F460826

General Info

Members Datasets Scaffolds Average Seq Length
536 225 1072 165

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_1219144|Ga0466967_1219144_19_606
Length 195
Sequence MRRCLGASPPRRRRGPPGACLSLRASAYTAAVDADIEQPVAARLGELAIPFERYEHPPVATVEEASRYWRGIDSSHCKNLFLRNQKGNRHYLVVLLHDKRADLKAVADQIGDGKLSFASPERLLAHLGLTPGSVSPFGLMNDASHAVRVVLERDLKQTSRVSFHPNINTRTYVVSTADFMRFLEASGNVVQYVTV

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
152 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
153 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
154 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
155 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
156 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
157 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
158 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
159 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
160 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
161 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
162 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
163 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
164 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
165 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
166 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
167 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
168 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
169 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
170 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
175 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
176 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
177 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
178 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
179 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
180 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
181 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
182 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
183 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
184 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
185 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
186 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
187 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
188 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
189 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
192 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
193 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
205 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
206 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
211 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
212 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
213 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
214 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
215 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
219 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
220 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
221 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
222 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
223 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
224 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
225 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.99
Rhizosphere 97.01
Stem 0
Stem Tuber 0
Unclassified 23.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_1219144 3300045976 Bacteria 750
2 Ga0065712_10264177 3300005290 Unclassified 930
3 Ga0065707_10209326 3300005295 Bacteria 1273
4 Ga0065707_10451801 3300005295 Bacteria 782
5 Ga0070676_10493719 3300005328 Bacteria 868
6 Ga0070690_100001578 3300005330 Bacteria 11953
7 Ga0070670_100160662 3300005331 Bacteria 1947
8 Ga0070677_10042613 3300005333 Bacteria 1799
9 Ga0068869_100182724 3300005334 Bacteria 1645
10 Ga0070666_10024899 3300005335 Bacteria 3901
11 Ga0070666_10030749 3300005335 Bacteria 3540
12 Ga0070666_10314169 3300005335 Bacteria 1117
13 Ga0070666_10601868 3300005335 Unclassified 802
14 Ga0070682_101170799 3300005337 Unclassified 647
15 Ga0068868_100103479 3300005338 Unclassified 2306
16 Ga0068868_100150478 3300005338 Unclassified 1916
17 Ga0068868_100172955 3300005338 Bacteria 1788
18 Ga0068868_100469071 3300005338 Unclassified 1098
19 Ga0070660_100139240 3300005339 Unclassified 1946
20 Ga0070689_100257217 3300005340 Bacteria 1442
21 Ga0070691_10002940 3300005341 Bacteria 7636
22 Ga0070668_100018144 3300005347 Bacteria 5279
23 Ga0070668_100162491 3300005347 Bacteria 1813
24 Ga0070669_100047122 3300005353 Bacteria 3144
25 Ga0070669_100070404 3300005353 Bacteria 2585
26 Ga0070669_100127569 3300005353 Bacteria 1948
27 Ga0070669_100244906 3300005353 Bacteria 1425
28 Ga0070675_100000150 3300005354 Bacteria 42017
29 Ga0070675_100290972 3300005354 Bacteria 1437
30 Ga0070675_100352010 3300005354 Bacteria 1306
31 Ga0070675_100977604 3300005354 Bacteria 777
32 Ga0070671_100271628 3300005355 Bacteria 1441
33 Ga0070671_100464751 3300005355 Bacteria 1086
34 Ga0070671_101251151 3300005355 Unclassified 654
35 Ga0070674_100395121 3300005356 Bacteria 1128
36 Ga0070674_100659371 3300005356 Unclassified 890
37 Ga0070673_100130209 3300005364 Bacteria 2110
38 Ga0070673_100336966 3300005364 Bacteria 1336
39 Ga0070688_100020782 3300005365 Bacteria 3824
40 Ga0070688_100160298 3300005365 Bacteria 1545
41 Ga0070688_100565816 3300005365 Bacteria 866
42 Ga0070659_100089347 3300005366 Bacteria 2468
43 Ga0070659_100340776 3300005366 Bacteria 1256
44 Ga0070667_101638301 3300005367 Unclassified 605
