F460658

General Info

Members Datasets Scaffolds Average Seq Length
535 229 1071 183

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10005283|Ga0157370_1000528311
Length 162
Sequence MTQIQNDQELLELFKDPSTKEQAFTSIIKKYQEKLYWHIRRMVISHEDADDVLQNMFIKVWKGLENFREDSQLYTWLYRIATNESLTLLAQEKKRSSISLSDWKLQLGIQSLPEKQRLVFNLRYYDEMPYEEMSRVLETSEGALKASYHHAAKKIENFILNN

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
16 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
96 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
97 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
98 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
101 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
103 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
156 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
157 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
158 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
159 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
160 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
161 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
171 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
172 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
173 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
174 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
175 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
176 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
179 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
180 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
181 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
182 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
183 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
184 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
185 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
186 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
187 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
194 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
203 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
207 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
208 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
211 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
212 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
213 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
214 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
215 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
216 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
217 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
218 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
219 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
220 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
221 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
222 2818991444 Filimonas endophytica 3197 Isolate Unclassified
223 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
224 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
225 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
226 2914759650 Rhizosphaericola mali Isolate Rhizosphere
227 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
228 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
229 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.32
Metatranscriptomes 0.19
Isolates 1.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.66
Nodule 0
Rhizoplane 1.31
Rhizosphere 85.42
Stem 0
Stem Tuber 0
Unclassified 10.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10005283 3300013104 Bacteria 14508
2 JGI24740J21852_10000784 3300001979 Bacteria 13950
3 JGI24739J22299_10002055 3300001989 Bacteria 7703
4 JGI25154J39366_1000002 3300002738 Bacteria 466942
5 JGI25157J39369_1002970 3300002741 Bacteria 3736
6 JGI25153J46596_10000187 3300003215 Bacteria 60030
7 JGI25153J46596_10006691 3300003215 Bacteria 5794
8 rootH2_10030772 3300003320 Bacteria 7763
9 rootH2_10071962 3300003320 Bacteria 2890
10 rootH2_10232718 3300003320 Bacteria 1467
11 rootL2_10323490 3300003322 Unclassified 2350
12 rootH1_10001269 3300003316 Bacteria 3482
13 rootH1_10001269 3300003323 Bacteria 14822
14 rootH1_10058159 3300003323 Bacteria 3113
15 rootH1_10091425 3300003323 Bacteria 17802
16 rootH1_10208903 3300003323 Bacteria 2006
17 JGI25160J50197_1007367 3300003354 Bacteria 4315
18 JGI25160J50197_1013543 3300003354 Bacteria 2774
19 Ga0055526_1011768 3300003771 Bacteria 3893
20 Ga0055528_1000422 3300003790 Bacteria 34012
21 Ga0055530_10000475 3300003791 Bacteria 34908
22 Ga0055531_10029861 3300003794 Bacteria 1846
23 Ga0055543_1010306 3300004625 Bacteria 1964
24 Ga0058862_11957623 3300004803 Bacteria 844
25 Ga0065165_1000258 3300005262 Bacteria 91861
26 Ga0065165_1025910 3300005262 Bacteria 1939
27 Ga0070658_10031857 3300005327 Bacteria 4236
28 Ga0070658_10048460 3300005327 Bacteria 3441
29 Ga0070658_10084648 3300005327 Bacteria 2607
30 Ga0070658_10288570 3300005327 Bacteria 1398
31 Ga0070658_10523310 3300005327 Bacteria 1025
32 Ga0070676_10018718 3300005328 Bacteria 3842
33 Ga0070676_10026193 3300005328 Bacteria 3301
34 Ga0070683_100196025 3300005329 Bacteria 1918
35 Ga0070683_100841110 3300005329 Bacteria 880
36 Ga0070690_100214988 3300005330 Unclassified 1344
37 Ga0070690_100226380 3300005330 Bacteria 1313
38 Ga0070690_100691246 3300005330 Bacteria 783
39 Ga0070670_100014229 3300005331 Bacteria 6825
40 Ga0070670_100905421 3300005331 Bacteria 800
41 Ga0068869_100072495 3300005334 Bacteria 2552
42 Ga0068869_100088639 3300005334 Unclassified 2323
43 Ga0068869_100673745 3300005334 Unclassified 880
44 Ga0068869_100845295 3300005334 Bacteria 789
45 Ga0070666_10128867 3300005335 Bacteria 1757
46 Ga0070666_10259263 3300005335 Unclassified 1232
47 Ga0070680_100005161 3300005336 Bacteria 9875
48 Ga0070680_100028538 3300005336 Bacteria 4477
49 Ga0070680_100078650 3300005336 Bacteria 2718
50 Ga0070680_100193377 3300005336 Bacteria 1715
51 Ga0070680_100406179 3300005336 Bacteria 1161
