8e-assembly3.cif.gz_C crystal structure of the human fe65-ptb1 domain (trigonal crystal form) 0.7058 245 276
8i1v-assembly1.cif.gz_G the asymmetric unit of p22 procapsid 0.6885 3 290
8i1v-assembly1.cif.gz_G the asymmetric unit of p22 procapsid 0.6781 3 290
8i1v-assembly1.cif.gz_C the asymmetric unit of p22 procapsid 0.6629 11 290
8e16-assembly1.cif.gz_I mycobacterium phage che8 0.6624 28 290
ID Description Score Start End Superfamily
3fg8C00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.6478 241 273 3.30.450.20
1v5vB01 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Probable tRNA modification gtpase trme; domain 1 0.644 246 276 3.30.1360.120
af_P96819_1_121_3.30.310.20 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;DNA-3-methyladenine glycosylase AlkA, N-terminal domain 0.6112 233 273 3.30.310.20
af_Q9VY39_49_289_3.40.33.10 Alpha Beta;3-Layer(aba) Sandwich;Pathogenesis-related Protein p14a;CAP 0.6046 256 278 3.40.33.10
af_P71947_196_475_3.30.2400.10 Alpha Beta;2-Layer Sandwich;Major capsid protein gp5 fold;Major capsid protein gp5 0.5979 47 292 3.30.2400.10
ID Description Score Start End GO Terms
AF-A0A7C3QS98-F1-model_v4 Uncharacterized protein 0.8611 79 292
AF-G4WW22-F1-model_v4 p22 coat protein 0.8399 1 292
AF-G4WW22-F1-model_v4 p22 coat protein 0.8372 1 292
AF-A0A2M7PT27-F1-model_v4 Phage major capsid protein 0.8301 87 292
AF-A0A7C3QS98-F1-model_v4 Uncharacterized protein 0.8164 79 292

Map