45 Ga0070709_10219905 3300005434 Bacteria 1354
46 Ga0070714_100016209 3300005435 Bacteria 6012
47 Ga0070701_10053872 3300005438 Bacteria 2095
48 Ga0070701_10468596 3300005438 Bacteria 812
49 Ga0070705_100479838 3300005440 Viruses 939
50 Ga0070700_100002889 3300005441 Bacteria 8827
51 Ga0070700_100179580 3300005441 Bacteria 1472
52 Ga0070694_100003213 3300005444 Bacteria 9754
53 Ga0070694_100009123 3300005444 Bacteria 6085
54 Ga0070694_100596163 3300005444 Bacteria 889
55 Ga0070708_100017122 3300005445 Bacteria 6036
56 Ga0070708_100091455 3300005445 Bacteria 2771
57 Ga0070708_101169261 3300005445 Bacteria 720
58 Ga0070678_100230191 3300005456 Bacteria 1545
59 Ga0070678_101430231 3300005456 Unclassified 646
60 Ga0070662_100188410 3300005457 Bacteria 1630
61 Ga0070662_100393785 3300005457 Bacteria 1142
62 Ga0070662_100418104 3300005457 Bacteria 1109
63 Ga0070662_100520145 3300005457 Unclassified 994
64 Ga0070681_10007882 3300005458 Bacteria 10421
65 Ga0070681_10232766 3300005458 Bacteria 1757
66 Ga0070681_10489259 3300005458 Bacteria 1143
67 Ga0068867_100012968 3300005459 Bacteria 5898
68 Ga0068867_100041091 3300005459 Bacteria 3379
69 Ga0068867_100956331 3300005459 Bacteria 774
70 Ga0070685_10388705 3300005466 Bacteria 963
71 Ga0070706_100311441 3300005467 Unclassified 1469
72 Ga0070707_100026548 3300005468 Bacteria 5499
73 Ga0070707_100207284 3300005468 Bacteria 1911
74 Ga0070698_100039805 3300005471 Bacteria 4835
75 Ga0070698_100126829 3300005471 Bacteria 2509
76 Ga0070698_100209221 3300005471 Bacteria 1886
77 Ga0070698_100489966 3300005471 Unclassified 1167
78 Ga0070698_101030695 3300005471 Unclassified 770
79 Ga0070699_100045481 3300005518 Bacteria 3799
80 Ga0070699_100915655 3300005518 Bacteria 803
81 Ga0070699_101046619 3300005518 Bacteria 749
82 Ga0070699_101728343 3300005518 Unclassified 573
83 Ga0070679_100090928 3300005530 Bacteria 3040
84 Ga0070697_100005325 3300005536 Bacteria 9888
85 Ga0070697_100225903 3300005536 Bacteria 1596
86 Ga0070697_100436207 3300005536 Unclassified 1140
87 Ga0070697_101527037 3300005536 Bacteria 597
88 Ga0070672_100127035 3300005543 Unclassified 2092
89 Ga0070672_100611771 3300005543 Unclassified 950
90 Ga0070686_100058282 3300005544 Bacteria 2484
91 Ga0070686_100138008 3300005544 Unclassified 1694
92 Ga0070686_100154266 3300005544 Bacteria 1611
93 Ga0070686_100191465 3300005544 Bacteria 1460
94 Ga0070686_100721588 3300005544 Bacteria 797
95 Ga0070695_100004153 3300005545 Bacteria 8466
96 Ga0070695_100045214 3300005545 Bacteria 2805
97 Ga0070696_100052507 3300005546 Bacteria 2836
98 Ga0070696_100070494 3300005546 Bacteria 2459
99 Ga0070696_100328403 3300005546 Bacteria 1179
100 Ga0070665_100094477 3300005548 Bacteria 2995
101 Ga0070665_100239328 3300005548 Bacteria 1816
102 Ga0070704_100014705 3300005549 Bacteria 4894
103 Ga0070704_100169761 3300005549 Bacteria 1733
104 Ga0070704_100193583 3300005549 Bacteria 1636
105 Ga0070704_100223896 3300005549 Bacteria 1531
106 Ga0070704_101414662 3300005549 Unclassified 638
107 Ga0068855_100298927 3300005563 Bacteria 1783
108 Ga0070664_100439450 3300005564 Bacteria 1197
109 Ga0068857_100104554 3300005577 Bacteria 2542
110 Ga0068854_100015173 3300005578 Bacteria 5098
111 Ga0068854_100020249 3300005578 Bacteria 4498
112 Ga0068854_100087961 3300005578 Bacteria 2306
113 Ga0068852_101140728 3300005616 Bacteria 800
114 Ga0068859_100044622 3300005617 Bacteria 4454
115 Ga0068859_100066515 3300005617 Bacteria 3639
116 Ga0068859_100907044 3300005617 Unclassified 966
117 Ga0068859_101998498 3300005617 Unclassified 640
118 Ga0068864_100054097 3300005618 Bacteria 3464
119 Ga0068864_100057697 3300005618 Bacteria 3354
120 Ga0068864_100088920 3300005618 Bacteria 2721
121 Ga0068864_101249403 3300005618 Unclassified 742
122 Ga0068866_10089166 3300005718 Bacteria 1675
123 Ga0068866_10163619 3300005718 Bacteria 1300
124 Ga0068861_100004082 3300005719 Bacteria 9787
125 Ga0068861_100301238 3300005719 Bacteria 1388
126 Ga0068861_100930053 3300005719 Bacteria 825
127 Ga0068851_10537248 3300005834 Unclassified 705
128 Ga0068870_10393348 3300005840 Unclassified 900
129 Ga0068863_100098859 3300005841 Bacteria 2772
130 Ga0068858_100060727 3300005842 Bacteria 3494
131 Ga0068858_100074374 3300005842 Bacteria 3154
132 Ga0068858_100135908 3300005842 Bacteria 2307
133 Ga0068858_100526790 3300005842 Bacteria 1143
134 Ga0068860_100266369 3300005843 Bacteria 1671
135 Ga0068860_100426777 3300005843 Bacteria 1315
136 Ga0068860_100515727 3300005843 Unclassified 1195
137 Ga0068860_100869890 3300005843 Unclassified 917
138 Ga0068862_100138930 3300005844 Bacteria 2155
139 Ga0068862_100171000 3300005844 Bacteria 1945
140 Ga0068862_100397625 3300005844 Bacteria 1288
141 Ga0068862_100592241 3300005844 Bacteria 1063
142 Ga0081539_10021678 3300005985 Bacteria 4281
143 Ga0081539_10123614 3300005985 Bacteria 1281
144 Ga0075432_10011323 3300006058 Bacteria 3031
145 Ga0075432_10169810 3300006058 Bacteria 848
146 Ga0070715_10291676 3300006163 Unclassified 869
147 Ga0070716_100695902 3300006173 Bacteria 776
148 Ga0097621_100034315 3300006237 Unclassified 4047
149 Ga0097621_100056477 3300006237 Bacteria 3207
150 Ga0097621_100138331 3300006237 Bacteria 2079
151 Ga0068871_100010147 3300006358 Bacteria 6857
152 Ga0068871_100015645 3300006358 Bacteria 5686
153 Ga0068871_100016541 3300006358 Bacteria 5560
154 Ga0068871_101842845 3300006358 Bacteria 575
155 Ga0075433_10139437 3300006852 Bacteria 2155
156 Ga0075433_10175723 3300006852 Unclassified 1906
157 Ga0075433_10250425 3300006852 Bacteria 1572