52 Ga0070680_100472157 3300005336 Bacteria 1072
53 Ga0070682_100000423 3300005337 Bacteria 27350
54 Ga0070682_100028788 3300005337 Bacteria 3343
55 Ga0068868_100148567 3300005338 Bacteria 1928
56 Ga0068868_100369426 3300005338 Bacteria 1232
57 Ga0068868_100380656 3300005338 Bacteria 1214
58 Ga0068868_100804995 3300005338 Bacteria 848
59 Ga0070660_100007790 3300005339 Bacteria 7469
60 Ga0070660_100036161 3300005339 Bacteria 3740
61 Ga0070660_100290647 3300005339 Bacteria 1338
62 Ga0070660_100595678 3300005339 Unclassified 924
63 Ga0070660_100636856 3300005339 Bacteria 892
64 Ga0070689_100134319 3300005340 Bacteria 1986
65 Ga0070689_100828185 3300005340 Bacteria 815
66 Ga0070687_100025218 3300005343 Bacteria 2850
67 Ga0070668_100511153 3300005347 Bacteria 1041
68 Ga0070675_100076250 3300005354 Bacteria 2789
69 Ga0070675_100260282 3300005354 Bacteria 1520
70 Ga0070671_100005943 3300005355 Bacteria 9725
71 Ga0070671_100116126 3300005355 Bacteria 2250
72 Ga0070671_100124041 3300005355 Unclassified 2174
73 Ga0070674_100038404 3300005356 Bacteria 3227
74 Ga0070674_100146091 3300005356 Bacteria 1780
75 Ga0070659_100056606 3300005366 Bacteria 3091
76 Ga0070659_100367631 3300005366 Bacteria 1209
77 Ga0070659_100390699 3300005366 Unclassified 1173
78 Ga0070667_100256903 3300005367 Unclassified 1563
79 Ga0070667_100305544 3300005367 Bacteria 1433
80 Ga0070711_101026360 3300005439 Bacteria 708
81 Ga0070700_100030687 3300005441 Bacteria 3215
82 Ga0070663_100078734 3300005455 Bacteria 2417
83 Ga0070663_100465345 3300005455 Bacteria 1044
84 Ga0070678_100158163 3300005456 Bacteria 1833
85 Ga0070678_100162904 3300005456 Bacteria 1809
86 Ga0070678_100164663 3300005456 Bacteria 1800
87 Ga0070678_100824278 3300005456 Bacteria 844
88 Ga0070681_10025891 3300005458 Bacteria 5897
89 Ga0070681_10103599 3300005458 Bacteria 2789
90 Ga0070681_10131581 3300005458 Bacteria 2434
91 Ga0070681_10275077 3300005458 Bacteria 1595
92 Ga0070681_10734874 3300005458 Bacteria 903
93 Ga0068867_100005852 3300005459 Bacteria 8721
94 Ga0068867_100056403 3300005459 Bacteria 2906
95 Ga0068867_100086193 3300005459 Bacteria 2375
96 Ga0068867_100107453 3300005459 Bacteria 2139
97 Ga0068867_100365290 3300005459 Bacteria 1208
98 Ga0068867_100790425 3300005459 Bacteria 845
99 Ga0070685_10878305 3300005466 Bacteria 666
100 Ga0070679_100010626 3300005530 Bacteria 8736
101 Ga0070679_100052004 3300005530 Bacteria 4081
102 Ga0070684_100390222 3300005535 Bacteria 1283
103 Ga0070684_100689702 3300005535 Bacteria 952
104 Ga0068853_100003003 3300005539 Bacteria 12871
105 Ga0068853_100006957 3300005539 Bacteria 9035
106 Ga0068853_100014006 3300005539 Bacteria 6562
107 Ga0068853_100331211 3300005539 Bacteria 1413
108 Ga0068853_101050458 3300005539 Bacteria 785
109 Ga0070672_100055896 3300005543 Bacteria 3093
110 Ga0070672_100739764 3300005543 Unclassified 863
111 Ga0070686_100154766 3300005544 Bacteria 1609
112 Ga0070693_100493867 3300005547 Unclassified 867
113 Ga0070665_100000018 3300005548 Bacteria 434118
114 Ga0068855_100041291 3300005563 Bacteria 5468
115 Ga0068855_100052756 3300005563 Bacteria 4786
116 Ga0068855_100118470 3300005563 Bacteria 3032
117 Ga0068855_100125804 3300005563 Bacteria 2931
118 Ga0068855_100247498 3300005563 Bacteria 1989
119 Ga0068855_101171713 3300005563 Bacteria 800
120 Ga0070664_100012816 3300005564 Bacteria 6820
121 Ga0070664_100419663 3300005564 Bacteria 1225
122 Ga0070664_100796264 3300005564 Bacteria 884
123 Ga0068857_100000270 3300005577 Bacteria 35248
124 Ga0068857_100278866 3300005577 Bacteria 1537
125 Ga0068857_100480822 3300005577 Unclassified 1164
126 Ga0068857_100940045 3300005577 Bacteria 830
127 Ga0068854_100151034 3300005578 Bacteria 1791
128 Ga0068854_100217224 3300005578 Bacteria 1511
129 Ga0068856_100025338 3300005614 Bacteria 5783
130 Ga0068856_100077260 3300005614 Bacteria 3299
131 Ga0068852_100000506 3300005616 Bacteria 25661
132 Ga0068852_100014035 3300005616 Bacteria 6148
133 Ga0068852_100139516 3300005616 Bacteria 2242
134 Ga0068852_100160188 3300005616 Bacteria 2101
135 Ga0068852_100220175 3300005616 Bacteria 1805
136 Ga0068859_100001123 3300005617 Bacteria 27361
137 Ga0068859_100079657 3300005617 Bacteria 3316
138 Ga0068859_100335071 3300005617 Bacteria 1607
139 Ga0068864_100129907 3300005618 Bacteria 2262
140 Ga0068864_100153012 3300005618 Bacteria 2091
141 Ga0068864_100249600 3300005618 Bacteria 1647
142 Ga0068864_100517235 3300005618 Unclassified 1150
143 Ga0068851_10019441 3300005834 Bacteria 3282
144 Ga0068851_10253870 3300005834 Unclassified 998
145 Ga0068870_10167291 3300005840 Unclassified 1309
146 Ga0068870_10694346 3300005840 Bacteria 701
147 Ga0068863_100051369 3300005841 Bacteria 3908
148 Ga0068863_101607009 3300005841 Bacteria 659
149 Ga0068858_100306707 3300005842 Bacteria 1515
150 Ga0068858_100630189 3300005842 Bacteria 1041
151 Ga0068860_100000328 3300005843 Bacteria 64568
152 Ga0068860_100009543 3300005843 Bacteria 9640
153 Ga0068860_100154414 3300005843 Bacteria 2212
154 Ga0068860_100167570 3300005843 Bacteria 2121
155 Ga0068860_100220905 3300005843 Bacteria 1840
156 Ga0068860_100309448 3300005843 Bacteria 1549
157 Ga0068860_100393469 3300005843 Bacteria 1370
158 Ga0068860_101451595 3300005843 Unclassified 707
159 Ga0068862_100013391 3300005844 Bacteria 6786
160 Ga0075366_10004918 3300006195 Bacteria 7207
161 Ga0097621_100008194 3300006237 Bacteria 7517
162 Ga0097621_100015056 3300006237 Bacteria 5808
163 Ga0097621_100050582 3300006237 Bacteria 3380
164 Ga0097621_100065340 3300006237 Bacteria 2994
165 Ga0075370_10152369 3300006353 Bacteria 1355
166 Ga0068871_100002710 3300006358 Bacteria 12089
167 Ga0068871_100004087 3300006358 Bacteria 10089
168 Ga0068871_100120793 3300006358 Bacteria 2213
169 Ga0068871_100207791 3300006358 Bacteria 1692
170 Ga0068865_100385881 3300006881 Bacteria 1144
171 Ga0068865_100422498 3300006881 Bacteria 1096
172 Ga0068865_100946858 3300006881 Bacteria 751
173 Ga0068865_101158294 3300006881 Unclassified 683
