F460540

General Info

Members Datasets Scaffolds Average Seq Length
534 311 1068 251

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10453056|Ga0157372_104530562
Length 295
Sequence MASAWQACRADRHWPASGGDRNSGGIAAVVIARDPPGGAAGRIRLGVAVFGAVRTVRATVRSLRIYYGNRARAAAMDRLYGEFIRPGDLVFDVGAHVGDRIASFRRLDARVVAVEPQHAMAGVLRLLYGFSRSVAIEEVAVGREPGRSRMMINADNPTVSSFSSAFVNAARDAPGWETQRWTGSAEVAVTTLDALMVRHGRPAFIKLDVEGFEAEALLGMSQAVPALSFEFTTIQRDVALACIERCSVLGYTRFNAALGESQMLVGGWVTAGDITRWLMQLPQSANSGDVYAVAG

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
151 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
152 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
153 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
154 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
157 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
158 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
163 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
164 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
165 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
166 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
167 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
168 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
169 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
170 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
174 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
175 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
181 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
184 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
185 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
186 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
187 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
188 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
189 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
190 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
191 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
192 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
193 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
194 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
195 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
196 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
197 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
198 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
199 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
200 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
201 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
202 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
203 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
204 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
205 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
206 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
207 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
208 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
209 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
210 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
211 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
212 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
213 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
214 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
215 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
216 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
217 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
218 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
219 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
220 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
221 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
222 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
223 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
224 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
225 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
226 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
227 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
228 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
229 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
230 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
231 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
232 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
233 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
234 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
235 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
236 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
237 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
238 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
239 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
240 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
241 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
242 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
243 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
244 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
245 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
246 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
247 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
248 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
249 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
250 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
251 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
252 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
253 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
254 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
255 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
256 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
257 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
258 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
259 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
260 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
261 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