158 Ga0075434_100000761 3300006871 Bacteria 25412
159 Ga0075434_100265620 3300006871 Bacteria 1735
160 Ga0075434_100314676 3300006871 Bacteria 1586
161 Ga0075434_100319777 3300006871 Bacteria 1572
162 Ga0075434_100571418 3300006871 Bacteria 1150
163 Ga0075434_100648391 3300006871 Bacteria 1074
164 Ga0075434_101014246 3300006871 Bacteria 844
165 Ga0075434_101172345 3300006871 Bacteria 781
166 Ga0075434_101329522 3300006871 Bacteria 729
167 Ga0075429_100356087 3300006880 Bacteria 1281
168 Ga0068865_100021711 3300006881 Bacteria 4179
169 Ga0068865_100073642 3300006881 Bacteria 2429
170 Ga0068865_100260593 3300006881 Bacteria 1372
171 Ga0068865_100326412 3300006881 Bacteria 1236
172 Ga0068865_101069704 3300006881 Unclassified 709
173 Ga0075436_100001518 3300006914 Bacteria 15844
174 Ga0075436_100010088 3300006914 Bacteria 6465
175 Ga0075436_100029483 3300006914 Bacteria 3773
176 Ga0075436_100284563 3300006914 Bacteria 1182
177 Ga0075436_100469455 3300006914 Bacteria 918
178 Ga0075436_100505604 3300006914 Unclassified 884
179 Ga0075436_100591795 3300006914 Bacteria 817
180 Ga0097620_100044622 3300006931 Bacteria 4454
181 Ga0097620_100066514 3300006931 Bacteria 3639
182 Ga0097620_100907087 3300006931 Unclassified 966
183 Ga0075435_100000057 3300007076 Bacteria 58158
184 Ga0075435_100001476 3300007076 Bacteria 15107
185 Ga0075435_100063518 3300007076 Bacteria 2999
186 Ga0075435_100105553 3300007076 Bacteria 2338
187 Ga0075435_100129717 3300007076 Bacteria 2109
188 Ga0075435_100200736 3300007076 Bacteria 1690
189 Ga0075435_100211871 3300007076 Bacteria 1644
190 Ga0075435_100669640 3300007076 Bacteria 901
191 Ga0075435_101175832 3300007076 Bacteria 671
192 Ga0105251_10173918 3300009011 Unclassified 970
193 Ga0105240_10015853 3300009093 Bacteria 10224
194 Ga0105240_10109366 3300009093 Bacteria 3347
195 Ga0105240_10826428 3300009093 Unclassified 1002
196 Ga0111539_10005814 3300009094 Bacteria 15944
197 Ga0111539_10006524 3300009094 Bacteria 15032
198 Ga0111539_10247892 3300009094 Bacteria 2074
199 Ga0111539_12062042 3300009094 Unclassified 662
200 Ga0105245_10026818 3300009098 Bacteria 5073
201 Ga0105245_10036900 3300009098 Bacteria 4344
202 Ga0105245_10256823 3300009098 Bacteria 1699
203 Ga0105245_10306042 3300009098 Unclassified 1561
204 Ga0105245_10591753 3300009098 Unclassified 1135
205 Ga0105245_11644451 3300009098 Bacteria 694
206 Ga0105247_10005554 3300009101 Bacteria 7927
207 Ga0105247_10634028 3300009101 Unclassified 796
208 Ga0114129_10013691 3300009147 Bacteria 11558
209 Ga0114129_10024677 3300009147 Bacteria 8521
210 Ga0114129_10031900 3300009147 Bacteria 7449
211 Ga0114129_10037031 3300009147 Bacteria 6888
212 Ga0114129_10100235 3300009147 Bacteria 4008
213 Ga0114129_10157032 3300009147 Bacteria 3110
214 Ga0114129_10245651 3300009147 Bacteria 2404
215 Ga0114129_11862065 3300009147 Unclassified 730
216 Ga0114129_12250556 3300009147 Bacteria 655
217 Ga0105243_10025628 3300009148 Bacteria 4508
218 Ga0105243_10473516 3300009148 Bacteria 1180
219 Ga0105243_10686686 3300009148 Bacteria 996
220 Ga0105243_11407271 3300009148 Unclassified 718
221 Ga0105241_10031950 3300009174 Bacteria 3943
222 Ga0105242_10007835 3300009176 Bacteria 8219
223 Ga0105242_10031915 3300009176 Bacteria 4211
224 Ga0105242_10079191 3300009176 Bacteria 2744
225 Ga0105242_10195183 3300009176 Bacteria 1795
226 Ga0105242_10306866 3300009176 Bacteria 1451
227 Ga0105242_11257384 3300009176 Unclassified 762
228 Ga0105248_10009442 3300009177 Bacteria 10740
229 Ga0105248_10037669 3300009177 Bacteria 5411
230 Ga0105248_10268911 3300009177 Bacteria 1919
231 Ga0105248_10316872 3300009177 Unclassified 1757
232 Ga0105248_10322349 3300009177 Bacteria 1740
233 Ga0105248_10381782 3300009177 Bacteria 1586
234 Ga0105248_10383868 3300009177 Bacteria 1582
235 Ga0105248_10598530 3300009177 Bacteria 1244
236 Ga0105237_10464479 3300009545 Unclassified 1272
237 Ga0105237_10600502 3300009545 Unclassified 1108
238 Ga0105238_11284284 3300009551 Unclassified 758
239 Ga0105238_11724481 3300009551 Bacteria 658
240 Ga0105249_10073318 3300009553 Bacteria 3167
241 Ga0105249_10182755 3300009553 Unclassified 2041
242 Ga0105249_10645235 3300009553 Bacteria 1116
243 Ga0105249_11381694 3300009553 Viruses 776
244 Ga0105239_10417917 3300010375 Bacteria 1519
245 Ga0105239_11739606 3300010375 Unclassified 722
246 Ga0105246_10205299 3300011119 Unclassified 1535
247 Ga0105246_10284623 3300011119 Bacteria 1328
248 Ga0105246_10327298 3300011119 Bacteria 1248
249 Ga0105246_10720424 3300011119 Bacteria 876
250 Ga0157374_10020117 3300013296 Bacteria 5918
251 Ga0157378_10751354 3300013297 Bacteria 998
252 Ga0157378_11006716 3300013297 Unclassified 868
253 Ga0163162_10198546 3300013306 Unclassified 2134
254 Ga0163162_10369237 3300013306 Bacteria 1568
255 Ga0163162_10594715 3300013306 Bacteria 1233
256 Ga0163162_11213595 3300013306 Bacteria 856
257 Ga0157375_10367178 3300013308 Bacteria 1605
258 Ga0163163_10005014 3300014325 Bacteria 11411
259 Ga0163163_10130352 3300014325 Bacteria 2554
260 Ga0163163_10842025 3300014325 Unclassified 981
261 Ga0157380_10055593 3300014326 Bacteria 3144
262 Ga0157380_10305101 3300014326 Unclassified 1468
263 Ga0157380_11098973 3300014326 Bacteria 834
264 Ga0157380_11835914 3300014326 Unclassified 666
265 Ga0157380_12254236 3300014326 Unclassified 609
266 Ga0157377_10013879 3300014745 Bacteria 4086
267 Ga0157379_10022768 3300014968 Bacteria 5552
268 Ga0157379_10072655 3300014968 Bacteria 3078
269 Ga0157379_10155720 3300014968 Bacteria 2061
270 Ga0157379_10832700 3300014968 Unclassified 872
271 Ga0157376_10008125 3300014969 Bacteria 7542