174 Ga0097620_100001123 3300006931 Bacteria 27361
175 Ga0097620_100079658 3300006931 Bacteria 3316
176 Ga0097620_100335072 3300006931 Bacteria 1607
177 Ga0105240_10015052 3300009093 Bacteria 10529
178 Ga0105240_10053011 3300009093 Bacteria 5095
179 Ga0105240_10677433 3300009093 Bacteria 1128
180 Ga0111539_10204040 3300009094 Bacteria 2305
181 Ga0111539_11023507 3300009094 Unclassified 960
182 Ga0105247_10652594 3300009101 Bacteria 786
183 Ga0105241_10024925 3300009174 Bacteria 4444
184 Ga0105241_10130842 3300009174 Bacteria 2031
185 Ga0105242_10597163 3300009176 Bacteria 1066
186 Ga0105248_10325863 3300009177 Bacteria 1730
187 Ga0105248_10636840 3300009177 Unclassified 1203
188 Ga0105237_10008880 3300009545 Bacteria 10831
189 Ga0105237_10038557 3300009545 Bacteria 4826
190 Ga0105238_10287303 3300009551 Bacteria 1627
191 Ga0105249_10046490 3300009553 Bacteria 3950
192 Ga0105249_10188743 3300009553 Unclassified 2010
193 Ga0105249_10990921 3300009553 Bacteria 909
194 Ga0105249_11107102 3300009553 Bacteria 862
195 Ga0105239_10005439 3300010375 Bacteria 14944
196 Ga0105239_10012212 3300010375 Bacteria 9575
197 Ga0105239_10309766 3300010375 Bacteria 1779
198 Ga0105239_10506148 3300010375 Bacteria 1373
199 Ga0105239_10589442 3300010375 Unclassified 1268
200 Ga0105239_11376463 3300010375 Bacteria 814
201 Ga0157373_10000579 3300013100 Bacteria 28434
202 Ga0157373_10004356 3300013100 Bacteria 10664
203 Ga0157373_10015035 3300013100 Bacteria 5661
204 Ga0157373_10030352 3300013100 Unclassified 3889
205 Ga0157373_10040115 3300013100 Bacteria 3350
206 Ga0157373_10133644 3300013100 Bacteria 1744
207 Ga0157371_10000218 3300013102 Bacteria 83919
208 Ga0157371_10001572 3300013102 Bacteria 23457
209 Ga0157371_10002476 3300013102 Bacteria 17566
210 Ga0157371_10006484 3300013102 Bacteria 9647
211 Ga0157371_10021618 3300013102 Bacteria 4721
212 Ga0157371_10028552 3300013102 Bacteria 4039
213 Ga0157371_10030821 3300013102 Bacteria 3866
214 Ga0157371_10046291 3300013102 Bacteria 3094
215 Ga0157371_10094999 3300013102 Bacteria 2113
216 Ga0157371_10142797 3300013102 Bacteria 1705
217 Ga0157371_10547485 3300013102 Bacteria 858
218 Ga0157370_10001029 3300013104 Bacteria 35080
219 Ga0157370_10002445 3300013104 Bacteria 22405
220 Ga0157370_10394621 3300013104 Bacteria 1274
221 Ga0157370_10497949 3300013104 Bacteria 1119
222 Ga0157370_11144056 3300013104 Bacteria 703
223 Ga0157369_10011041 3300013105 Bacteria 10276
224 Ga0157369_10279132 3300013105 Bacteria 1740
225 Ga0157369_10312107 3300013105 Bacteria 1635
226 Ga0157369_10621398 3300013105 Bacteria 1115
227 Ga0157369_10882638 3300013105 Unclassified 917
228 Ga0157369_11348906 3300013105 Bacteria 726
229 Ga0157374_10022980 3300013296 Bacteria 5569
230 Ga0157374_10109685 3300013296 Bacteria 2653
231 Ga0157378_10007124 3300013297 Bacteria 9767
232 Ga0157378_10027625 3300013297 Bacteria 5005
233 Ga0157378_10040568 3300013297 Bacteria 4128
234 Ga0157378_10048153 3300013297 Bacteria 3790
235 Ga0157378_10158088 3300013297 Bacteria 2117
236 Ga0157378_10841354 3300013297 Bacteria 945
237 Ga0157378_11019793 3300013297 Bacteria 862
238 Ga0163162_10001057 3300013306 Bacteria 25608
239 Ga0163162_10008947 3300013306 Bacteria 9734
240 Ga0163162_10023314 3300013306 Bacteria 6109
241 Ga0163162_10193894 3300013306 Bacteria 2160
242 Ga0163162_10372883 3300013306 Bacteria 1560
243 Ga0163162_10378557 3300013306 Unclassified 1549
244 Ga0163162_10402852 3300013306 Unclassified 1501
245 Ga0163162_10647726 3300013306 Unclassified 1180
246 Ga0157372_10000656 3300013307 Bacteria 37971
247 Ga0157372_10005977 3300013307 Bacteria 12934
248 Ga0157372_10019771 3300013307 Bacteria 7258
249 Ga0157372_10020650 3300013307 Bacteria 7108
250 Ga0157372_10028787 3300013307 Bacteria 6063
251 Ga0157372_10035488 3300013307 Bacteria 5490
252 Ga0157372_10036951 3300013307 Bacteria 5385
253 Ga0157372_10040361 3300013307 Bacteria 5155
254 Ga0157372_10040921 3300013307 Bacteria 5122
255 Ga0157372_10061606 3300013307 Bacteria 4202
256 Ga0157372_10061671 3300013307 Bacteria 4200
257 Ga0157372_10062675 3300013307 Bacteria 4167
258 Ga0157372_10151365 3300013307 Bacteria 2678
259 Ga0157372_10229110 3300013307 Bacteria 2154
260 Ga0157372_10261038 3300013307 Bacteria 2011
261 Ga0157375_10000445 3300013308 Bacteria 37477
262 Ga0157375_10038364 3300013308 Bacteria 4600
263 Ga0157375_10046690 3300013308 Bacteria 4225
264 Ga0157375_10459553 3300013308 Bacteria 1439
265 Ga0157375_10508629 3300013308 Bacteria 1368
266 Ga0157375_12193115 3300013308 Bacteria 658
267 Ga0157375_12715501 3300013308 Unclassified 592
268 Ga0163163_10000421 3300014325 Bacteria 39252
269 Ga0157380_10039070 3300014326 Bacteria 3689
270 Ga0157377_10111023 3300014745 Unclassified 1648
271 Ga0157379_10160656 3300014968 Unclassified 2028
272 Ga0157379_10467893 3300014968 Bacteria 1166
273 Ga0157376_10003150 3300014969 Bacteria 11327
274 Ga0157376_10025841 3300014969 Bacteria 4630
275 Ga0157376_10169950 3300014969 Bacteria 1984
276 Ga0163161_10012391 3300017792 Bacteria 5919
277 Ga0163161_10037515 3300017792 Bacteria 3474
278 Ga0163161_10561325 3300017792 Bacteria 937
279 Ga0213876_10020175 3300021384 Bacteria 3522
280 Ga0213876_10106149 3300021384 Bacteria 1490
281 Ga0209646_1000005 3300025246 Bacteria 717627
282 Ga0209026_1000169 3300025250 Bacteria 100088
283 Ga0209673_1000049 3300025273 Bacteria 286207
284 Ga0209564_1011681 3300025295 Bacteria 3908
285 Ga0209758_1000346 3300025297 Bacteria 84821
286 Ga0209758_1009924 3300025297 Bacteria 5805
287 Ga0209050_1000272 3300025298 Bacteria 110636
288 Ga0207426_1000052 3300025302 Bacteria 389825
289 Ga0207426_1000381 3300025302 Bacteria 76038
290 Ga0207426_1001311 3300025302 Bacteria 21230
291 Ga0209051_1033844 3300025303 Bacteria 1925
292 Ga0209257_1001525 3300025304 Bacteria 27049
293 Ga0207688_10105727 3300025901 Unclassified 1629
294 Ga0207647_10041661 3300025904 Bacteria 2885
295 Ga0207647_10047934 3300025904 Bacteria 2655
296 Ga0207647_10299588 3300025904 Bacteria 916