262 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
263 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
264 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
265 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
266 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
267 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
268 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
271 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
272 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
273 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
274 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
275 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
276 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
277 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
278 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
279 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
280 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
281 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
282 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
283 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
284 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
285 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
286 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
287 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
288 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
289 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
290 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
291 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
292 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
293 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
294 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
295 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
296 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
297 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
298 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
299 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
300 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
301 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
302 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
303 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
304 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
305 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
306 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
307 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
308 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
309 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
310 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
311 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.74
Nodule 0
Rhizoplane 6.18
Rhizosphere 85.77
Stem 0
Stem Tuber 0
Unclassified 7.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10453056 3300013307 Bacteria 1495
2 JGI24738J21930_10000339 3300002075 Bacteria 12791
3 Ga0070683_100070542 3300005329 Bacteria 3259
4 Ga0070690_100555576 3300005330 Bacteria 866
5 Ga0068869_100052528 3300005334 Bacteria 2959
6 Ga0070680_100003636 3300005336 Bacteria 11519
7 Ga0070680_100076851 3300005336 Bacteria 2749
8 Ga0070680_100090104 3300005336 Bacteria 2538
9 Ga0070680_100719816 3300005336 Bacteria 859
10 Ga0070682_100051692 3300005337 Bacteria 2569
11 Ga0070682_100286138 3300005337 Bacteria 1204
12 Ga0068868_100324176 3300005338 Bacteria 1313
13 Ga0070691_10045146 3300005341 Unclassified 2091
14 Ga0070661_100363479 3300005344 Bacteria 1138
15 Ga0070668_100023103 3300005347 Bacteria 4700
16 Ga0070669_100284842 3300005353 Bacteria 1325
17 Ga0070675_100194383 3300005354 Bacteria 1759
18 Ga0070671_100187740 3300005355 Unclassified 1751
19 Ga0070674_100035415 3300005356 Bacteria 3343
20 Ga0070674_100067908 3300005356 Bacteria 2509
21 Ga0070673_100443920 3300005364 Bacteria 1166
22 Ga0070673_100661674 3300005364 Bacteria 957
23 Ga0070688_100190327 3300005365 Bacteria 1429
24 Ga0070703_10000756 3300005406 Bacteria 10744
25 Ga0070709_10027521 3300005434 Bacteria 3381
26 Ga0070709_10036256 3300005434 Bacteria 3003
27 Ga0070714_100203355 3300005435 Bacteria 1812
28 Ga0070713_100018506 3300005436 Bacteria 5293
29 Ga0070713_100574126 3300005436 Unclassified 1069
30 Ga0070710_10009722 3300005437 Bacteria 4711
31 Ga0070710_10027537 3300005437 Bacteria 3032
32 Ga0070710_10100892 3300005437 Bacteria 1718
33 Ga0070701_10044650 3300005438 Bacteria 2271
34 Ga0070711_100046749 3300005439 Bacteria 2950
35 Ga0070705_100000027 3300005440 Bacteria 77032
36 Ga0070705_100083507 3300005440 Bacteria 1968
37 Ga0070700_100002837 3300005441 Bacteria 8890
38 Ga0070694_100001651 3300005444 Bacteria 13115
39 Ga0070708_100029409 3300005445 Bacteria 4738
40 Ga0070663_100003177 3300005455 Bacteria 9428
41 Ga0070663_100026307 3300005455 Bacteria 3940
42 Ga0070663_100347058 3300005455 Bacteria 1201
43 Ga0070663_100615892 3300005455 Bacteria 915
44 Ga0070678_100019469 3300005456 Bacteria 4426
45 Ga0070678_100226389 3300005456 Bacteria 1557
46 Ga0070678_100291433 3300005456 Bacteria 1384
47 Ga0070662_100086860 3300005457 Bacteria 2340
48 Ga0070681_10012408 3300005458 Bacteria 8452
49 Ga0070681_10020093 3300005458 Bacteria 6693
50 Ga0070681_10139461 3300005458 Bacteria 2355
51 Ga0070681_10154777 3300005458 Bacteria 2218
52 Ga0070681_10201849 3300005458 Bacteria 1906
53 Ga0068867_100205080 3300005459 Bacteria 1580
54 Ga0070685_10147470 3300005466 Bacteria 1488
55 Ga0070685_10354815 3300005466 Bacteria 1004
56 Ga0070707_100235025 3300005468 Bacteria 1784
57 Ga0070698_100074454 3300005471 Bacteria 3401
58 Ga0070699_100000454 3300005518 Bacteria 39303
59 Ga0070679_100011488 3300005530 Bacteria 8439
60 Ga0070679_100140494 3300005530 Bacteria 2395
61 Ga0070679_100194172 3300005530 Bacteria 1998
62 Ga0070679_100397969 3300005530 Bacteria 1323
63 Ga0070679_100552711 3300005530 Unclassified 1095
64 Ga0070684_100013204 3300005535 Bacteria 6650
65 Ga0070684_100014566 3300005535 Bacteria 6375
66 Ga0070684_100057703 3300005535 Bacteria 3390
67 Ga0070697_100005007 3300005536 Bacteria 10174