272 Ga0157376_10078643 3300014969 Unclassified 2825
273 Ga0157376_10213950 3300014969 Unclassified 1781
274 Ga0207697_10195486 3300025315 Unclassified 889
275 Ga0207713_1137918 3300025735 Bacteria 799
276 Ga0207682_10018272 3300025893 Bacteria 2742
277 Ga0207642_10083114 3300025899 Bacteria 1560
278 Ga0207642_10404051 3300025899 Unclassified 818
279 Ga0207642_10441951 3300025899 Bacteria 786
280 Ga0207710_10011786 3300025900 Bacteria 3677
281 Ga0207680_10063304 3300025903 Bacteria 2263
282 Ga0207680_10226596 3300025903 Unclassified 1283
283 Ga0207645_10006373 3300025907 Bacteria 8477
284 Ga0207645_10126624 3300025907 Bacteria 1660
285 Ga0207684_10178300 3300025910 Unclassified 1832
286 Ga0207654_10222886 3300025911 Unclassified 1252
287 Ga0207707_10420382 3300025912 Bacteria 1146
288 Ga0207707_10435365 3300025912 Bacteria 1123
289 Ga0207660_10506522 3300025917 Bacteria 980
290 Ga0207662_10026028 3300025918 Bacteria 3373
291 Ga0207662_10265171 3300025918 Bacteria 1132
292 Ga0207662_10397635 3300025918 Bacteria 934
293 Ga0207657_10114206 3300025919 Bacteria 2227
294 Ga0207652_10110373 3300025921 Bacteria 2439
295 Ga0207652_10497863 3300025921 Bacteria 1097
296 Ga0207646_10064230 3300025922 Bacteria 3276
297 Ga0207646_10164362 3300025922 Bacteria 2004
298 Ga0207646_10524782 3300025922 Bacteria 1066
299 Ga0207681_10010827 3300025923 Bacteria 5602
300 Ga0207681_10806891 3300025923 Unclassified 784
301 Ga0207650_10163731 3300025925 Bacteria 1764
302 Ga0207650_11015730 3300025925 Unclassified 705
303 Ga0207659_10000529 3300025926 Bacteria 22804
304 Ga0207659_10187242 3300025926 Bacteria 1644
305 Ga0207659_10354870 3300025926 Bacteria 1217
306 Ga0207687_10077246 3300025927 Unclassified 2394
307 Ga0207687_10326337 3300025927 Bacteria 1244
308 Ga0207687_10369386 3300025927 Unclassified 1173
309 Ga0207687_10714711 3300025927 Bacteria 851
310 Ga0207664_10044699 3300025929 Bacteria 3470
311 Ga0207644_10041408 3300025931 Bacteria 3259
312 Ga0207644_10815589 3300025931 Bacteria 781
313 Ga0207690_10162787 3300025932 Bacteria 1665
314 Ga0207690_10506586 3300025932 Bacteria 977
315 Ga0207706_10050851 3300025933 Bacteria 3661
316 Ga0207706_10586260 3300025933 Unclassified 958
317 Ga0207686_10012981 3300025934 Bacteria 4597
318 Ga0207686_10126485 3300025934 Unclassified 1747
319 Ga0207686_10161872 3300025934 Unclassified 1569
320 Ga0207686_10183606 3300025934 Unclassified 1485
321 Ga0207709_10005722 3300025935 Bacteria 7019
322 Ga0207709_10010343 3300025935 Bacteria 5138
323 Ga0207709_10077822 3300025935 Bacteria 2127
324 Ga0207670_10079424 3300025936 Bacteria 2290
325 Ga0207670_10346719 3300025936 Unclassified 1175
326 Ga0207669_10006050 3300025937 Bacteria 5492
327 Ga0207704_10137066 3300025938 Bacteria 1706
328 Ga0207704_10191167 3300025938 Bacteria 1489
329 Ga0207704_10210917 3300025938 Bacteria 1429
330 Ga0207704_10248295 3300025938 Bacteria 1334
331 Ga0207691_10127069 3300025940 Unclassified 2255
332 Ga0207691_10652459 3300025940 Unclassified 889
333 Ga0207691_10675434 3300025940 Unclassified 872
334 Ga0207711_10057059 3300025941 Bacteria 3357
335 Ga0207711_10103585 3300025941 Unclassified 2520
336 Ga0207711_10273299 3300025941 Unclassified 1555
337 Ga0207711_10450428 3300025941 Bacteria 1198
338 Ga0207711_10520485 3300025941 Bacteria 1109
339 Ga0207689_10051530 3300025942 Bacteria 3393
340 Ga0207689_10375400 3300025942 Unclassified 1184
341 Ga0207689_10772867 3300025942 Bacteria 811
342 Ga0207667_10269246 3300025949 Bacteria 1741
343 Ga0207651_10019901 3300025960 Bacteria 4036
344 Ga0207651_10157112 3300025960 Bacteria 1778
345 Ga0207651_10420102 3300025960 Bacteria 1141
346 Ga0207712_10928670 3300025961 Viruses 770
347 Ga0207668_10112799 3300025972 Bacteria 2043
348 Ga0207640_10041821 3300025981 Bacteria 2917
349 Ga0207640_10053021 3300025981 Bacteria 2645
350 Ga0207640_10177912 3300025981 Unclassified 1592
351 Ga0207640_10406309 3300025981 Bacteria 1110
352 Ga0207640_11810187 3300025981 Bacteria 552
353 Ga0207677_10008794 3300026023 Bacteria 5658
354 Ga0207677_10037131 3300026023 Unclassified 3181
355 Ga0207677_10425213 3300026023 Unclassified 1132
356 Ga0207703_10070300 3300026035 Unclassified 2889
357 Ga0207703_10077783 3300026035 Bacteria 2755
358 Ga0207703_10297403 3300026035 Bacteria 1471
359 Ga0207708_10006622 3300026075 Bacteria 8575
360 Ga0207708_10032358 3300026075 Bacteria 3972
361 Ga0207708_10362240 3300026075 Bacteria 1192
362 Ga0207708_10744239 3300026075 Unclassified 841
363 Ga0207708_10920612 3300026075 Unclassified 757
364 Ga0207641_10201572 3300026088 Bacteria 1835
365 Ga0207641_10368098 3300026088 Unclassified 1374
366 Ga0207648_10020640 3300026089 Bacteria 5932
367 Ga0207648_10027686 3300026089 Bacteria 5030
368 Ga0207648_10059141 3300026089 Bacteria 3342
369 Ga0207648_10175255 3300026089 Unclassified 1896
370 Ga0207676_10033531 3300026095 Bacteria 3880
371 Ga0207676_10034294 3300026095 Bacteria 3842
372 Ga0207676_10053267 3300026095 Bacteria 3167
373 Ga0207676_10098963 3300026095 Bacteria 2413
374 Ga0207676_10395237 3300026095 Unclassified 1291
375 Ga0207674_10055760 3300026116 Bacteria 4016
376 Ga0207675_100004793 3300026118 Bacteria 13031
377 Ga0207675_100007166 3300026118 Bacteria 10540
378 Ga0207675_100035206 3300026118 Bacteria 4670
379 Ga0207675_100554609 3300026118 Bacteria 1148
380 Ga0207675_100587606 3300026118 Unclassified 1115
381 Ga0207683_10255295 3300026121 Bacteria 1600
382 Ga0207683_11284654 3300026121 Unclassified 678
383 Ga0207683_11288979 3300026121 Bacteria 676
384 Ga0207683_11512635 3300026121 Unclassified 620
