F460536

General Info

Members Datasets Scaffolds Average Seq Length
534 231 1068 134

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_11800525|Ga0105242_118005251
Length 162
Sequence MAWRDVQVISTGINLQQFRINSELDFGEALMNGKLITCLVVCLSYIATAMPAFGHHAFTAVFDEKKPLKMTGTVTKVEWQNPHTWFYVDVKDGSGKVTNWAFEMASPNLLIRNGWTRSSLKIGDVVTVDAFGSKDGSNNANARVVILASTGKSLFAGSSSGR

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
150 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
151 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
152 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
153 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
154 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
155 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
156 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
157 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
160 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
163 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
164 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
165 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
166 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
167 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
168 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
169 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
170 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
171 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
172 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
173 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
174 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
175 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
176 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
177 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
178 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
179 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
180 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
181 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
182 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
183 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
184 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
185 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
186 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
187 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
195 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
196 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
197 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
206 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
207 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
208 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
209 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
210 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
211 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
212 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
215 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
219 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
223 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
224 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
225 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
226 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
227 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
228 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
229 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
231 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.5
Metatranscriptomes 1.5
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3
Rhizosphere 97
Stem 0
Stem Tuber 0
Unclassified 34.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_11800525 3300009176 Unclassified 651
2 Ga0058863_11977491 3300004799 Unclassified 1971
3 Ga0058861_10658042 3300004800 Unclassified 758
4 Ga0058861_11893714 3300004800 Bacteria 1712
5 Ga0058861_12066362 3300004800 Bacteria 1182
6 Ga0058862_12450620 3300004803 Unclassified 1017
7 Ga0058862_12488952 3300004803 Bacteria 1940
8 Ga0058862_12846190 3300004803 Bacteria 2047
9 Ga0065712_10145997 3300005290 Bacteria 1408
10 Ga0065712_10316805 3300005290 Bacteria 835
11 Ga0065707_10270615 3300005295 Unclassified 1072
12 Ga0065707_10464090 3300005295 Unclassified 782
13 Ga0070676_10062675 3300005328 Unclassified 2213
14 Ga0070683_100042966 3300005329 Bacteria 4164
15 Ga0070683_100075145 3300005329 Unclassified 3157
16 Ga0070690_100000820 3300005330 Bacteria 15769