68 Ga0070686_100051673 3300005544 Bacteria 2618
69 Ga0070686_100152246 3300005544 Unclassified 1621
70 Ga0070695_100001187 3300005545 Bacteria 14328
71 Ga0070695_100004938 3300005545 Bacteria 7866
72 Ga0070696_100000051 3300005546 Bacteria 54480
73 Ga0070696_100190074 3300005546 Bacteria 1528
74 Ga0070693_100115987 3300005547 Bacteria 1655
75 Ga0070665_100166899 3300005548 Bacteria 2204
76 Ga0070665_100650049 3300005548 Unclassified 1067
77 Ga0070704_100002193 3300005549 Bacteria 10879
78 Ga0068855_100149917 3300005563 Unclassified 2652
79 Ga0070664_100313879 3300005564 Viruses 1419
80 Ga0070664_100512186 3300005564 Bacteria 1107
81 Ga0068857_100009967 3300005577 Bacteria 8248
82 Ga0068857_100222591 3300005577 Unclassified 1724
83 Ga0068856_100657406 3300005614 Bacteria 1069
84 Ga0068859_100006951 3300005617 Bacteria 11493
85 Ga0068859_100007259 3300005617 Bacteria 11241
86 Ga0068859_100567606 3300005617 Bacteria 1229
87 Ga0068864_100081154 3300005618 Bacteria 2843
88 Ga0068864_100593939 3300005618 Bacteria 1074
89 Ga0068864_100622055 3300005618 Unclassified 1049
90 Ga0068861_100016587 3300005719 Bacteria 5214
91 Ga0068861_100020533 3300005719 Bacteria 4734
92 Ga0068870_10091527 3300005840 Bacteria 1701
93 Ga0068863_100062894 3300005841 Bacteria 3510
94 Ga0068863_100360124 3300005841 Bacteria 1418
95 Ga0068858_100110966 3300005842 Bacteria 2561
96 Ga0068858_100469481 3300005842 Bacteria 1214
97 Ga0068858_100581402 3300005842 Unclassified 1085
98 Ga0068860_100003821 3300005843 Bacteria 15492
99 Ga0068860_100020624 3300005843 Bacteria 6385
100 Ga0068862_100001513 3300005844 Bacteria 21315
101 Ga0081538_10036167 3300005981 Bacteria 3228
102 Ga0070717_10000938 3300006028 Bacteria 19441
103 Ga0075368_10001857 3300006042 Bacteria 6782
104 Ga0075368_10004366 3300006042 Bacteria 4786
105 Ga0075363_100009107 3300006048 Bacteria 4660
106 Ga0075363_100041803 3300006048 Bacteria 2419
107 Ga0075363_100311134 3300006048 Bacteria 915
108 Ga0075364_10152048 3300006051 Bacteria 1560
109 Ga0070716_100010800 3300006173 Bacteria 4590
110 Ga0070716_100192304 3300006173 Bacteria 1349
111 Ga0075367_10010172 3300006178 Bacteria 4932
112 Ga0075367_10043276 3300006178 Bacteria 2637
113 Ga0075367_10485045 3300006178 Bacteria 784
114 Ga0097621_100053338 3300006237 Bacteria 3296
115 Ga0075370_10020361 3300006353 Bacteria 3625
116 Ga0068871_100090481 3300006358 Bacteria 2549
117 Ga0068871_100550638 3300006358 Bacteria 1045
118 Ga0075428_100112570 3300006844 Bacteria 2964
119 Ga0075430_100010638 3300006846 Bacteria 7796
120 Ga0075430_100431140 3300006846 Bacteria 1088
121 Ga0075431_100003909 3300006847 Bacteria 14505
122 Ga0075431_100006985 3300006847 Bacteria 11224
123 Ga0075431_100010242 3300006847 Bacteria 9424
124 Ga0075431_100097514 3300006847 Bacteria 3036
125 Ga0075434_100018163 3300006871 Bacteria 6789
126 Ga0075436_100008963 3300006914 Bacteria 6846
127 Ga0075436_100148967 3300006914 Bacteria 1646
128 Ga0097620_100006952 3300006931 Bacteria 11493
129 Ga0097620_100007259 3300006931 Bacteria 11241
130 Ga0097620_100567571 3300006931 Bacteria 1229
131 Ga0099794_10056946 3300007265 Bacteria 1893
132 Ga0105240_10062357 3300009093 Bacteria 4642
133 Ga0105240_10201626 3300009093 Bacteria 2331
134 Ga0111539_10101583 3300009094 Bacteria 3376
135 Ga0105245_10503680 3300009098 Bacteria 1227
136 Ga0105247_10161060 3300009101 Bacteria 1486
137 Ga0105247_10333271 3300009101 Bacteria 1062
138 Ga0105247_10430733 3300009101 Bacteria 946
139 Ga0114129_10362492 3300009147 Bacteria 1917
140 Ga0114129_10379620 3300009147 Bacteria 1867
141 Ga0114129_10431659 3300009147 Bacteria 1731
142 Ga0105243_10108872 3300009148 Bacteria 2314
143 Ga0105241_10044461 3300009174 Bacteria 3366
144 Ga0105241_10069390 3300009174 Bacteria 2733
145 Ga0105242_10027220 3300009176 Bacteria 4538
146 Ga0105248_10058203 3300009177 Bacteria 4339
147 Ga0105248_10096518 3300009177 Bacteria 3330
148 Ga0105237_10148469 3300009545 Bacteria 2340
149 Ga0105238_10048713 3300009551 Bacteria 4269
150 Ga0105238_10071324 3300009551 Bacteria 3471
151 Ga0105238_10113473 3300009551 Bacteria 2690
152 Ga0105238_10561582 3300009551 Unclassified 1146
153 Ga0105249_10025244 3300009553 Bacteria 5347
154 Ga0105249_10028665 3300009553 Bacteria 5025
155 Ga0105249_10106127 3300009553 Bacteria 2649
156 Ga0105249_10263347 3300009553 Bacteria 1714
157 Ga0105249_10764050 3300009553 Bacteria 1029
158 Ga0105239_10125803 3300010375 Bacteria 2849
159 Ga0157373_10200954 3300013100 Bacteria 1405
160 Ga0157370_10116909 3300013104 Bacteria 2491
161 Ga0157369_10050445 3300013105 Bacteria 4507
162 Ga0157369_10119548 3300013105 Bacteria 2796
163 Ga0157378_10106191 3300013297 Bacteria 2568
164 Ga0163162_10005449 3300013306 Bacteria 12292
165 Ga0163162_10032027 3300013306 Bacteria 5219
166 Ga0163162_10135606 3300013306 Bacteria 2572
167 Ga0157372_10041708 3300013307 Bacteria 5073
168 Ga0157372_10461451 3300013307 Bacteria 1480
169 Ga0157375_10054994 3300013308 Bacteria 3922
170 Ga0163163_10000693 3300014325 Bacteria 28657
171 Ga0163163_10762334 3300014325 Bacteria 1031
172 Ga0157380_10105552 3300014326 Bacteria 2355
173 Ga0157380_10142588 3300014326 Bacteria 2060
174 Ga0157380_10377010 3300014326 Bacteria 1337
175 Ga0157380_10461907 3300014326 Bacteria 1222
176 Ga0182008_10173108 3300014497 Bacteria 1090
177 Ga0157379_10114223 3300014968 Bacteria 2427
178 Ga0157376_10555459 3300014969 Bacteria 1137
179 Ga0163161_10007341 3300017792 Bacteria 7609
180 Ga0163161_10128763 3300017792 Bacteria 1908
181 Ga0206353_11951829 3300020082 Bacteria 1268
182 Ga0207713_1092185 3300025735 Bacteria 1062
183 Ga0207692_10061720 3300025898 Bacteria 1943
184 Ga0207692_10133157 3300025898 Bacteria 1406
185 Ga0207710_10002727 3300025900 Bacteria 8089
186 Ga0207710_10116322 3300025900 Bacteria 1273
187 Ga0207688_10033146 3300025901 Bacteria 2855
188 Ga0207685_10001866 3300025905 Bacteria 4626
189 Ga0207699_10030049 3300025906 Bacteria 3037
190 Ga0207699_10032422 3300025906 Bacteria 2944
191 Ga0207699_10061851 3300025906 Bacteria 2254
192 Ga0207684_10431005 3300025910 Bacteria 1133