385 Ga0209998_10022230 3300027717 Bacteria 1367
386 Ga0207428_10019113 3300027907 Bacteria 5842
387 Ga0268266_10304175 3300028379 Bacteria 1488
388 Ga0268266_10420425 3300028379 Unclassified 1266
389 Ga0268266_10445622 3300028379 Bacteria 1230
390 Ga0268265_10011853 3300028380 Bacteria 5893
391 Ga0268265_10089401 3300028380 Bacteria 2456
392 Ga0268265_10228609 3300028380 Unclassified 1633
393 Ga0268265_10637911 3300028380 Bacteria 1022
394 Ga0268264_10324077 3300028381 Bacteria 1458
395 Ga0307416_100457208 3300032002 Bacteria 1331
396 Ga0307416_100520823 3300032002 Bacteria 1257
397 Ga0373948_0017896 3300034817 Unclassified 1325
398 Ga0373959_0007906 3300034820 Unclassified 1796
399 Ga0373938_0009269 3300034957 Bacteria 1779
400 Ga0373928_0001581 3300035084 Bacteria 4412
401 Ga0373929_0001870 3300035085 Bacteria 3945
402 Ga0373949_0003100 3300035090 Bacteria 4062
403 Ga0373951_0003434 3300035091 Bacteria 3843
404 Ga0373932_0000525 3300035112 Bacteria 11778
405 Ga0373936_0166770 3300035113 Bacteria 961
406 Ga0373939_0000501 3300035114 Bacteria 9845
407 Ga0373941_0004288 3300035115 Bacteria 3283
408 Ga0373945_0252364 3300035116 Bacteria 745
409 Ga0373960_0017582 3300035121 Unclassified 1854
410 Ga0373943_0189394 3300035170 Bacteria 1134
411 Ga0373943_0370058 3300035170 Unclassified 824
412 Ga0373942_0000466 3300035207 Bacteria 11451
413 Ga0373961_0003745 3300035241 Bacteria 3717
414 Ga0373962_0081388 3300035242 Unclassified 983
415 Ga0373924_0183647 3300035410 Bacteria 921
416 Ga0373931_0003729 3300035691 Bacteria 6894
417 Ga0373947_1002085 3300035725 Bacteria 570
418 Ga0373937_0097655 3300036401 Bacteria 2725
419 Ga0373937_0148815 3300036401 Bacteria 2193
420 Ga0373937_0446786 3300036401 Bacteria 1228
421 Ga0373937_0694919 3300036401 Bacteria 964
422 Ga0373925_0054589 3300037068 Bacteria 2989
423 Ga0373925_0273942 3300037068 Bacteria 1358
424 Ga0451576_0041334 3300045051 Bacteria 4875
425 Ga0451576_1548651 3300045051 Bacteria 688
426 Ga0466967_0332097 3300045976 Viruses 1468
427 Ga0495603_0708498 3300046455 Unclassified 575
428 Ga0495629_0387276 3300046459 Unclassified 951
429 Ga0495629_0766098 3300046459 Bacteria 638
430 Ga0495582_0124405 3300046473 Bacteria 1455
431 Ga0495582_0214734 3300046473 Bacteria 1100
432 Ga0495639_0137054 3300046475 Bacteria 1175
433 Ga0495608_0635285 3300046511 Unclassified 639
434 Ga0495608_0867018 3300046511 Unclassified 530
435 Ga0495628_0150415 3300046516 Unclassified 1774
436 Ga0495630_0299515 3300046517 Bacteria 1229
437 Ga0495586_0122419 3300046535 Unclassified 1454
438 Ga0495586_0430782 3300046535 Bacteria 760
439 Ga0495621_0006335 3300046539 Bacteria 3448
440 Ga0495621_0392415 3300046539 Bacteria 588
441 Ga0495645_0173210 3300046543 Bacteria 1484
442 Ga0495645_0467868 3300046543 Unclassified 793
443 Ga0495667_0252763 3300046559 Bacteria 1122
444 Ga0495634_0246987 3300046642 Unclassified 1093
445 Ga0495635_0127104 3300046663 Bacteria 1738
446 Ga0495635_0873054 3300046663 Unclassified 577
447 Ga0495659_0343958 3300046664 Unclassified 636
448 Ga0495658_0058517 3300046683 Bacteria 2205
449 Ga0495658_0146144 3300046683 Bacteria 1449
450 Ga0495658_0288245 3300046683 Bacteria 1037
451 Ga0495613_0184614 3300046689 Bacteria 1476
452 Ga0495674_0361822 3300047319 Unclassified 1176
453 Ga0495674_1308358 3300047319 Bacteria 544
454 Ga0495676_0459500 3300047321 Bacteria 839
455 Ga0495676_0653388 3300047321 Unclassified 682
456 Ga0495684_0206308 3300047471 Bacteria 1447
457 Ga0495602_0156775 3300048088 Bacteria 1782
458 Ga0496101_0731061 3300048904 Bacteria 781
459 Ga0496102_0089812 3300048905 Bacteria 2843
460 Ga0496104_0222475 3300048907 Bacteria 1800
461 Ga0496105_0169399 3300048908 Bacteria 1791
462 Ga0496105_0287183 3300048908 Bacteria 1325
463 Ga0496106_0917284 3300048909 Unclassified 691
464 Ga0496106_1090447 3300048909 Unclassified 626
465 Ga0496107_0963981 3300048910 Unclassified 620
466 Ga0496108_0145577 3300048911 Bacteria 2043
467 Ga0496109_0222547 3300048912 Bacteria 1775
468 Ga0496109_1160738 3300048912 Viruses 709
469 Ga0496112_0001427 3300048915 Bacteria 18309
470 Ga0496112_0330162 3300048915 Bacteria 1469
471 Ga0496112_0450512 3300048915 Bacteria 1225
472 Ga0496113_0774208 3300048916 Unclassified 763
473 Ga0496115_0163602 3300048918 Unclassified 1840
474 Ga0501291_013727 3300049514 Bacteria 1203
475 Ga0501034_0117939 3300049571 Bacteria 2642
476 Ga0501038_0434924 3300049574 Bacteria 1011
477 Ga0501043_0245502 3300049579 Unclassified 1380
478 Ga0501047_0006409 3300049581 Bacteria 11070
479 Ga0501067_0154852 3300049583 Bacteria 1277
480 Ga0501072_0636413 3300049588 Bacteria 840
481 Ga0501076_0362148 3300049592 Unclassified 1191
482 nmdc:mga05p37_13705_c1 3300050507 Bacteria 9718
483 nmdc:mga05p37_14201_c1 3300050507 Bacteria 9562
484 nmdc:mga05p37_169745_c1 3300050507 Bacteria 2661
485 nmdc:mga05p37_202894_c1 3300050507 Bacteria 2400
486 nmdc:mga05p37_278347_c1 3300050507 Bacteria 1996
487 nmdc:mga05p37_29257_c1 3300050507 Bacteria 6724
488 nmdc:mga05p37_3881_c1 3300050507 Bacteria 17482
489 nmdc:mga05p37_55640_c1 3300050507 Bacteria 4869
490 nmdc:mga05p37_59120_c2 3300050507 Bacteria 4295
491 nmdc:mga09592_491777_c1 3300050508 Bacteria 1056
492 nmdc:mga09592_748762_c1 3300050508 Unclassified 829
493 nmdc:mga06r32_109442_c1 3300050510 Bacteria 2717
494 nmdc:mga08y16_4182_c1 3300050511 Bacteria 15078
495 nmdc:mga08y16_4370_c1 3300050511 Bacteria 14769
496 nmdc:mga0n895_1052875_c1 3300050512 Bacteria 793
497 nmdc:mga0n895_1192171_c1 3300050512 Bacteria 736
498 nmdc:mga0n895_136699_c1 3300050512 Bacteria 2477