297 Ga0207647_10524794 3300025904 Bacteria 659
298 Ga0207645_10011457 3300025907 Bacteria 6051
299 Ga0207645_10036615 3300025907 Bacteria 3151
300 Ga0207643_10048041 3300025908 Bacteria 2417
301 Ga0207705_10008088 3300025909 Bacteria 7707
302 Ga0207705_10026019 3300025909 Bacteria 4175
303 Ga0207705_10077030 3300025909 Unclassified 2425
304 Ga0207705_10110980 3300025909 Bacteria 2026
305 Ga0207654_10278269 3300025911 Bacteria 1131
306 Ga0207707_10139652 3300025912 Bacteria 2118
307 Ga0207707_10816411 3300025912 Bacteria 776
308 Ga0207695_10033500 3300025913 Bacteria 5601
309 Ga0207695_10038103 3300025913 Bacteria 5181
310 Ga0207695_10278648 3300025913 Bacteria 1566
311 Ga0207671_10020118 3300025914 Bacteria 5089
312 Ga0207671_10117395 3300025914 Bacteria 2031
313 Ga0207663_10692569 3300025916 Bacteria 806
314 Ga0207660_10006315 3300025917 Bacteria 7683
315 Ga0207660_10023368 3300025917 Bacteria 4174
316 Ga0207660_10094230 3300025917 Bacteria 2225
317 Ga0207660_10719497 3300025917 Unclassified 814
318 Ga0207662_10009843 3300025918 Bacteria 5275
319 Ga0207657_10019195 3300025919 Bacteria 6500
320 Ga0207657_10142687 3300025919 Bacteria 1956
321 Ga0207657_10326798 3300025919 Bacteria 1212
322 Ga0207657_10620788 3300025919 Unclassified 843
323 Ga0207652_10000203 3300025921 Bacteria 62871
324 Ga0207652_10000978 3300025921 Bacteria 26478
325 Ga0207652_10052662 3300025921 Bacteria 3494
326 Ga0207652_10090315 3300025921 Bacteria 2691
327 Ga0207681_10230721 3300025923 Bacteria 1437
328 Ga0207694_10142194 3300025924 Bacteria 1930
329 Ga0207650_10091058 3300025925 Unclassified 2330
330 Ga0207650_10514804 3300025925 Bacteria 1001
331 Ga0207659_10056675 3300025926 Bacteria 2807
332 Ga0207659_10836973 3300025926 Bacteria 791
333 Ga0207659_11336945 3300025926 Bacteria 615
334 Ga0207644_10056999 3300025931 Bacteria 2820
335 Ga0207644_10348547 3300025931 Bacteria 1202
336 Ga0207644_10533089 3300025931 Bacteria 971
337 Ga0207690_10035458 3300025932 Bacteria 3222
338 Ga0207690_10055604 3300025932 Bacteria 2666
339 Ga0207706_10042540 3300025933 Bacteria 4026
340 Ga0207686_10097043 3300025934 Bacteria 1960
341 Ga0207686_10733690 3300025934 Bacteria 788
342 Ga0207669_10120512 3300025937 Bacteria 1780
343 Ga0207669_10732104 3300025937 Unclassified 815
344 Ga0207704_10082543 3300025938 Bacteria 2083
345 Ga0207704_10590084 3300025938 Bacteria 908
346 Ga0207691_10072458 3300025940 Bacteria 3107
347 Ga0207691_10217821 3300025940 Bacteria 1656
348 Ga0207711_10414114 3300025941 Bacteria 1253
349 Ga0207689_10029169 3300025942 Bacteria 4610
350 Ga0207689_10115110 3300025942 Bacteria 2210
351 Ga0207661_10191154 3300025944 Bacteria 1795
352 Ga0207661_10206908 3300025944 Bacteria 1728
353 Ga0207679_10007296 3300025945 Bacteria 7006
354 Ga0207667_10001760 3300025949 Bacteria 27253
355 Ga0207667_10073464 3300025949 Bacteria 3553
356 Ga0207667_10074755 3300025949 Bacteria 3519
357 Ga0207667_10203910 3300025949 Bacteria 2028
358 Ga0207667_10294408 3300025949 Bacteria 1658
359 Ga0207667_10415036 3300025949 Bacteria 1370
360 Ga0207667_11427789 3300025949 Bacteria 665
361 Ga0207651_10268995 3300025960 Unclassified 1403
362 Ga0207712_10165095 3300025961 Unclassified 1725
363 Ga0207712_10187782 3300025961 Bacteria 1629
364 Ga0207712_11066588 3300025961 Bacteria 718
365 Ga0207668_10360317 3300025972 Bacteria 1218
366 Ga0207668_10391705 3300025972 Bacteria 1172
367 Ga0207640_10084433 3300025981 Bacteria 2180
368 Ga0207640_10486036 3300025981 Bacteria 1025
369 Ga0207658_10014167 3300025986 Bacteria 5461
370 Ga0207658_10875248 3300025986 Bacteria 817
371 Ga0207658_10936601 3300025986 Unclassified 789
372 Ga0207658_10958657 3300025986 Bacteria 780
373 Ga0207677_10259407 3300026023 Bacteria 1416
374 Ga0207677_10264746 3300026023 Bacteria 1403
375 Ga0207677_11055705 3300026023 Unclassified 739
376 Ga0207639_10002997 3300026041 Bacteria 11363
377 Ga0207639_10031054 3300026041 Bacteria 3924
378 Ga0207639_10333478 3300026041 Bacteria 1350
379 Ga0207678_10038042 3300026067 Bacteria 4183
380 Ga0207678_10201789 3300026067 Bacteria 1701
381 Ga0207678_10411107 3300026067 Bacteria 1172
382 Ga0207708_10131162 3300026075 Bacteria 1959
383 Ga0207702_10115865 3300026078 Bacteria 2390
384 Ga0207702_10944320 3300026078 Bacteria 855
385 Ga0207641_10023042 3300026088 Bacteria 5130
386 Ga0207641_10230573 3300026088 Unclassified 1721
387 Ga0207648_10050091 3300026089 Bacteria 3652
388 Ga0207648_10062951 3300026089 Bacteria 3234
389 Ga0207648_10063552 3300026089 Bacteria 3217
390 Ga0207648_10074083 3300026089 Bacteria 2967
391 Ga0207648_10097201 3300026089 Bacteria 2577
392 Ga0207648_10189725 3300026089 Bacteria 1821
393 Ga0207648_10204456 3300026089 Bacteria 1752
394 Ga0207648_10243104 3300026089 Unclassified 1603
395 Ga0207648_10273400 3300026089 Unclassified 1510
396 Ga0207676_10116335 3300026095 Bacteria 2247
397 Ga0207676_10164836 3300026095 Bacteria 1924
398 Ga0207676_10282045 3300026095 Bacteria 1509
399 Ga0207676_10468142 3300026095 Unclassified 1191
400 Ga0207674_10002382 3300026116 Bacteria 23767
401 Ga0207674_10031134 3300026116 Bacteria 5606
402 Ga0207674_10066171 3300026116 Bacteria 3641
403 Ga0207674_10624204 3300026116 Bacteria 1041
404 Ga0207675_100200918 3300026118 Bacteria 1914
405 Ga0207675_101118389 3300026118 Bacteria 808
406 Ga0207683_10086212 3300026121 Bacteria 2792
407 Ga0207683_10133846 3300026121 Bacteria 2231
408 Ga0207683_10171646 3300026121 Bacteria 1964
409 Ga0207683_10201172 3300026121 Bacteria 1811
410 Ga0207683_10370219 3300026121 Unclassified 1316
411 Ga0207683_10767738 3300026121 Bacteria 894
412 Ga0207698_10000340 3300026142 Bacteria 27673
413 Ga0207698_10071681 3300026142 Bacteria 2750
414 Ga0207698_10158249 3300026142 Bacteria 1977
415 Ga0207698_10409306 3300026142 Bacteria 1298
416 Ga0268266_10000026 3300028379 Bacteria 434485
417 Ga0268266_10593923 3300028379 Bacteria 1063
418 Ga0268265_10068051 3300028380 Unclassified 2759
419 Ga0268265_10640288 3300028380 Bacteria 1021