193 Ga0207654_10182912 3300025911 Bacteria 1368
194 Ga0207654_10253877 3300025911 Bacteria 1180
195 Ga0207654_10267930 3300025911 Bacteria 1151
196 Ga0207707_10000204 3300025912 Bacteria 63042
197 Ga0207707_10039976 3300025912 Bacteria 4098
198 Ga0207707_10106090 3300025912 Bacteria 2456
199 Ga0207707_10164411 3300025912 Bacteria 1939
200 Ga0207693_10004590 3300025915 Bacteria 11653
201 Ga0207663_10048950 3300025916 Bacteria 2618
202 Ga0207660_10006612 3300025917 Bacteria 7524
203 Ga0207660_10022705 3300025917 Bacteria 4229
204 Ga0207657_10258934 3300025919 Unclassified 1385
205 Ga0207652_10135443 3300025921 Bacteria 2199
206 Ga0207652_10139139 3300025921 Unclassified 2170
207 Ga0207652_10207871 3300025921 Unclassified 1762
208 Ga0207652_10319436 3300025921 Bacteria 1402
209 Ga0207694_10224894 3300025924 Bacteria 1531
210 Ga0207659_10147957 3300025926 Bacteria 1831
211 Ga0207700_10000751 3300025928 Bacteria 18675
212 Ga0207700_10383956 3300025928 Bacteria 1229
213 Ga0207664_10379242 3300025929 Bacteria 1255
214 Ga0207644_10008515 3300025931 Bacteria 6711
215 Ga0207706_10064096 3300025933 Bacteria 3235
216 Ga0207706_10116084 3300025933 Bacteria 2354
217 Ga0207709_10062881 3300025935 Bacteria 2325
218 Ga0207709_10155653 3300025935 Unclassified 1588
219 Ga0207670_10029988 3300025936 Bacteria 3472
220 Ga0207669_10007185 3300025937 Bacteria 5129
221 Ga0207704_10077076 3300025938 Bacteria 2139
222 Ga0207704_10174914 3300025938 Bacteria 1544
223 Ga0207665_10001820 3300025939 Bacteria 14355
224 Ga0207665_10141255 3300025939 Bacteria 1717
225 Ga0207691_10090561 3300025940 Unclassified 2741
226 Ga0207711_10021764 3300025941 Bacteria 5354
227 Ga0207711_10062066 3300025941 Bacteria 3223
228 Ga0207711_10414533 3300025941 Bacteria 1252
229 Ga0207711_10530646 3300025941 Unclassified 1098
230 Ga0207689_10061002 3300025942 Bacteria 3101
231 Ga0207661_10027426 3300025944 Bacteria 4350
232 Ga0207661_10076297 3300025944 Bacteria 2753
233 Ga0207679_10391259 3300025945 Viruses 1221
234 Ga0207667_10058439 3300025949 Bacteria 4044
235 Ga0207712_10064015 3300025961 Bacteria 2620
236 Ga0207712_10077985 3300025961 Unclassified 2403
237 Ga0207712_10192492 3300025961 Bacteria 1611
238 Ga0207668_10004910 3300025972 Bacteria 7864
239 Ga0207668_10241991 3300025972 Bacteria 1460
240 Ga0207703_10086751 3300026035 Bacteria 2622
241 Ga0207703_10099362 3300026035 Bacteria 2463
242 Ga0207703_10124310 3300026035 Bacteria 2219
243 Ga0207639_10552546 3300026041 Bacteria 1057
244 Ga0207678_10019413 3300026067 Bacteria 5970
245 Ga0207678_10387661 3300026067 Bacteria 1208
246 Ga0207708_10023797 3300026075 Bacteria 4631
247 Ga0207708_10053913 3300026075 Bacteria 3065
248 Ga0207702_10101008 3300026078 Bacteria 2546
249 Ga0207641_10025568 3300026088 Bacteria 4869
250 Ga0207641_10223528 3300026088 Bacteria 1747
251 Ga0207641_10628483 3300026088 Bacteria 1053
252 Ga0207648_10205974 3300026089 Bacteria 1745
253 Ga0207676_10196474 3300026095 Bacteria 1779
254 Ga0207676_10494603 3300026095 Bacteria 1160
255 Ga0207674_10002717 3300026116 Bacteria 22070
256 Ga0207674_10109774 3300026116 Bacteria 2734
257 Ga0207675_100017884 3300026118 Bacteria 6611
258 Ga0207675_100028733 3300026118 Bacteria 5180
259 Ga0207675_100035537 3300026118 Bacteria 4648
260 Ga0207683_10013609 3300026121 Bacteria 6939
261 Ga0207683_10042497 3300026121 Bacteria 3970
262 Ga0209813_10003369 3300027866 Bacteria 3734
263 Ga0268266_10013896 3300028379 Bacteria 6932
264 Ga0268266_10045072 3300028379 Bacteria 3771
265 Ga0268266_10276028 3300028379 Unclassified 1561
266 Ga0268266_10463309 3300028379 Bacteria 1206
267 Ga0268265_10000493 3300028380 Bacteria 41060
268 Ga0268265_10015224 3300028380 Bacteria 5258
269 Ga0268264_10002296 3300028381 Bacteria 16929
270 Ga0268264_10036394 3300028381 Bacteria 4055
271 Ga0268264_10286604 3300028381 Bacteria 1545
272 Ga0265332_10000917 3300031238 Bacteria 17700
273 Ga0265329_10010587 3300031242 Bacteria 3378
274 Ga0265340_10006545 3300031247 Bacteria 6399
275 Ga0265339_10015306 3300031249 Bacteria 4601
276 Ga0265331_10020213 3300031250 Bacteria 3423
277 Ga0307408_100433962 3300031548 Bacteria 1136
278 Ga0265314_10028365 3300031711 Bacteria 4174
279 Ga0265342_10000069 3300031712 Bacteria 110550
280 Ga0307407_10164286 3300031903 Bacteria 1456
281 Ga0307409_100190641 3300031995 Bacteria 1824
282 Ga0307415_100380396 3300032126 Bacteria 1198
283 Ga0373923_0013744 3300035111 Bacteria 3023
284 Ga0373923_0025112 3300035111 Bacteria 2358
285 Ga0373945_0007437 3300035116 Bacteria 3551
286 Ga0373945_0015868 3300035116 Unclassified 2538
287 Ga0373953_0011179 3300035117 Bacteria 3144
288 Ga0373954_0026490 3300035118 Bacteria 2658
289 Ga0373956_0019665 3300035119 Bacteria 2866
290 Ga0373956_0024945 3300035119 Bacteria 2581
291 Ga0373957_0029269 3300035120 Bacteria 2011
292 Ga0373943_0002295 3300035170 Bacteria 8689
293 Ga0373943_0043857 3300035170 Unclassified 2174
294 Ga0373946_0013481 3300035171 Bacteria 3075
295 Ga0373946_0083717 3300035171 Unclassified 1401
296 Ga0373955_0029422 3300035172 Bacteria 2856
297 Ga0373955_0049600 3300035172 Bacteria 2280
298 Ga0373924_0027900 3300035410 Bacteria 2247
299 Ga0373931_0198919 3300035691 Bacteria 1196
300 Ga0373935_0004551 3300035692 Bacteria 8152
301 Ga0373935_0075597 3300035692 Bacteria 2179
302 Ga0373927_0007100 3300035695 Bacteria 7598
303 Ga0373927_0024431 3300035695 Bacteria 3953
304 Ga0373927_0226515 3300035695 Bacteria 1228
305 Ga0373933_0008198 3300035724 Bacteria 5703
306 Ga0373947_0086507 3300035725 Bacteria 1948
307 Ga0373947_0088002 3300035725 Unclassified 1932
308 Ga0373937_0083231 3300036401 Bacteria 2960
309 Ga0373937_0121758 3300036401 Bacteria 2431
310 Ga0373937_0284977 3300036401 Unclassified 1560
311 Ga0373925_0003332 3300037068 Bacteria 12485
312 Ga0373925_0008055 3300037068 Bacteria 7675
313 Ga0373925_0101799 3300037068 Bacteria 2209
314 Ga0373925_0212179 3300037068 Bacteria 1542
315 Ga0395899_0027775 3300037312 Bacteria 4263
316 Ga0395899_0031906 3300037312 Bacteria 3958
317 Ga0395899_0126924 3300037312 Unclassified 1824
318 Ga0395900_0005623 3300037418 Bacteria 13110