499 nmdc:mga0n895_1853850_c1 3300050512 Bacteria 563
500 nmdc:mga0n895_38_c1 3300050512 Bacteria 76202
501 nmdc:mga0n895_405272_c1 3300050512 Bacteria 1379
502 nmdc:mga0n895_5062_c1 3300050512 Bacteria 10947
503 nmdc:mga0n895_776827_c1 3300050512 Bacteria 950
504 nmdc:mga0n895_916833_c1 3300050512 Bacteria 861
505 nmdc:mga0n895_976214_c1 3300050512 Bacteria 829
506 nmdc:mga0rr50_112185_c1 3300050513 Bacteria 2159
507 nmdc:mga0rr50_1516464_c1 3300050513 Bacteria 566
508 nmdc:mga0rr50_190927_c1 3300050513 Bacteria 1679
509 nmdc:mga0rr50_22410_c1 3300050513 Bacteria 4335
510 nmdc:mga0rr50_2_c1 3300050513 Bacteria 373938
511 nmdc:mga0rr50_431914_c1 3300050513 Unclassified 1115
512 nmdc:mga0rr50_600073_c1 3300050513 Bacteria 939
513 nmdc:mga0rr50_60636_c1 3300050513 Bacteria 2847
514 nmdc:mga0rr50_656004_c1 3300050513 Bacteria 895
515 nmdc:mga08x19_1256896_c1 3300050514 Unclassified 525
516 nmdc:mga08x19_15691_c1 3300050514 Bacteria 4609
517 nmdc:mga08x19_239616_c1 3300050514 Bacteria 1250
518 nmdc:mga08x19_473365_c1 3300050514 Unclassified 883
519 nmdc:mga08x19_53287_c1 3300050514 Unclassified 2603
520 nmdc:mga08x19_60470_c1 3300050514 Bacteria 2454
521 nmdc:mga08x19_604_c1 3300050514 Bacteria 23235
522 nmdc:mga08x19_91364_c1 3300050514 Bacteria 2010
523 nmdc:mga08x19_96627_c1 3300050514 Unclassified 1956
524 nmdc:mga0a205_1308969_c1 3300050515 Unclassified 572
525 nmdc:mga0a205_140571_c1 3300050515 Bacteria 2314
526 nmdc:mga0a205_202745_c1 3300050515 Bacteria 1874
527 nmdc:mga0a205_398890_c1 3300050515 Bacteria 1239
528 Ga0495601_0156308 3300053077 Bacteria 1489
529 Ga0495655_0107993 3300053083 Bacteria 833
530 Ga0495595_0078458 3300053084 Bacteria 1570
531 Ga0495595_0169629 3300053084 Bacteria 1080
532 Ga0495595_0211618 3300053084 Bacteria 966
533 Ga0495619_0063407 3300053085 Bacteria 2462
534 Ga0495619_0103165 3300053085 Bacteria 1943
535 Ga0495619_0178369 3300053085 Bacteria 1470
536 Ga0501082_0711172 3300060353 Bacteria 879
537 Ga0466967_1219144
538 Ga0065712_10264177
539 Ga0065707_10209326
540 Ga0065707_10451801
541 Ga0070676_10493719
542 Ga0070690_100001578
543 Ga0070670_100160662
544 Ga0070677_10042613
545 Ga0068869_100182724
546 Ga0070666_10024899
547 Ga0070666_10030749
548 Ga0070666_10314169
549 Ga0070666_10601868
550 Ga0070682_101170799
551 Ga0068868_100103479
552 Ga0068868_100150478
553 Ga0068868_100172955
554 Ga0068868_100469071
555 Ga0070660_100139240
556 Ga0070689_100257217
557 Ga0070691_10002940
558 Ga0070668_100018144
559 Ga0070668_100162491
560 Ga0070669_100047122
561 Ga0070669_100070404
562 Ga0070669_100127569
563 Ga0070669_100244906
564 Ga0070675_100000150
565 Ga0070675_100290972
566 Ga0070675_100352010
567 Ga0070675_100977604
568 Ga0070671_100271628
569 Ga0070671_100464751
570 Ga0070671_101251151
571 Ga0070674_100395121
572 Ga0070674_100659371
573 Ga0070673_100130209
574 Ga0070673_100336966
575 Ga0070688_100020782
576 Ga0070688_100160298
577 Ga0070688_100565816
578 Ga0070659_100089347
579 Ga0070659_100340776
580 Ga0070667_101638301
581 Ga0070709_10219905
582 Ga0070714_100016209
583 Ga0070701_10053872
584 Ga0070701_10468596
585 Ga0070705_100479838
586 Ga0070700_100002889
587 Ga0070700_100179580
588 Ga0070694_100003213
589 Ga0070694_100009123
590 Ga0070694_100596163
591 Ga0070708_100017122
592 Ga0070708_100091455
593 Ga0070708_101169261
594 Ga0070678_100230191
595 Ga0070678_101430231
596 Ga0070662_100188410
597 Ga0070662_100393785
598 Ga0070662_100418104
599 Ga0070662_100520145
600 Ga0070681_10007882
601 Ga0070681_10232766
602 Ga0070681_10489259
603 Ga0068867_100012968
604 Ga0068867_100041091
605 Ga0068867_100956331
606 Ga0070685_10388705
607 Ga0070706_100311441
608 Ga0070707_100026548
609 Ga0070707_100207284
610 Ga0070698_100039805
611 Ga0070698_100126829
612 Ga0070698_100209221
613 Ga0070698_100489966
614 Ga0070698_101030695
615 Ga0070699_100045481
616 Ga0070699_100915655
617 Ga0070699_101046619
618 Ga0070699_101728343
619 Ga0070679_100090928
620 Ga0070697_100005325
621 Ga0070697_100225903
622 Ga0070697_100436207
623 Ga0070697_101527037
624 Ga0070672_100127035
625 Ga0070672_100611771
626 Ga0070686_100058282
627 Ga0070686_100138008
628 Ga0070686_100154266
629 Ga0070686_100191465
630 Ga0070686_100721588
631 Ga0070695_100004153
632 Ga0070695_100045214
633 Ga0070696_100052507
634 Ga0070696_100070494
635 Ga0070696_100328403
636 Ga0070665_100094477
637 Ga0070665_100239328
638 Ga0070704_100014705
639 Ga0070704_100169761
640 Ga0070704_100193583
641 Ga0070704_100223896
642 Ga0070704_101414662
643 Ga0068855_100298927
644 Ga0070664_100439450
645 Ga0068857_100104554
646 Ga0068854_100015173
647 Ga0068854_100020249
648 Ga0068854_100087961
649 Ga0068852_101140728
650 Ga0068859_100044622
651 Ga0068859_100066515
652 Ga0068859_100907044
653 Ga0068859_101998498
654 Ga0068864_100054097
655 Ga0068864_100057697
656 Ga0068864_100088920
657 Ga0068864_101249403
658 Ga0068866_10089166
659 Ga0068866_10163619
660 Ga0068861_100004082
661 Ga0068861_100301238
662 Ga0068861_100930053
663 Ga0068851_10537248
664 Ga0068870_10393348
665 Ga0068863_100098859
666 Ga0068858_100060727
667 Ga0068858_100074374
668 Ga0068858_100135908
669 Ga0068858_100526790
670 Ga0068860_100266369
671 Ga0068860_100426777
672 Ga0068860_100515727
673 Ga0068860_100869890
674 Ga0068862_100138930
675 Ga0068862_100171000
676 Ga0068862_100397625
677 Ga0068862_100592241
678 Ga0081539_10021678
679 Ga0081539_10123614
680 Ga0075432_10011323
681 Ga0075432_10169810
682 Ga0070715_10291676
683 Ga0070716_100695902
684 Ga0097621_100034315
685 Ga0097621_100056477
686 Ga0097621_100138331
687 Ga0068871_100010147