420 Ga0268264_10075138 3300028381 Bacteria 2872
421 Ga0268264_10197975 3300028381 Bacteria 1836
422 Ga0268264_10240433 3300028381 Bacteria 1677
423 Ga0268264_10435031 3300028381 Bacteria 1268
424 Ga0268264_10839794 3300028381 Unclassified 919
425 Ga0307517_10216218 3300028786 Bacteria 1172
426 Ga0307515_10000001 3300028794 Bacteria 4259510
427 Ga0265338_10113236 3300028800 Bacteria 2180
428 Ga0265332_10182638 3300031238 Bacteria 874
429 Ga0265327_10000013 3300031251 Bacteria 519549
430 Ga0265327_10014059 3300031251 Bacteria 5266
431 Ga0265327_10122299 3300031251 Bacteria 1232
432 Ga0307508_10000606 3300031616 Bacteria 42966
433 Ga0307508_10354871 3300031616 Bacteria 1058
434 Ga0307507_10383720 3300033179 Bacteria 808
435 Ga0373937_0343758 3300036401 Bacteria 1413
436 Ga0395899_0001902 3300037312 Bacteria 17216
437 Ga0395899_0017970 3300037312 Bacteria 5381
438 Ga0395899_0056912 3300037312 Bacteria 2888
439 Ga0395899_0173188 3300037312 Unclassified 1518
440 Ga0395899_0512437 3300037312 Bacteria 776
441 Ga0395900_0003487 3300037418 Bacteria 16977
442 Ga0395900_0020578 3300037418 Bacteria 6738
443 Ga0395900_0034470 3300037418 Bacteria 5212
444 Ga0395900_0085241 3300037418 Bacteria 3246
445 Ga0395900_0127324 3300037418 Bacteria 2611
446 Ga0395900_0135699 3300037418 Bacteria 2521
447 Ga0395900_0186800 3300037418 Unclassified 2103
448 Ga0395898_0003804 3300037466 Bacteria 16709
449 Ga0395898_0025289 3300037466 Bacteria 5984
450 Ga0395898_0044708 3300037466 Bacteria 4356
451 Ga0395898_0096090 3300037466 Bacteria 2846
452 Ga0395898_0561757 3300037466 Bacteria 1083
453 Ga0395905_0009841 3300037471 Bacteria 9319
454 Ga0395905_0221943 3300037471 Bacteria 1769
455 Ga0395901_0004581 3300038443 Bacteria 13959
456 Ga0395901_0016821 3300038443 Bacteria 7453
457 Ga0395901_0017188 3300038443 Bacteria 7379
458 Ga0400483_082871 3300039062 Bacteria 1866
459 Ga0436365_0951333 3300039437 Bacteria 12859
460 Ga0436365_1214692 3300039437 Bacteria 1928
461 Ga0436365_1684945 3300039437 Bacteria 47686
462 Ga0436363_1318320 3300039450 Bacteria 721
463 Ga0451800_0812781 3300041459 Unclassified 753
464 Ga0451807_1673129 3300041486 Unclassified 936
465 Ga0451577_0098384 3300042876 Bacteria 2613
466 Ga0451577_0110301 3300042876 Unclassified 2461
467 Ga0453683_0173463 3300044673 Bacteria 1366
468 Ga0466965_0120246 3300044683 Bacteria 1356
469 Ga0453684_0017490 3300044712 Bacteria 11102
470 Ga0453684_0028161 3300044712 Bacteria 8029
471 Ga0466957_0584444 3300044842 Bacteria 781
472 Ga0495638_0065466 3300046460 Bacteria 2237
473 Ga0495596_0168761 3300046500 Bacteria 850
474 Ga0495648_0001596 3300046524 Bacteria 22083
475 Ga0495667_0433348 3300046559 Unclassified 827
476 Ga0495668_0000099 3300046616 Bacteria 137915
477 Ga0495668_0000595 3300046616 Bacteria 43979
478 Ga0495625_0026123 3300046660 Bacteria 4416
479 Ga0495625_0151324 3300046660 Bacteria 1560
480 Ga0495649_0127949 3300046694 Bacteria 1341
481 Ga0495649_0191116 3300046694 Bacteria 1066
482 Ga0495672_0153027 3300047320 Bacteria 1194
483 Ga0495687_000058 3300047443 Bacteria 185830
484 Ga0495686_0199333 3300047472 Bacteria 1150
485 Ga0495686_0263079 3300047472 Bacteria 965
486 Ga0496101_0030341 3300048904 Bacteria 3790
487 Ga0496102_0336388 3300048905 Bacteria 1422
488 Ga0496104_0053736 3300048907 Bacteria 3807
489 Ga0496109_0597464 3300048912 Unclassified 1040
490 Ga0496110_0605494 3300048913 Unclassified 994
491 Ga0496124_0123386 3300048927 Bacteria 2067
492 Ga0501033_0065945 3300049570 Bacteria 2663
493 Ga0501034_0000004 3300049571 Bacteria 382255
494 Ga0501034_0041675 3300049571 Bacteria 4646
495 Ga0501034_0186220 3300049571 Bacteria 2039
496 Ga0501036_0449907 3300049572 Bacteria 1073
497 Ga0501037_0186753 3300049573 Bacteria 1469
498 Ga0501038_0770169 3300049574 Bacteria 717
499 Ga0501043_0032856 3300049579 Bacteria 4081
500 Ga0501046_0571884 3300049580 Bacteria 804
501 Ga0501047_0046277 3300049581 Bacteria 4205
502 Ga0501216_050089 3300049660 Bacteria 819
503 Ga0501219_000177 3300049703 Bacteria 11733
504 Ga0501080_0341616 3300049742 Bacteria 1353
505 Ga0501035_0832333 3300049822 Bacteria 735
506 Ga0501044_0042676 3300049823 Bacteria 4716
507 Ga0501044_0341691 3300049823 Bacteria 1418
508 Ga0501044_0362697 3300049823 Unclassified 1367
509 Ga0501284_00051 3300050005 Bacteria 43498
510 nmdc:mga07m45_246718_c1 3300050496 Bacteria 1039
511 nmdc:mga07m45_450805_c1 3300050496 Bacteria 746
512 nmdc:mga08y16_153432_c1 3300050511 Bacteria 2394
513 Ga0500578_0247619 3300053086 Bacteria 1075
514 Ga0500643_123522 3300053087 Bacteria 697
515 Ga0500644_0012690 3300053088 Bacteria 2336
516 Ga0500583_0001695 3300053092 Bacteria 6435
517 Ga0500562_000027 3300053108 Bacteria 100118
518 Ga0500642_0208940 3300053130 Bacteria 906
519 Ga0500568_0004392 3300053139 Bacteria 7547
520 Ga0500568_0010956 3300053139 Bacteria 4226
521 Ga0500588_0022030 3300053146 Bacteria 1729
522 Ga0500616_0001739 3300053153 Bacteria 19962
523 Ga0500616_0077715 3300053153 Bacteria 1675
524 Ga0500622_0000931 3300053156 Bacteria 24896
525 Ga0500622_0001238 3300053156 Bacteria 20912
526 Ga0500622_0235543 3300053156 Bacteria 812
527 Ga0500627_0067920 3300053158 Bacteria 1575
528 Ga0500661_020809 3300055283 Unclassified 1166
529 2819586231 2818991444 Bacteria 6968812
530 2881957154 2881955468 Bacteria 3545609
531 2896087049 2896085136 Bacteria 6129793
532 2896114334 2896109856 Bacteria 7140722
533 2914760015 2914759650 Bacteria 4701441
534 2929158858 2929154850 Bacteria 6753285
535 2929921241 2929921140 Bacteria 8649150
536 8003152531 8003151029 Bacteria 8187759
537 Ga0157370_10005283
538 JGI24740J21852_10000784
539 JGI24739J22299_10002055
540 JGI25154J39366_1000002
541 JGI25157J39369_1002970
542 JGI25153J46596_10000187
543 JGI25153J46596_10006691
544 rootH2_10030772
545 rootH2_10071962
546 rootH2_10232718
547 rootL2_10323490
548 rootH1_10001269
549 rootH1_10058159
550 rootH1_10091425
551 rootH1_10208903
552 JGI25160J50197_1007367
553 JGI25160J50197_1013543
554 Ga0055526_1011768