319 Ga0395900_0014818 3300037418 Bacteria 7942
320 Ga0395900_0091243 3300037418 Bacteria 3131
321 Ga0395898_0009703 3300037466 Bacteria 10094
322 Ga0395898_0009874 3300037466 Bacteria 10006
323 Ga0395898_0148624 3300037466 Bacteria 2242
324 Ga0436364_1102499 3300037853 Bacteria 2220
325 Ga0395901_0004287 3300038443 Bacteria 14389
326 Ga0395901_0010157 3300038443 Bacteria 9540
327 Ga0395901_0106580 3300038443 Unclassified 2941
328 Ga0451807_1793899 3300041486 Bacteria 1357
329 Ga0439448_0094760 3300042005 Unclassified 1011
330 Ga0439460_0003903 3300042461 Bacteria 3619
331 Ga0495617_039827 3300046452 Unclassified 1572
332 Ga0495592_0001530 3300046454 Bacteria 16127
333 Ga0495603_0001247 3300046455 Bacteria 14873
334 Ga0495603_0013938 3300046455 Bacteria 4861
335 Ga0495629_0001052 3300046459 Bacteria 22061
336 Ga0495638_0140102 3300046460 Bacteria 1413
337 Ga0495641_0004176 3300046461 Bacteria 10378
338 Ga0495651_0257894 3300046462 Bacteria 1187
339 Ga0495653_0159030 3300046463 Bacteria 1570
340 Ga0495650_0032622 3300046471 Bacteria 2327
341 Ga0495580_0007358 3300046472 Bacteria 8854
342 Ga0495580_0007868 3300046472 Bacteria 8528
343 Ga0495582_0000221 3300046473 Bacteria 31591
344 Ga0495582_0033524 3300046473 Bacteria 2823
345 Ga0495605_0099845 3300046474 Bacteria 1335
346 Ga0495639_0001053 3300046475 Bacteria 12441
347 Ga0495639_0015119 3300046475 Bacteria 3347
348 Ga0495662_0003281 3300046476 Bacteria 8191
349 Ga0495662_0025881 3300046476 Bacteria 2834
350 Ga0495664_0043739 3300046477 Bacteria 2654
351 Ga0495664_0163731 3300046477 Bacteria 1349
352 Ga0495584_0265697 3300046491 Bacteria 872
353 Ga0495594_0000259 3300046499 Bacteria 25796
354 Ga0495594_0028217 3300046499 Bacteria 3027
355 Ga0495608_0030268 3300046511 Bacteria 3666
356 Ga0495608_0246296 3300046511 Bacteria 1115
357 Ga0495616_0031594 3300046513 Bacteria 2771
358 Ga0495618_0032972 3300046514 Unclassified 3246
359 Ga0495620_0035741 3300046515 Bacteria 2230
360 Ga0495628_0001389 3300046516 Bacteria 22209
361 Ga0495628_0050871 3300046516 Bacteria 3277
362 Ga0495628_0116392 3300046516 Bacteria 2053
363 Ga0495630_0002234 3300046517 Bacteria 13474
364 Ga0495630_0071475 3300046517 Bacteria 2611
365 Ga0495632_0085144 3300046519 Bacteria 1504
366 Ga0495632_0093955 3300046519 Unclassified 1419
367 Ga0495644_0049553 3300046523 Unclassified 1576
368 Ga0495666_0007121 3300046526 Bacteria 5621
369 Ga0495666_0047878 3300046526 Bacteria 2060
370 Ga0495652_0045290 3300046529 Bacteria 3784
371 Ga0495652_0131024 3300046529 Unclassified 1985
372 Ga0495652_0236667 3300046529 Bacteria 1362
373 Ga0495665_0000755 3300046531 Bacteria 16775
374 Ga0495640_0000198 3300046533 Bacteria 40193
375 Ga0495640_0051615 3300046533 Bacteria 2826
376 Ga0495587_0003773 3300046536 Bacteria 10050
377 Ga0495598_0021515 3300046537 Bacteria 1716
378 Ga0495645_0000359 3300046543 Bacteria 31690
379 Ga0495645_0141589 3300046543 Bacteria 1677
380 Ga0495622_0014159 3300046557 Bacteria 3703
381 Ga0495633_0008284 3300046558 Bacteria 5880
382 Ga0495667_0005600 3300046559 Bacteria 8488
383 Ga0495667_0043523 3300046559 Bacteria 2975
384 Ga0495668_0146414 3300046616 Unclassified 1293
385 Ga0495634_0003584 3300046642 Bacteria 12413
386 Ga0495634_0028526 3300046642 Bacteria 3873
387 Ga0495635_0004759 3300046663 Bacteria 9436
388 Ga0495635_0031318 3300046663 Bacteria 3693
389 Ga0495661_0089783 3300046665 Bacteria 1751
390 Ga0495588_0013975 3300046674 Bacteria 3835
391 Ga0495657_0013159 3300046675 Bacteria 6113
392 Ga0495657_0103511 3300046675 Bacteria 1811
393 Ga0495599_0002856 3300046678 Bacteria 10068
394 Ga0495646_0039366 3300046680 Bacteria 2915
395 Ga0495646_0066603 3300046680 Unclassified 2130
396 Ga0495646_0070475 3300046680 Bacteria 2059
397 Ga0495647_0011050 3300046681 Bacteria 3085
398 Ga0495658_0000937 3300046683 Bacteria 15538
399 Ga0495669_0006085 3300046684 Bacteria 5032
400 Ga0495613_0000393 3300046689 Bacteria 37458
401 Ga0495613_0047560 3300046689 Unclassified 3169
402 Ga0495624_0000182 3300046690 Bacteria 46968
403 Ga0495624_0016734 3300046690 Bacteria 4935
404 Ga0495670_0243661 3300046691 Bacteria 957
405 Ga0495649_0085682 3300046694 Unclassified 1682
406 Ga0495600_0001577 3300046809 Bacteria 12681
407 Ga0495581_0001865 3300047315 Bacteria 11792
408 Ga0495581_0013041 3300047315 Bacteria 4817
409 Ga0495604_0007461 3300047317 Bacteria 8657
410 Ga0495604_0199919 3300047317 Bacteria 1387
411 Ga0495636_0022032 3300047318 Bacteria 2575
412 Ga0495674_0005687 3300047319 Bacteria 11939
413 Ga0495674_0210886 3300047319 Bacteria 1609
414 Ga0495674_0327844 3300047319 Bacteria 1246
415 Ga0495676_0016635 3300047321 Bacteria 6518
416 Ga0495676_0034747 3300047321 Bacteria 4226
417 Ga0495676_0071684 3300047321 Bacteria 2663
418 Ga0495675_0018126 3300047444 Bacteria 4465
419 Ga0495684_0027179 3300047471 Bacteria 4393
420 Ga0495684_0033270 3300047471 Bacteria 3956
421 Ga0495593_0000827 3300047673 Bacteria 17976
422 Ga0495593_0053637 3300047673 Unclassified 2127
423 Ga0495602_0036462 3300048088 Bacteria 4577
424 Ga0495602_0373772 3300048088 Bacteria 1023
425 Ga0495614_0022564 3300048089 Bacteria 2716
426 Ga0495614_0076297 3300048089 Unclassified 1449
427 Ga0496101_0271428 3300048904 Bacteria 1324
428 Ga0496102_0012053 3300048905 Bacteria 7470
429 Ga0496102_0285599 3300048905 Bacteria 1555
430 Ga0496102_0304254 3300048905 Bacteria 1503
431 Ga0496102_0460364 3300048905 Bacteria 1193
432 Ga0496103_0012950 3300048906 Bacteria 4947
433 Ga0496104_0000086 3300048907 Bacteria 89916
434 Ga0496104_0155662 3300048907 Bacteria 2193
435 Ga0496105_0001471 3300048908 Bacteria 16623
436 Ga0496105_0220537 3300048908 Bacteria 1544
437 Ga0496105_0340963 3300048908 Bacteria 1198
438 Ga0496106_0002468 3300048909 Bacteria 13788
439 Ga0496106_0203370 3300048909 Bacteria 1576
440 Ga0496106_0436760 3300048909 Bacteria 1052
441 Ga0496107_0008553 3300048910 Bacteria 7083
442 Ga0496108_0002358 3300048911 Bacteria 15127
443 Ga0496108_0025091 3300048911 Bacteria 4912
444 Ga0496108_0348303 3300048911 Bacteria 1292
445 Ga0496109_0004689 3300048912 Bacteria 11413