688 Ga0068871_100015645
689 Ga0068871_100016541
690 Ga0068871_101842845
691 Ga0075433_10139437
692 Ga0075433_10175723
693 Ga0075433_10250425
694 Ga0075434_100000761
695 Ga0075434_100265620
696 Ga0075434_100314676
697 Ga0075434_100319777
698 Ga0075434_100571418
699 Ga0075434_100648391
700 Ga0075434_101014246
701 Ga0075434_101172345
702 Ga0075434_101329522
703 Ga0075429_100356087
704 Ga0068865_100021711
705 Ga0068865_100073642
706 Ga0068865_100260593
707 Ga0068865_100326412
708 Ga0068865_101069704
709 Ga0075436_100001518
710 Ga0075436_100010088
711 Ga0075436_100029483
712 Ga0075436_100284563
713 Ga0075436_100469455
714 Ga0075436_100505604
715 Ga0075436_100591795
716 Ga0097620_100044622
717 Ga0097620_100066514
718 Ga0097620_100907087
719 Ga0075435_100000057
720 Ga0075435_100001476
721 Ga0075435_100063518
722 Ga0075435_100105553
723 Ga0075435_100129717
724 Ga0075435_100200736
725 Ga0075435_100211871
726 Ga0075435_100669640
727 Ga0075435_101175832
728 Ga0105251_10173918
729 Ga0105240_10015853
730 Ga0105240_10109366
731 Ga0105240_10826428
732 Ga0111539_10005814
733 Ga0111539_10006524
734 Ga0111539_10247892
735 Ga0111539_12062042
736 Ga0105245_10026818
737 Ga0105245_10036900
738 Ga0105245_10256823
739 Ga0105245_10306042
740 Ga0105245_10591753
741 Ga0105245_11644451
742 Ga0105247_10005554
743 Ga0105247_10634028
744 Ga0114129_10013691
745 Ga0114129_10024677
746 Ga0114129_10031900
747 Ga0114129_10037031
748 Ga0114129_10100235
749 Ga0114129_10157032
750 Ga0114129_10245651
751 Ga0114129_11862065
752 Ga0114129_12250556
753 Ga0105243_10025628
754 Ga0105243_10473516
755 Ga0105243_10686686
756 Ga0105243_11407271
757 Ga0105241_10031950
758 Ga0105242_10007835
759 Ga0105242_10031915
760 Ga0105242_10079191
761 Ga0105242_10195183
762 Ga0105242_10306866
763 Ga0105242_11257384
764 Ga0105248_10009442
765 Ga0105248_10037669
766 Ga0105248_10268911
767 Ga0105248_10316872
768 Ga0105248_10322349
769 Ga0105248_10381782
770 Ga0105248_10383868
771 Ga0105248_10598530
772 Ga0105237_10464479
773 Ga0105237_10600502
774 Ga0105238_11284284
775 Ga0105238_11724481
776 Ga0105249_10073318
777 Ga0105249_10182755
778 Ga0105249_10645235
779 Ga0105249_11381694
780 Ga0105239_10417917
781 Ga0105239_11739606
782 Ga0105246_10205299
783 Ga0105246_10284623
784 Ga0105246_10327298
785 Ga0105246_10720424
786 Ga0157374_10020117
787 Ga0157378_10751354
788 Ga0157378_11006716
789 Ga0163162_10198546
790 Ga0163162_10369237
791 Ga0163162_10594715
792 Ga0163162_11213595
793 Ga0157375_10367178
794 Ga0163163_10005014
795 Ga0163163_10130352
796 Ga0163163_10842025
797 Ga0157380_10055593
798 Ga0157380_10305101
799 Ga0157380_11098973
800 Ga0157380_11835914
801 Ga0157380_12254236
802 Ga0157377_10013879
803 Ga0157379_10022768
804 Ga0157379_10072655
805 Ga0157379_10155720
806 Ga0157379_10832700
807 Ga0157376_10008125
808 Ga0157376_10078643
809 Ga0157376_10213950
810 Ga0207697_10195486
811 Ga0207713_1137918
812 Ga0207682_10018272
813 Ga0207642_10083114
814 Ga0207642_10404051
815 Ga0207642_10441951
816 Ga0207710_10011786
817 Ga0207680_10063304
818 Ga0207680_10226596
819 Ga0207645_10006373
820 Ga0207645_10126624
821 Ga0207684_10178300
822 Ga0207654_10222886
823 Ga0207707_10420382
824 Ga0207707_10435365
825 Ga0207660_10506522
826 Ga0207662_10026028
827 Ga0207662_10265171
828 Ga0207662_10397635
829 Ga0207657_10114206
830 Ga0207652_10110373
831 Ga0207652_10497863
832 Ga0207646_10064230
833 Ga0207646_10164362
834 Ga0207646_10524782
835 Ga0207681_10010827
836 Ga0207681_10806891
837 Ga0207650_10163731
838 Ga0207650_11015730
839 Ga0207659_10000529
840 Ga0207659_10187242
841 Ga0207659_10354870
842 Ga0207687_10077246
843 Ga0207687_10326337
844 Ga0207687_10369386
845 Ga0207687_10714711
846 Ga0207664_10044699
847 Ga0207644_10041408
848 Ga0207644_10815589
849 Ga0207690_10162787
850 Ga0207690_10506586
851 Ga0207706_10050851
852 Ga0207706_10586260
853 Ga0207686_10012981
854 Ga0207686_10126485
855 Ga0207686_10161872
856 Ga0207686_10183606
857 Ga0207709_10005722
858 Ga0207709_10010343
859 Ga0207709_10077822
860 Ga0207670_10079424
861 Ga0207670_10346719
862 Ga0207669_10006050
863 Ga0207704_10137066
864 Ga0207704_10191167
865 Ga0207704_10210917
866 Ga0207704_10248295
867 Ga0207691_10127069
868 Ga0207691_10652459
869 Ga0207691_10675434
870 Ga0207711_10057059
871 Ga0207711_10103585
872 Ga0207711_10273299
873 Ga0207711_10450428
874 Ga0207711_10520485
875 Ga0207689_10051530
876 Ga0207689_10375400
877 Ga0207689_10772867
878 Ga0207667_10269246
879 Ga0207651_10019901
880 Ga0207651_10157112
881 Ga0207651_10420102
882 Ga0207712_10928670
883 Ga0207668_10112799
884 Ga0207640_10041821
885 Ga0207640_10053021
886 Ga0207640_10177912
887 Ga0207640_10406309
888 Ga0207640_11810187
889 Ga0207677_10008794
890 Ga0207677_10037131
891 Ga0207677_10425213
892 Ga0207703_10070300
893 Ga0207703_10077783
894 Ga0207703_10297403
895 Ga0207708_10006622
896 Ga0207708_10032358
897 Ga0207708_10362240
898 Ga0207708_10744239
899 Ga0207708_10920612
900 Ga0207641_10201572
901 Ga0207641_10368098
902 Ga0207648_10020640
903 Ga0207648_10027686
904 Ga0207648_10059141
905 Ga0207648_10175255
906 Ga0207676_10033531
907 Ga0207676_10034294
908 Ga0207676_10053267
909 Ga0207676_10098963
910 Ga0207676_10395237
911 Ga0207674_10055760
912 Ga0207675_100004793
913 Ga0207675_100007166
914 Ga0207675_100035206
915 Ga0207675_100554609
916 Ga0207675_100587606
917 Ga0207683_10255295
918 Ga0207683_11284654
919 Ga0207683_11288979
920 Ga0207683_11512635
921 Ga0209998_10022230
922 Ga0207428_10019113
923 Ga0268266_10304175
924 Ga0268266_10420425
925 Ga0268266_10445622
926 Ga0268265_10011853
927 Ga0268265_10089401