555 Ga0055528_1000422
556 Ga0055530_10000475
557 Ga0055531_10029861
558 Ga0055543_1010306
559 Ga0058862_11957623
560 Ga0065165_1000258
561 Ga0065165_1025910
562 Ga0070658_10031857
563 Ga0070658_10048460
564 Ga0070658_10084648
565 Ga0070658_10288570
566 Ga0070658_10523310
567 Ga0070676_10018718
568 Ga0070676_10026193
569 Ga0070683_100196025
570 Ga0070683_100841110
571 Ga0070690_100214988
572 Ga0070690_100226380
573 Ga0070690_100691246
574 Ga0070670_100014229
575 Ga0070670_100905421
576 Ga0068869_100072495
577 Ga0068869_100088639
578 Ga0068869_100673745
579 Ga0068869_100845295
580 Ga0070666_10128867
581 Ga0070666_10259263
582 Ga0070680_100005161
583 Ga0070680_100028538
584 Ga0070680_100078650
585 Ga0070680_100193377
586 Ga0070680_100406179
587 Ga0070680_100472157
588 Ga0070682_100000423
589 Ga0070682_100028788
590 Ga0068868_100148567
591 Ga0068868_100369426
592 Ga0068868_100380656
593 Ga0068868_100804995
594 Ga0070660_100007790
595 Ga0070660_100036161
596 Ga0070660_100290647
597 Ga0070660_100595678
598 Ga0070660_100636856
599 Ga0070689_100134319
600 Ga0070689_100828185
601 Ga0070687_100025218
602 Ga0070668_100511153
603 Ga0070675_100076250
604 Ga0070675_100260282
605 Ga0070671_100005943
606 Ga0070671_100116126
607 Ga0070671_100124041
608 Ga0070674_100038404
609 Ga0070674_100146091
610 Ga0070659_100056606
611 Ga0070659_100367631
612 Ga0070659_100390699
613 Ga0070667_100256903
614 Ga0070667_100305544
615 Ga0070711_101026360
616 Ga0070700_100030687
617 Ga0070663_100078734
618 Ga0070663_100465345
619 Ga0070678_100158163
620 Ga0070678_100162904
621 Ga0070678_100164663
622 Ga0070678_100824278
623 Ga0070681_10025891
624 Ga0070681_10103599
625 Ga0070681_10131581
626 Ga0070681_10275077
627 Ga0070681_10734874
628 Ga0068867_100005852
629 Ga0068867_100056403
630 Ga0068867_100086193
631 Ga0068867_100107453
632 Ga0068867_100365290
633 Ga0068867_100790425
634 Ga0070685_10878305
635 Ga0070679_100010626
636 Ga0070679_100052004
637 Ga0070684_100390222
638 Ga0070684_100689702
639 Ga0068853_100003003
640 Ga0068853_100006957
641 Ga0068853_100014006
642 Ga0068853_100331211
643 Ga0068853_101050458
644 Ga0070672_100055896
645 Ga0070672_100739764
646 Ga0070686_100154766
647 Ga0070693_100493867
648 Ga0070665_100000018
649 Ga0068855_100041291
650 Ga0068855_100052756
651 Ga0068855_100118470
652 Ga0068855_100125804
653 Ga0068855_100247498
654 Ga0068855_101171713
655 Ga0070664_100012816
656 Ga0070664_100419663
657 Ga0070664_100796264
658 Ga0068857_100000270
659 Ga0068857_100278866
660 Ga0068857_100480822
661 Ga0068857_100940045
662 Ga0068854_100151034
663 Ga0068854_100217224
664 Ga0068856_100025338
665 Ga0068856_100077260
666 Ga0068852_100000506
667 Ga0068852_100014035
668 Ga0068852_100139516
669 Ga0068852_100160188
670 Ga0068852_100220175
671 Ga0068859_100001123
672 Ga0068859_100079657
673 Ga0068859_100335071
674 Ga0068864_100129907
675 Ga0068864_100153012
676 Ga0068864_100249600
677 Ga0068864_100517235
678 Ga0068851_10019441
679 Ga0068851_10253870
680 Ga0068870_10167291
681 Ga0068870_10694346
682 Ga0068863_100051369
683 Ga0068863_101607009
684 Ga0068858_100306707
685 Ga0068858_100630189
686 Ga0068860_100000328
687 Ga0068860_100009543
688 Ga0068860_100154414
689 Ga0068860_100167570
690 Ga0068860_100220905
691 Ga0068860_100309448
692 Ga0068860_100393469
693 Ga0068860_101451595
694 Ga0068862_100013391
695 Ga0075366_10004918
696 Ga0097621_100008194
697 Ga0097621_100015056
698 Ga0097621_100050582
699 Ga0097621_100065340
700 Ga0075370_10152369
701 Ga0068871_100002710
702 Ga0068871_100004087
703 Ga0068871_100120793
704 Ga0068871_100207791
705 Ga0068865_100385881
706 Ga0068865_100422498
707 Ga0068865_100946858
708 Ga0068865_101158294
709 Ga0097620_100001123
710 Ga0097620_100079658
711 Ga0097620_100335072
712 Ga0105240_10015052
713 Ga0105240_10053011
714 Ga0105240_10677433
715 Ga0111539_10204040
716 Ga0111539_11023507
717 Ga0105247_10652594
718 Ga0105241_10024925
719 Ga0105241_10130842
720 Ga0105242_10597163
721 Ga0105248_10325863
722 Ga0105248_10636840
723 Ga0105237_10008880
724 Ga0105237_10038557
725 Ga0105238_10287303
726 Ga0105249_10046490
727 Ga0105249_10188743
728 Ga0105249_10990921
729 Ga0105249_11107102
730 Ga0105239_10005439
731 Ga0105239_10012212
732 Ga0105239_10309766
733 Ga0105239_10506148
734 Ga0105239_10589442
735 Ga0105239_11376463
736 Ga0157373_10000579
737 Ga0157373_10004356
738 Ga0157373_10015035
739 Ga0157373_10030352
740 Ga0157373_10040115
741 Ga0157373_10133644
742 Ga0157371_10000218
743 Ga0157371_10001572
744 Ga0157371_10002476
745 Ga0157371_10006484
746 Ga0157371_10021618
747 Ga0157371_10028552
748 Ga0157371_10030821
749 Ga0157371_10046291
750 Ga0157371_10094999
751 Ga0157371_10142797
752 Ga0157371_10547485
753 Ga0157370_10001029
754 Ga0157370_10002445
755 Ga0157370_10394621
756 Ga0157370_10497949
757 Ga0157370_11144056
758 Ga0157369_10011041
759 Ga0157369_10279132
760 Ga0157369_10312107
761 Ga0157369_10621398
762 Ga0157369_10882638
763 Ga0157369_11348906
764 Ga0157374_10022980
765 Ga0157374_10109685
766 Ga0157378_10007124
767 Ga0157378_10027625
768 Ga0157378_10040568
769 Ga0157378_10048153
770 Ga0157378_10158088
771 Ga0157378_10841354
772 Ga0157378_11019793
773 Ga0163162_10001057
774 Ga0163162_10008947
775 Ga0163162_10023314
776 Ga0163162_10193894
777 Ga0163162_10372883
778 Ga0163162_10378557
779 Ga0163162_10402852
780 Ga0163162_10647726
781 Ga0157372_10000656
782 Ga0157372_10005977
783 Ga0157372_10019771
784 Ga0157372_10020650
785 Ga0157372_10028787
786 Ga0157372_10035488
787 Ga0157372_10036951
788 Ga0157372_10040361
789 Ga0157372_10040921
790 Ga0157372_10061606
791 Ga0157372_10061671
792 Ga0157372_10062675
793 Ga0157372_10151365
794 Ga0157372_10229110
795 Ga0157372_10261038
796 Ga0157375_10000445
797 Ga0157375_10038364
798 Ga0157375_10046690
799 Ga0157375_10459553
800 Ga0157375_10508629
801 Ga0157375_12193115
802 Ga0157375_12715501
803 Ga0163163_10000421
804 Ga0157380_10039070
805 Ga0157377_10111023
806 Ga0157379_10160656
807 Ga0157379_10467893
808 Ga0157376_10003150