446 Ga0496109_0007719 3300048912 Bacteria 9115
447 Ga0496109_0170891 3300048912 Bacteria 2039
448 Ga0496110_0000532 3300048913 Bacteria 25909
449 Ga0496111_0003579 3300048914 Bacteria 9629
450 Ga0496111_0013721 3300048914 Bacteria 5519
451 Ga0496112_0005694 3300048915 Bacteria 10823
452 Ga0496112_0012138 3300048915 Bacteria 7906
453 Ga0496113_0008446 3300048916 Bacteria 6709
454 Ga0496113_0025594 3300048916 Bacteria 4208
455 Ga0496114_0119808 3300048917 Bacteria 2263
456 Ga0496115_0032133 3300048918 Bacteria 4140
457 Ga0496115_0068868 3300048918 Bacteria 2866
458 Ga0496115_0154708 3300048918 Bacteria 1894
459 Ga0496118_0135896 3300048921 Bacteria 1569
460 Ga0496121_0007756 3300048924 Bacteria 12859
461 Ga0496124_0117074 3300048927 Bacteria 2135
462 Ga0496124_0135375 3300048927 Bacteria 1951
463 Ga0496125_0035282 3300048928 Bacteria 4392
464 Ga0496126_0035207 3300048929 Bacteria 4694
465 Ga0495682_0105048 3300049460 Bacteria 1013
466 Ga0501040_0117297 3300049576 Bacteria 1865
467 Ga0501041_0055395 3300049577 Bacteria 2420
468 Ga0501072_0035105 3300049588 Bacteria 3930
469 Ga0501075_0109590 3300049591 Bacteria 2099
470 Ga0501076_0037214 3300049592 Bacteria 3815
471 Ga0501076_0057402 3300049592 Bacteria 3091
472 Ga0501077_0084989 3300049593 Bacteria 2006
473 Ga0501077_0149225 3300049593 Unclassified 1483
474 Ga0501080_0153319 3300049742 Bacteria 2129
475 Ga0501081_0079661 3300049743 Bacteria 2291
476 Ga0501081_0082895 3300049743 Bacteria 2247
477 Ga0501081_0091915 3300049743 Bacteria 2135
478 Ga0501081_0444183 3300049743 Bacteria 963
479 Ga0501045_0075660 3300049824 Bacteria 2480
480 Ga0501045_0336974 3300049824 Bacteria 1122
481 nmdc:mga03n38_793_c1 3300050490 Bacteria 8393
482 nmdc:mga0yw44_376023_c1 3300050492 Bacteria 959
483 nmdc:mga0k408_113760_c1 3300050493 Bacteria 1600
484 nmdc:mga06z11_133175_c1 3300050494 Bacteria 1398
485 nmdc:mga06z11_3967_c1 3300050494 Bacteria 5771
486 nmdc:mga04h51_3371_c1 3300050495 Bacteria 3880
487 nmdc:mga07m45_73776_c1 3300050496 Bacteria 1226
488 nmdc:mga05p37_283857_c1 3300050507 Bacteria 1973
489 nmdc:mga05p37_293898_c1 3300050507 Bacteria 1933
490 nmdc:mga0qj67_11268_c1 3300050509 Bacteria 6697
491 nmdc:mga06r32_1544_c1 3300050510 Bacteria 20738
492 nmdc:mga06r32_54093_c1 3300050510 Bacteria 3849
493 nmdc:mga06r32_6262_c1 3300050510 Bacteria 10685
494 nmdc:mga06r32_703669_c1 3300050510 Bacteria 976
495 nmdc:mga06r32_96895_c1 3300050510 Bacteria 2889
496 nmdc:mga08y16_103807_c1 3300050511 Bacteria 2959
497 nmdc:mga08y16_300232_c1 3300050511 Bacteria 1655
498 nmdc:mga08x19_126659_c1 3300050514 Bacteria 1715
499 nmdc:mga08x19_24_c1 3300050514 Bacteria 245940
500 Ga0495601_0002897 3300053077 Bacteria 9758
501 Ga0495601_0098944 3300053077 Bacteria 1883
502 Ga0495601_0144512 3300053077 Bacteria 1552
503 Ga0495601_0194605 3300053077 Unclassified 1325
504 Ga0495612_0003210 3300053078 Bacteria 6779
505 Ga0495595_0002677 3300053084 Bacteria 6986
506 Ga0495619_0002304 3300053085 Bacteria 12575
507 Ga0495619_0190775 3300053085 Bacteria 1418
508 Ga0500566_0000003 3300053094 Bacteria 166820
509 Ga0500640_000016 3300053095 Bacteria 24966
510 Ga0500555_064842 3300053103 Bacteria 975
511 Ga0500572_000125 3300053111 Bacteria 25716
512 Ga0500591_030900 3300053115 Bacteria 2584
513 Ga0500595_001762 3300053119 Bacteria 11267
514 Ga0500595_003974 3300053119 Bacteria 6757
515 Ga0500608_011166 3300053122 Bacteria 3889
516 Ga0500614_000470 3300053123 Bacteria 10447
517 Ga0500559_0002825 3300053136 Bacteria 8774
518 Ga0500590_169526 3300053148 Bacteria 962
519 Ga0500603_000029 3300053150 Bacteria 36423
520 Ga0500630_000051 3300053159 Bacteria 34539
521 Ga0500638_001699 3300053162 Bacteria 7160
522 Ga0500639_000042 3300053163 Bacteria 61423
523 Ga0500576_073534 3300053725 Bacteria 1463
524 Ga0500645_035723 3300053730 Bacteria 1480
525 Ga0501084_0079085 3300054114 Bacteria 2756
526 Ga0501084_0086082 3300054114 Bacteria 2639
527 Ga0501084_0512983 3300054114 Bacteria 1013
528 Ga0500661_033148 3300055283 Bacteria 912
529 Ga0501082_0062227 3300060353 Bacteria 3212
530 Ga0501082_0141801 3300060353 Bacteria 2086
531 Ga0501082_0231202 3300060353 Bacteria 1609
532 Ga0530510_0023035 3300061734 Bacteria 4439
533 Ga0530510_0126922 3300061734 Bacteria 1876
534 Ga0530510_0360538 3300061734 Bacteria 1092
535 Ga0157372_10453056
536 JGI24738J21930_10000339
537 Ga0070683_100070542
538 Ga0070690_100555576
539 Ga0068869_100052528
540 Ga0070680_100003636
541 Ga0070680_100076851
542 Ga0070680_100090104
543 Ga0070680_100719816
544 Ga0070682_100051692
545 Ga0070682_100286138
546 Ga0068868_100324176
547 Ga0070691_10045146
548 Ga0070661_100363479
549 Ga0070668_100023103
550 Ga0070669_100284842
551 Ga0070675_100194383
552 Ga0070671_100187740
553 Ga0070674_100035415
554 Ga0070674_100067908
555 Ga0070673_100443920
556 Ga0070673_100661674
557 Ga0070688_100190327
558 Ga0070703_10000756
559 Ga0070709_10027521
560 Ga0070709_10036256
561 Ga0070714_100203355
562 Ga0070713_100018506
563 Ga0070713_100574126
564 Ga0070710_10009722
565 Ga0070710_10027537
566 Ga0070710_10100892
567 Ga0070701_10044650
568 Ga0070711_100046749
569 Ga0070705_100000027
570 Ga0070705_100083507
571 Ga0070700_100002837
572 Ga0070694_100001651
573 Ga0070708_100029409
574 Ga0070663_100003177
575 Ga0070663_100026307
576 Ga0070663_100347058
577 Ga0070663_100615892
578 Ga0070678_100019469
579 Ga0070678_100226389
580 Ga0070678_100291433
581 Ga0070662_100086860
582 Ga0070681_10012408
583 Ga0070681_10020093
584 Ga0070681_10139461
585 Ga0070681_10154777
586 Ga0070681_10201849
587 Ga0068867_100205080
588 Ga0070685_10147470
589 Ga0070685_10354815
590 Ga0070707_100235025
591 Ga0070698_100074454
592 Ga0070699_100000454
593 Ga0070679_100011488
594 Ga0070679_100140494
595 Ga0070679_100194172
596 Ga0070679_100397969
597 Ga0070679_100552711
598 Ga0070684_100013204
599 Ga0070684_100014566
600 Ga0070684_100057703
601 Ga0070697_100005007
602 Ga0070686_100051673
603 Ga0070686_100152246
604 Ga0070695_100001187
605 Ga0070695_100004938
606 Ga0070696_100000051
607 Ga0070696_100190074
608 Ga0070693_100115987
609 Ga0070665_100166899