928 Ga0268265_10228609
929 Ga0268265_10637911
930 Ga0268264_10324077
931 Ga0307416_100457208
932 Ga0307416_100520823
933 Ga0373948_0017896
934 Ga0373959_0007906
935 Ga0373938_0009269
936 Ga0373928_0001581
937 Ga0373929_0001870
938 Ga0373949_0003100
939 Ga0373951_0003434
940 Ga0373932_0000525
941 Ga0373936_0166770
942 Ga0373939_0000501
943 Ga0373941_0004288
944 Ga0373945_0252364
945 Ga0373960_0017582
946 Ga0373943_0189394
947 Ga0373943_0370058
948 Ga0373942_0000466
949 Ga0373961_0003745
950 Ga0373962_0081388
951 Ga0373924_0183647
952 Ga0373931_0003729
953 Ga0373947_1002085
954 Ga0373937_0097655
955 Ga0373937_0148815
956 Ga0373937_0446786
957 Ga0373937_0694919
958 Ga0373925_0054589
959 Ga0373925_0273942
960 Ga0451576_0041334
961 Ga0451576_1548651
962 Ga0466967_0332097
963 Ga0495603_0708498
964 Ga0495629_0387276
965 Ga0495629_0766098
966 Ga0495582_0124405
967 Ga0495582_0214734
968 Ga0495639_0137054
969 Ga0495608_0635285
970 Ga0495608_0867018
971 Ga0495628_0150415
972 Ga0495630_0299515
973 Ga0495586_0122419
974 Ga0495586_0430782
975 Ga0495621_0006335
976 Ga0495621_0392415
977 Ga0495645_0173210
978 Ga0495645_0467868
979 Ga0495667_0252763
980 Ga0495634_0246987
981 Ga0495635_0127104
982 Ga0495635_0873054
983 Ga0495659_0343958
984 Ga0495658_0058517
985 Ga0495658_0146144
986 Ga0495658_0288245
987 Ga0495613_0184614
988 Ga0495674_0361822
989 Ga0495674_1308358
990 Ga0495676_0459500
991 Ga0495676_0653388
992 Ga0495684_0206308
993 Ga0495602_0156775
994 Ga0496101_0731061
995 Ga0496102_0089812
996 Ga0496104_0222475
997 Ga0496105_0169399
998 Ga0496105_0287183
999 Ga0496106_0917284
1000 Ga0496106_1090447
1001 Ga0496107_0963981
1002 Ga0496108_0145577
1003 Ga0496109_0222547
1004 Ga0496109_1160738
1005 Ga0496112_0001427
1006 Ga0496112_0330162
1007 Ga0496112_0450512
1008 Ga0496113_0774208
1009 Ga0496115_0163602
1010 Ga0501291_013727
1011 Ga0501034_0117939
1012 Ga0501038_0434924
1013 Ga0501043_0245502
1014 Ga0501047_0006409
1015 Ga0501067_0154852
1016 Ga0501072_0636413
1017 Ga0501076_0362148
1018 nmdc:mga05p37_13705_c1
1019 nmdc:mga05p37_14201_c1
1020 nmdc:mga05p37_169745_c1
1021 nmdc:mga05p37_202894_c1
1022 nmdc:mga05p37_278347_c1
1023 nmdc:mga05p37_29257_c1
1024 nmdc:mga05p37_3881_c1
1025 nmdc:mga05p37_55640_c1
1026 nmdc:mga05p37_59120_c2
1027 nmdc:mga09592_491777_c1
1028 nmdc:mga09592_748762_c1
1029 nmdc:mga06r32_109442_c1
1030 nmdc:mga08y16_4182_c1
1031 nmdc:mga08y16_4370_c1
1032 nmdc:mga0n895_1052875_c1
1033 nmdc:mga0n895_1192171_c1
1034 nmdc:mga0n895_136699_c1
1035 nmdc:mga0n895_1853850_c1
1036 nmdc:mga0n895_38_c1
1037 nmdc:mga0n895_405272_c1
1038 nmdc:mga0n895_5062_c1
1039 nmdc:mga0n895_776827_c1
1040 nmdc:mga0n895_916833_c1
1041 nmdc:mga0n895_976214_c1
1042 nmdc:mga0rr50_112185_c1
1043 nmdc:mga0rr50_1516464_c1
1044 nmdc:mga0rr50_190927_c1
1045 nmdc:mga0rr50_22410_c1
1046 nmdc:mga0rr50_2_c1
1047 nmdc:mga0rr50_431914_c1
1048 nmdc:mga0rr50_600073_c1
1049 nmdc:mga0rr50_60636_c1
1050 nmdc:mga0rr50_656004_c1
1051 nmdc:mga08x19_1256896_c1
1052 nmdc:mga08x19_15691_c1
1053 nmdc:mga08x19_239616_c1
1054 nmdc:mga08x19_473365_c1
1055 nmdc:mga08x19_53287_c1
1056 nmdc:mga08x19_60470_c1
1057 nmdc:mga08x19_604_c1
1058 nmdc:mga08x19_91364_c1
1059 nmdc:mga08x19_96627_c1
1060 nmdc:mga0a205_1308969_c1
1061 nmdc:mga0a205_140571_c1
1062 nmdc:mga0a205_202745_c1
1063 nmdc:mga0a205_398890_c1
1064 Ga0495601_0156308
1065 Ga0495655_0107993
1066 Ga0495595_0078458
1067 Ga0495595_0169629
1068 Ga0495595_0211618
1069 Ga0495619_0063407
1070 Ga0495619_0103165
1071 Ga0495619_0178369
1072 Ga0501082_0711172

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04073

tRNA_edit

Aminoacyl-tRNA editing domain

56

182

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vxb-assembly1.cif.gz_A crystal structure of caulobacter crescentus proxp-ala at 1.69 angstrom 0.9303 5 162
1vki-assembly1.cif.gz_A crystal structure of a putative oligo-nucleotide binding protein (atu3699, agr_l_2275) from agrobacterium tumefaciens str. c58 at 1.60 a resolution 0.9288 5 163
1vki-assembly1.cif.gz_A crystal structure of a putative oligo-nucleotide binding protein (atu3699, agr_l_2275) from agrobacterium tumefaciens str. c58 at 1.60 a resolution 0.9018 5 163
5vxb-assembly1.cif.gz_A crystal structure of caulobacter crescentus proxp-ala at 1.69 angstrom 0.8923 5 162
1dbu-assembly1.cif.gz_A crystal structure of cysteinyl-trna(pro) deacylase protein from h. influenzae (hi1434) 0.8548 8 163
ID Description Score Start End Superfamily
af_Q6PFS2_19_184_3.90.960.10 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9596 2 162 3.90.960.10
af_A0A0G2L4U2_9_155_3.90.960.10 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9534 23 162 3.90.960.10
af_A0A144A0G8_12_181_3.90.960.10 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9518 4 163 3.90.960.10
af_Q6PFS2_19_184_3.90.960.10 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9425 2 162 3.90.960.10
1vkiA00 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9288 5 163 3.90.960.10
ID Description Score Start End GO Terms
AF-A0A2V8FKZ0-F1-model_v4 YbaK/aminoacyl-tRNA synthetase-associated domain-containing protein 0.9941 2 163 GO:0002161
AF-A0A1F7GBB4-F1-model_v4 YbaK/aminoacyl-tRNA synthetase-associated domain-containing protein 0.9845 48 151 GO:0002161
AF-A0A7X9DLI1-F1-model_v4 Prolyl-tRNA synthetase associated domain-containing protein 0.9836 42 160 GO:0002161
GO:0004812
AF-A0A645H9P4-F1-model_v4 Prolyl-tRNA editing protein ProX 0.9824 45 163 GO:0002161
AF-A0A2V8FKZ0-F1-model_v4 YbaK/aminoacyl-tRNA synthetase-associated domain-containing protein 0.982 2 163 GO:0002161

Map