809 Ga0157376_10025841
810 Ga0157376_10169950
811 Ga0163161_10012391
812 Ga0163161_10037515
813 Ga0163161_10561325
814 Ga0213876_10020175
815 Ga0213876_10106149
816 Ga0209646_1000005
817 Ga0209026_1000169
818 Ga0209673_1000049
819 Ga0209564_1011681
820 Ga0209758_1000346
821 Ga0209758_1009924
822 Ga0209050_1000272
823 Ga0207426_1000052
824 Ga0207426_1000381
825 Ga0207426_1001311
826 Ga0209051_1033844
827 Ga0209257_1001525
828 Ga0207688_10105727
829 Ga0207647_10041661
830 Ga0207647_10047934
831 Ga0207647_10299588
832 Ga0207647_10524794
833 Ga0207645_10011457
834 Ga0207645_10036615
835 Ga0207643_10048041
836 Ga0207705_10008088
837 Ga0207705_10026019
838 Ga0207705_10077030
839 Ga0207705_10110980
840 Ga0207654_10278269
841 Ga0207707_10139652
842 Ga0207707_10816411
843 Ga0207695_10033500
844 Ga0207695_10038103
845 Ga0207695_10278648
846 Ga0207671_10020118
847 Ga0207671_10117395
848 Ga0207663_10692569
849 Ga0207660_10006315
850 Ga0207660_10023368
851 Ga0207660_10094230
852 Ga0207660_10719497
853 Ga0207662_10009843
854 Ga0207657_10019195
855 Ga0207657_10142687
856 Ga0207657_10326798
857 Ga0207657_10620788
858 Ga0207652_10000203
859 Ga0207652_10000978
860 Ga0207652_10052662
861 Ga0207652_10090315
862 Ga0207681_10230721
863 Ga0207694_10142194
864 Ga0207650_10091058
865 Ga0207650_10514804
866 Ga0207659_10056675
867 Ga0207659_10836973
868 Ga0207659_11336945
869 Ga0207644_10056999
870 Ga0207644_10348547
871 Ga0207644_10533089
872 Ga0207690_10035458
873 Ga0207690_10055604
874 Ga0207706_10042540
875 Ga0207686_10097043
876 Ga0207686_10733690
877 Ga0207669_10120512
878 Ga0207669_10732104
879 Ga0207704_10082543
880 Ga0207704_10590084
881 Ga0207691_10072458
882 Ga0207691_10217821
883 Ga0207711_10414114
884 Ga0207689_10029169
885 Ga0207689_10115110
886 Ga0207661_10191154
887 Ga0207661_10206908
888 Ga0207679_10007296
889 Ga0207667_10001760
890 Ga0207667_10073464
891 Ga0207667_10074755
892 Ga0207667_10203910
893 Ga0207667_10294408
894 Ga0207667_10415036
895 Ga0207667_11427789
896 Ga0207651_10268995
897 Ga0207712_10165095
898 Ga0207712_10187782
899 Ga0207712_11066588
900 Ga0207668_10360317
901 Ga0207668_10391705
902 Ga0207640_10084433
903 Ga0207640_10486036
904 Ga0207658_10014167
905 Ga0207658_10875248
906 Ga0207658_10936601
907 Ga0207658_10958657
908 Ga0207677_10259407
909 Ga0207677_10264746
910 Ga0207677_11055705
911 Ga0207639_10002997
912 Ga0207639_10031054
913 Ga0207639_10333478
914 Ga0207678_10038042
915 Ga0207678_10201789
916 Ga0207678_10411107
917 Ga0207708_10131162
918 Ga0207702_10115865
919 Ga0207702_10944320
920 Ga0207641_10023042
921 Ga0207641_10230573
922 Ga0207648_10050091
923 Ga0207648_10062951
924 Ga0207648_10063552
925 Ga0207648_10074083
926 Ga0207648_10097201
927 Ga0207648_10189725
928 Ga0207648_10204456
929 Ga0207648_10243104
930 Ga0207648_10273400
931 Ga0207676_10116335
932 Ga0207676_10164836
933 Ga0207676_10282045
934 Ga0207676_10468142
935 Ga0207674_10002382
936 Ga0207674_10031134
937 Ga0207674_10066171
938 Ga0207674_10624204
939 Ga0207675_100200918
940 Ga0207675_101118389
941 Ga0207683_10086212
942 Ga0207683_10133846
943 Ga0207683_10171646
944 Ga0207683_10201172
945 Ga0207683_10370219
946 Ga0207683_10767738
947 Ga0207698_10000340
948 Ga0207698_10071681
949 Ga0207698_10158249
950 Ga0207698_10409306
951 Ga0268266_10000026
952 Ga0268266_10593923
953 Ga0268265_10068051
954 Ga0268265_10640288
955 Ga0268264_10075138
956 Ga0268264_10197975
957 Ga0268264_10240433
958 Ga0268264_10435031
959 Ga0268264_10839794
960 Ga0307517_10216218
961 Ga0307515_10000001
962 Ga0265338_10113236
963 Ga0265332_10182638
964 Ga0265327_10000013
965 Ga0265327_10014059
966 Ga0265327_10122299
967 Ga0307508_10000606
968 Ga0307508_10354871
969 Ga0307507_10383720
970 Ga0373937_0343758
971 Ga0395899_0001902
972 Ga0395899_0017970
973 Ga0395899_0056912
974 Ga0395899_0173188
975 Ga0395899_0512437
976 Ga0395900_0003487
977 Ga0395900_0020578
978 Ga0395900_0034470
979 Ga0395900_0085241
980 Ga0395900_0127324
981 Ga0395900_0135699
982 Ga0395900_0186800
983 Ga0395898_0003804
984 Ga0395898_0025289
985 Ga0395898_0044708
986 Ga0395898_0096090
987 Ga0395898_0561757
988 Ga0395905_0009841
989 Ga0395905_0221943
990 Ga0395901_0004581
991 Ga0395901_0016821
992 Ga0395901_0017188
993 Ga0400483_082871
994 Ga0436365_0951333
995 Ga0436365_1214692
996 Ga0436365_1684945
997 Ga0436363_1318320
998 Ga0451800_0812781
999 Ga0451807_1673129
1000 Ga0451577_0098384
1001 Ga0451577_0110301
1002 Ga0453683_0173463
1003 Ga0466965_0120246
1004 Ga0453684_0017490
1005 Ga0453684_0028161
1006 Ga0466957_0584444
1007 Ga0495638_0065466
1008 Ga0495596_0168761
1009 Ga0495648_0001596
1010 Ga0495667_0433348
1011 Ga0495668_0000099
1012 Ga0495668_0000595
1013 Ga0495625_0026123
1014 Ga0495625_0151324
1015 Ga0495649_0127949
1016 Ga0495649_0191116
1017 Ga0495672_0153027
1018 Ga0495687_000058
1019 Ga0495686_0199333
1020 Ga0495686_0263079
1021 Ga0496101_0030341
1022 Ga0496102_0336388
1023 Ga0496104_0053736
1024 Ga0496109_0597464
1025 Ga0496110_0605494
1026 Ga0496124_0123386
1027 Ga0501033_0065945
1028 Ga0501034_0000004
1029 Ga0501034_0041675
1030 Ga0501034_0186220
1031 Ga0501036_0449907
1032 Ga0501037_0186753
1033 Ga0501038_0770169
1034 Ga0501043_0032856
1035 Ga0501046_0571884
1036 Ga0501047_0046277
1037 Ga0501216_050089
1038 Ga0501219_000177
1039 Ga0501080_0341616
1040 Ga0501035_0832333
1041 Ga0501044_0042676
1042 Ga0501044_0341691
1043 Ga0501044_0362697
1044 Ga0501284_00051
1045 nmdc:mga07m45_246718_c1
1046 nmdc:mga07m45_450805_c1
1047 nmdc:mga08y16_153432_c1
1048 Ga0500578_0247619
1049 Ga0500643_123522
1050 Ga0500644_0012690
1051 Ga0500583_0001695
1052 Ga0500562_000027
1053 Ga0500642_0208940
1054 Ga0500568_0004392
1055 Ga0500568_0010956
1056 Ga0500588_0022030
1057 Ga0500616_0001739
1058 Ga0500616_0077715
1059 Ga0500622_0000931
1060 Ga0500622_0001238
1061 Ga0500622_0235543
1062 Ga0500627_0067920
1063 Ga0500661_020809
1064 2819586231
1065 2881957154
1066 2896087049
1067 2896114334
1068 2914760015
1069 2929158858
1070 2929921241
1071 8003152531