610 Ga0070665_100650049
611 Ga0070704_100002193
612 Ga0068855_100149917
613 Ga0070664_100313879
614 Ga0070664_100512186
615 Ga0068857_100009967
616 Ga0068857_100222591
617 Ga0068856_100657406
618 Ga0068859_100006951
619 Ga0068859_100007259
620 Ga0068859_100567606
621 Ga0068864_100081154
622 Ga0068864_100593939
623 Ga0068864_100622055
624 Ga0068861_100016587
625 Ga0068861_100020533
626 Ga0068870_10091527
627 Ga0068863_100062894
628 Ga0068863_100360124
629 Ga0068858_100110966
630 Ga0068858_100469481
631 Ga0068858_100581402
632 Ga0068860_100003821
633 Ga0068860_100020624
634 Ga0068862_100001513
635 Ga0081538_10036167
636 Ga0070717_10000938
637 Ga0075368_10001857
638 Ga0075368_10004366
639 Ga0075363_100009107
640 Ga0075363_100041803
641 Ga0075363_100311134
642 Ga0075364_10152048
643 Ga0070716_100010800
644 Ga0070716_100192304
645 Ga0075367_10010172
646 Ga0075367_10043276
647 Ga0075367_10485045
648 Ga0097621_100053338
649 Ga0075370_10020361
650 Ga0068871_100090481
651 Ga0068871_100550638
652 Ga0075428_100112570
653 Ga0075430_100010638
654 Ga0075430_100431140
655 Ga0075431_100003909
656 Ga0075431_100006985
657 Ga0075431_100010242
658 Ga0075431_100097514
659 Ga0075434_100018163
660 Ga0075436_100008963
661 Ga0075436_100148967
662 Ga0097620_100006952
663 Ga0097620_100007259
664 Ga0097620_100567571
665 Ga0099794_10056946
666 Ga0105240_10062357
667 Ga0105240_10201626
668 Ga0111539_10101583
669 Ga0105245_10503680
670 Ga0105247_10161060
671 Ga0105247_10333271
672 Ga0105247_10430733
673 Ga0114129_10362492
674 Ga0114129_10379620
675 Ga0114129_10431659
676 Ga0105243_10108872
677 Ga0105241_10044461
678 Ga0105241_10069390
679 Ga0105242_10027220
680 Ga0105248_10058203
681 Ga0105248_10096518
682 Ga0105237_10148469
683 Ga0105238_10048713
684 Ga0105238_10071324
685 Ga0105238_10113473
686 Ga0105238_10561582
687 Ga0105249_10025244
688 Ga0105249_10028665
689 Ga0105249_10106127
690 Ga0105249_10263347
691 Ga0105249_10764050
692 Ga0105239_10125803
693 Ga0157373_10200954
694 Ga0157370_10116909
695 Ga0157369_10050445
696 Ga0157369_10119548
697 Ga0157378_10106191
698 Ga0163162_10005449
699 Ga0163162_10032027
700 Ga0163162_10135606
701 Ga0157372_10041708
702 Ga0157372_10461451
703 Ga0157375_10054994
704 Ga0163163_10000693
705 Ga0163163_10762334
706 Ga0157380_10105552
707 Ga0157380_10142588
708 Ga0157380_10377010
709 Ga0157380_10461907
710 Ga0182008_10173108
711 Ga0157379_10114223
712 Ga0157376_10555459
713 Ga0163161_10007341
714 Ga0163161_10128763
715 Ga0206353_11951829
716 Ga0207713_1092185
717 Ga0207692_10061720
718 Ga0207692_10133157
719 Ga0207710_10002727
720 Ga0207710_10116322
721 Ga0207688_10033146
722 Ga0207685_10001866
723 Ga0207699_10030049
724 Ga0207699_10032422
725 Ga0207699_10061851
726 Ga0207684_10431005
727 Ga0207654_10182912
728 Ga0207654_10253877
729 Ga0207654_10267930
730 Ga0207707_10000204
731 Ga0207707_10039976
732 Ga0207707_10106090
733 Ga0207707_10164411
734 Ga0207693_10004590
735 Ga0207663_10048950
736 Ga0207660_10006612
737 Ga0207660_10022705
738 Ga0207657_10258934
739 Ga0207652_10135443
740 Ga0207652_10139139
741 Ga0207652_10207871
742 Ga0207652_10319436
743 Ga0207694_10224894
744 Ga0207659_10147957
745 Ga0207700_10000751
746 Ga0207700_10383956
747 Ga0207664_10379242
748 Ga0207644_10008515
749 Ga0207706_10064096
750 Ga0207706_10116084
751 Ga0207709_10062881
752 Ga0207709_10155653
753 Ga0207670_10029988
754 Ga0207669_10007185
755 Ga0207704_10077076
756 Ga0207704_10174914
757 Ga0207665_10001820
758 Ga0207665_10141255
759 Ga0207691_10090561
760 Ga0207711_10021764
761 Ga0207711_10062066
762 Ga0207711_10414533
763 Ga0207711_10530646
764 Ga0207689_10061002
765 Ga0207661_10027426
766 Ga0207661_10076297
767 Ga0207679_10391259
768 Ga0207667_10058439
769 Ga0207712_10064015
770 Ga0207712_10077985
771 Ga0207712_10192492
772 Ga0207668_10004910
773 Ga0207668_10241991
774 Ga0207703_10086751
775 Ga0207703_10099362
776 Ga0207703_10124310
777 Ga0207639_10552546
778 Ga0207678_10019413
779 Ga0207678_10387661
780 Ga0207708_10023797
781 Ga0207708_10053913
782 Ga0207702_10101008
783 Ga0207641_10025568
784 Ga0207641_10223528
785 Ga0207641_10628483
786 Ga0207648_10205974
787 Ga0207676_10196474
788 Ga0207676_10494603
789 Ga0207674_10002717
790 Ga0207674_10109774
791 Ga0207675_100017884
792 Ga0207675_100028733
793 Ga0207675_100035537
794 Ga0207683_10013609
795 Ga0207683_10042497
796 Ga0209813_10003369
797 Ga0268266_10013896
798 Ga0268266_10045072
799 Ga0268266_10276028
800 Ga0268266_10463309
801 Ga0268265_10000493
802 Ga0268265_10015224
803 Ga0268264_10002296
804 Ga0268264_10036394
805 Ga0268264_10286604
806 Ga0265332_10000917
807 Ga0265329_10010587
808 Ga0265340_10006545
809 Ga0265339_10015306
810 Ga0265331_10020213
811 Ga0307408_100433962
812 Ga0265314_10028365
813 Ga0265342_10000069
814 Ga0307407_10164286
815 Ga0307409_100190641
816 Ga0307415_100380396
817 Ga0373923_0013744
818 Ga0373923_0025112
819 Ga0373945_0007437
820 Ga0373945_0015868
821 Ga0373953_0011179
822 Ga0373954_0026490
823 Ga0373956_0019665
824 Ga0373956_0024945
825 Ga0373957_0029269
826 Ga0373943_0002295
827 Ga0373943_0043857
828 Ga0373946_0013481
829 Ga0373946_0083717
830 Ga0373955_0029422
831 Ga0373955_0049600
832 Ga0373924_0027900
833 Ga0373931_0198919
834 Ga0373935_0004551
835 Ga0373935_0075597
836 Ga0373927_0007100
837 Ga0373927_0024431
838 Ga0373927_0226515
839 Ga0373933_0008198
840 Ga0373947_0086507
841 Ga0373947_0088002
842 Ga0373937_0083231
843 Ga0373937_0121758
844 Ga0373937_0284977
845 Ga0373925_0003332
846 Ga0373925_0008055
847 Ga0373925_0101799
848 Ga0373925_0212179
849 Ga0395899_0027775
850 Ga0395899_0031906
851 Ga0395899_0126924
852 Ga0395900_0005623
853 Ga0395900_0014818
854 Ga0395900_0091243
855 Ga0395898_0009703
856 Ga0395898_0009874
857 Ga0395898_0148624
858 Ga0436364_1102499
859 Ga0395901_0004287
860 Ga0395901_0010157
861 Ga0395901_0106580
862 Ga0451807_1793899
863 Ga0439448_0094760
864 Ga0439460_0003903
865 Ga0495617_039827
866 Ga0495592_0001530
867 Ga0495603_0001247
868 Ga0495603_0013938
869 Ga0495629_0001052
870 Ga0495638_0140102
871 Ga0495641_0004176
872 Ga0495651_0257894
873 Ga0495653_0159030
874 Ga0495650_0032622