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04542

Sigma70_r2

Sigma-70 region 2

27

95

0.95

PF04545

Sigma70_r4

Sigma-70, region 4

108

157

0.94

PF08281

Sigma70_r4_2

Sigma-70, region 4

103

155

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hnp-assembly1.cif.gz_B archaeal transcription factor mutant 0.9515 133 178
2h27-assembly2.cif.gz_D crystal structure of escherichia coli sigmae region 4 bound to its-35 element dna 0.9474 120 182
6jhe-assembly1.cif.gz_A crystal structure of bacillus subtilis sigw domain 4 in complexed with -35 element dna 0.9452 132 178
2o8x-assembly1.cif.gz_B "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.9431 118 176
3hug-assembly6.cif.gz_M crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.9416 123 182
ID Description Score Start End Superfamily
1or7A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9673 117 181 1.10.10.10
2o8xC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9643 125 176 1.10.10.10
1or7B02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9606 117 182 1.10.10.10
af_P0AGB6_121_191_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9549 120 182 1.10.10.10
3hugG00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9487 123 182 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A327R7U7-F1-model_v4 RNA polymerase sigma factor 0.5871 1 182 GO:0003677
GO:0006352
GO:0016987
AF-A0A249SX72-F1-model_v4 RNA polymerase sigma-70 factor 0.578 8 183 GO:0003677
GO:0006352
GO:0016987
AF-A0A327R7U7-F1-model_v4 RNA polymerase sigma factor 0.5755 1 182 GO:0003677
GO:0006352
GO:0016987
AF-A0A6N8KTT0-F1-model_v4 RNA polymerase sigma factor 0.5702 9 183 GO:0003677
GO:0006352
GO:0016987
AF-A0A2E0R0D5-F1-model_v4 RNA polymerase sigma factor 70 region 4 type 2 domain-containing protein 0.57 1 182 GO:0003677
GO:0006352
GO:0016987

Map