875 Ga0495580_0007358
876 Ga0495580_0007868
877 Ga0495582_0000221
878 Ga0495582_0033524
879 Ga0495605_0099845
880 Ga0495639_0001053
881 Ga0495639_0015119
882 Ga0495662_0003281
883 Ga0495662_0025881
884 Ga0495664_0043739
885 Ga0495664_0163731
886 Ga0495584_0265697
887 Ga0495594_0000259
888 Ga0495594_0028217
889 Ga0495608_0030268
890 Ga0495608_0246296
891 Ga0495616_0031594
892 Ga0495618_0032972
893 Ga0495620_0035741
894 Ga0495628_0001389
895 Ga0495628_0050871
896 Ga0495628_0116392
897 Ga0495630_0002234
898 Ga0495630_0071475
899 Ga0495632_0085144
900 Ga0495632_0093955
901 Ga0495644_0049553
902 Ga0495666_0007121
903 Ga0495666_0047878
904 Ga0495652_0045290
905 Ga0495652_0131024
906 Ga0495652_0236667
907 Ga0495665_0000755
908 Ga0495640_0000198
909 Ga0495640_0051615
910 Ga0495587_0003773
911 Ga0495598_0021515
912 Ga0495645_0000359
913 Ga0495645_0141589
914 Ga0495622_0014159
915 Ga0495633_0008284
916 Ga0495667_0005600
917 Ga0495667_0043523
918 Ga0495668_0146414
919 Ga0495634_0003584
920 Ga0495634_0028526
921 Ga0495635_0004759
922 Ga0495635_0031318
923 Ga0495661_0089783
924 Ga0495588_0013975
925 Ga0495657_0013159
926 Ga0495657_0103511
927 Ga0495599_0002856
928 Ga0495646_0039366
929 Ga0495646_0066603
930 Ga0495646_0070475
931 Ga0495647_0011050
932 Ga0495658_0000937
933 Ga0495669_0006085
934 Ga0495613_0000393
935 Ga0495613_0047560
936 Ga0495624_0000182
937 Ga0495624_0016734
938 Ga0495670_0243661
939 Ga0495649_0085682
940 Ga0495600_0001577
941 Ga0495581_0001865
942 Ga0495581_0013041
943 Ga0495604_0007461
944 Ga0495604_0199919
945 Ga0495636_0022032
946 Ga0495674_0005687
947 Ga0495674_0210886
948 Ga0495674_0327844
949 Ga0495676_0016635
950 Ga0495676_0034747
951 Ga0495676_0071684
952 Ga0495675_0018126
953 Ga0495684_0027179
954 Ga0495684_0033270
955 Ga0495593_0000827
956 Ga0495593_0053637
957 Ga0495602_0036462
958 Ga0495602_0373772
959 Ga0495614_0022564
960 Ga0495614_0076297
961 Ga0496101_0271428
962 Ga0496102_0012053
963 Ga0496102_0285599
964 Ga0496102_0304254
965 Ga0496102_0460364
966 Ga0496103_0012950
967 Ga0496104_0000086
968 Ga0496104_0155662
969 Ga0496105_0001471
970 Ga0496105_0220537
971 Ga0496105_0340963
972 Ga0496106_0002468
973 Ga0496106_0203370
974 Ga0496106_0436760
975 Ga0496107_0008553
976 Ga0496108_0002358
977 Ga0496108_0025091
978 Ga0496108_0348303
979 Ga0496109_0004689
980 Ga0496109_0007719
981 Ga0496109_0170891
982 Ga0496110_0000532
983 Ga0496111_0003579
984 Ga0496111_0013721
985 Ga0496112_0005694
986 Ga0496112_0012138
987 Ga0496113_0008446
988 Ga0496113_0025594
989 Ga0496114_0119808
990 Ga0496115_0032133
991 Ga0496115_0068868
992 Ga0496115_0154708
993 Ga0496118_0135896
994 Ga0496121_0007756
995 Ga0496124_0117074
996 Ga0496124_0135375
997 Ga0496125_0035282
998 Ga0496126_0035207
999 Ga0495682_0105048
1000 Ga0501040_0117297
1001 Ga0501041_0055395
1002 Ga0501072_0035105
1003 Ga0501075_0109590
1004 Ga0501076_0037214
1005 Ga0501076_0057402
1006 Ga0501077_0084989
1007 Ga0501077_0149225
1008 Ga0501080_0153319
1009 Ga0501081_0079661
1010 Ga0501081_0082895
1011 Ga0501081_0091915
1012 Ga0501081_0444183
1013 Ga0501045_0075660
1014 Ga0501045_0336974
1015 nmdc:mga03n38_793_c1
1016 nmdc:mga0yw44_376023_c1
1017 nmdc:mga0k408_113760_c1
1018 nmdc:mga06z11_133175_c1
1019 nmdc:mga06z11_3967_c1
1020 nmdc:mga04h51_3371_c1
1021 nmdc:mga07m45_73776_c1
1022 nmdc:mga05p37_283857_c1
1023 nmdc:mga05p37_293898_c1
1024 nmdc:mga0qj67_11268_c1
1025 nmdc:mga06r32_1544_c1
1026 nmdc:mga06r32_54093_c1
1027 nmdc:mga06r32_6262_c1
1028 nmdc:mga06r32_703669_c1
1029 nmdc:mga06r32_96895_c1
1030 nmdc:mga08y16_103807_c1
1031 nmdc:mga08y16_300232_c1
1032 nmdc:mga08x19_126659_c1
1033 nmdc:mga08x19_24_c1
1034 Ga0495601_0002897
1035 Ga0495601_0098944
1036 Ga0495601_0144512
1037 Ga0495601_0194605
1038 Ga0495612_0003210
1039 Ga0495595_0002677
1040 Ga0495619_0002304
1041 Ga0495619_0190775
1042 Ga0500566_0000003
1043 Ga0500640_000016
1044 Ga0500555_064842
1045 Ga0500572_000125
1046 Ga0500591_030900
1047 Ga0500595_001762
1048 Ga0500595_003974
1049 Ga0500608_011166
1050 Ga0500614_000470
1051 Ga0500559_0002825
1052 Ga0500590_169526
1053 Ga0500603_000029
1054 Ga0500630_000051
1055 Ga0500638_001699
1056 Ga0500639_000042
1057 Ga0500576_073534
1058 Ga0500645_035723
1059 Ga0501084_0079085
1060 Ga0501084_0086082
1061 Ga0501084_0512983
1062 Ga0500661_033148
1063 Ga0501082_0062227
1064 Ga0501082_0141801
1065 Ga0501082_0231202
1066 Ga0530510_0023035
1067 Ga0530510_0126922
1068 Ga0530510_0360538

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05050

Methyltransf_21

Methyltransferase FkbM domain

92

276

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vbf-assembly1.cif.gz_B crystal structure of protein l-isoaspartate o-methyltransferase homologue from sulfolobus tokodaii 0.8683 36 91
1g60-assembly1.cif.gz_B crystal structure of methyltransferase mboiia (moraxella bovis) 0.865 25 82
5hek-assembly2.cif.gz_A crystal structure of m1.hpyavi 0.8596 25 78
5hek-assembly2.cif.gz_C crystal structure of m1.hpyavi 0.8585 25 79
5hfj-assembly1.cif.gz_A crystal structure of m1.hpyavi-sam complex 0.8508 25 78
ID Description Score Start End Superfamily
af_A0A1D6FP61_65_209_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9014 38 82 3.40.50.150
af_P25087_39_327_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8914 25 88 3.40.50.150
af_O74198_45_292_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.89 25 88 3.40.50.150
af_K7MAL3_1_105_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8843 40 88 3.40.50.150
af_P71785_5_106_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8819 38 91 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A537N620-F1-model_v4 Glucans biosynthesis glucosyltransferase H 0.9965 1 247 GO:0005886
GO:0016758
AF-A0A0U5I8B8-F1-model_v4 Methyltransferase FkbM family 0.9958 93 247 GO:0008168
GO:0032259
AF-A0A363TI89-F1-model_v4 FkbM family methyltransferase 0.9926 29 246 GO:0008168
GO:0032259
AF-A0A537N620-F1-model_v4 Glucans biosynthesis glucosyltransferase H 0.9925 1 247 GO:0005886
GO:0016758
AF-A0A4Q7UHM5-F1-model_v4 FkbM family methyltransferase 0.9918 11 245 GO:0008168
GO:0032259

Map