17 Ga0070690_100028750 3300005330 Bacteria 3445
18 Ga0070690_100821678 3300005330 Unclassified 722
19 Ga0070690_100986374 3300005330 Bacteria 663
20 Ga0070670_100011107 3300005331 Bacteria 7694
21 Ga0070670_100011411 3300005331 Bacteria 7598
22 Ga0070670_100021627 3300005331 Bacteria 5531
23 Ga0070670_100162215 3300005331 Bacteria 1937
24 Ga0070670_100395017 3300005331 Bacteria 1220
25 Ga0070670_101983545 3300005331 Unclassified 536
26 Ga0068869_100273517 3300005334 Unclassified 1356
27 Ga0068869_100656338 3300005334 Bacteria 891
28 Ga0068869_100741641 3300005334 Unclassified 840
29 Ga0070666_10005000 3300005335 Bacteria 8110
30 Ga0070666_10006577 3300005335 Bacteria 7142
31 Ga0070666_10006969 3300005335 Bacteria 6968
32 Ga0070680_100958894 3300005336 Bacteria 738
33 Ga0070682_100016883 3300005337 Unclassified 4248
34 Ga0068868_100005627 3300005338 Bacteria 8816
35 Ga0068868_100032292 3300005338 Bacteria 4027
36 Ga0068868_100373712 3300005338 Unclassified 1225
37 Ga0068868_100539984 3300005338 Bacteria 1026
38 Ga0068868_101248999 3300005338 Unclassified 688
39 Ga0068868_101264315 3300005338 Unclassified 684
40 Ga0070689_100057893 3300005340 Unclassified 3009
41 Ga0070689_100067827 3300005340 Unclassified 2782
42 Ga0070689_100428200 3300005340 Bacteria 1123
43 Ga0070689_100707490 3300005340 Unclassified 880
44 Ga0070687_100081248 3300005343 Bacteria 1769
45 Ga0070687_100195297 3300005343 Bacteria 1222
46 Ga0070661_100006147 3300005344 Bacteria 8272
47 Ga0070661_100129671 3300005344 Unclassified 1893
48 Ga0070661_100357980 3300005344 Bacteria 1146
49 Ga0070661_100689694 3300005344 Unclassified 831
50 Ga0070661_101079796 3300005344 Bacteria 668
51 Ga0070692_10645346 3300005345 Unclassified 706
52 Ga0070668_100709123 3300005347 Bacteria 888
53 Ga0070668_100810349 3300005347 Unclassified 832
54 Ga0070669_100094553 3300005353 Unclassified 2246
55 Ga0070669_100262311 3300005353 Unclassified 1379
56 Ga0070675_100000795 3300005354 Bacteria 22144
57 Ga0070675_100167274 3300005354 Bacteria 1894
58 Ga0070675_100234412 3300005354 Unclassified 1602
59 Ga0070675_100550854 3300005354 Bacteria 1043
60 Ga0070675_100666771 3300005354 Unclassified 946
61 Ga0070675_101402998 3300005354 Bacteria 644
62 Ga0070671_100001590 3300005355 Bacteria 17082
63 Ga0070671_100010823 3300005355 Bacteria 7320
64 Ga0070671_100026326 3300005355 Bacteria 4779
65 Ga0070671_100039643 3300005355 Bacteria 3910
66 Ga0070671_101692563 3300005355 Unclassified 561
67 Ga0070673_100001700 3300005364 Bacteria 13068
68 Ga0070673_100025071 3300005364 Bacteria 4383
69 Ga0070673_100031485 3300005364 Bacteria 3981
70 Ga0070673_100040449 3300005364 Bacteria 3577
71 Ga0070673_100100892 3300005364 Bacteria 2377
72 Ga0070673_101341864 3300005364 Unclassified 672
73 Ga0070688_100053640 3300005365 Unclassified 2523
74 Ga0070688_100092412 3300005365 Unclassified 1979
75 Ga0070688_100687542 3300005365 Bacteria 791
76 Ga0070667_100008499 3300005367 Bacteria 8511
77 Ga0070667_100013080 3300005367 Bacteria 6858
78 Ga0070667_100019984 3300005367 Bacteria 5559
79 Ga0070667_100028469 3300005367 Bacteria 4652
80 Ga0070709_11158472 3300005434 Unclassified 620
81 Ga0070701_10055157 3300005438 Bacteria 2075
82 Ga0070711_100437644 3300005439 Unclassified 1068
83 Ga0070711_100961476 3300005439 Bacteria 731
84 Ga0070705_101417970 3300005440 Unclassified 579
85 Ga0070694_100069668 3300005444 Archaea 2420
86 Ga0070694_100116639 3300005444 Bacteria 1910
87 Ga0070694_100497908 3300005444 Unclassified 969
88 Ga0070708_100523871 3300005445 Bacteria 1118
89 Ga0070708_100641635 3300005445 Bacteria 1001
90 Ga0070708_101001102 3300005445 Bacteria 784
91 Ga0070678_100739525 3300005456 Bacteria 889
92 Ga0070678_101551674 3300005456 Bacteria 621
93 Ga0070678_101950279 3300005456 Unclassified 555
94 Ga0070662_100124121 3300005457 Unclassified 1982
95 Ga0070681_10320702 3300005458 Bacteria 1459
96 Ga0070681_10621600 3300005458 Unclassified 995
97 Ga0068867_100127022 3300005459 Unclassified 1977
98 Ga0068867_100190413 3300005459 Unclassified 1636
99 Ga0068867_100415513 3300005459 Bacteria 1138
100 Ga0068867_100782931 3300005459 Bacteria 849
101 Ga0068867_101094735 3300005459 Unclassified 727
102 Ga0068867_101112225 3300005459 Unclassified 722
103 Ga0068867_101203918 3300005459 Bacteria 696
104 Ga0070685_10073515 3300005466 Bacteria 2032
105 Ga0070685_10245163 3300005466 Unclassified 1184
106 Ga0070706_100212180 3300005467 Bacteria 1808
107 Ga0070707_100217286 3300005468 Bacteria 1863
108 Ga0070699_100277140 3300005518 Unclassified 1502
109 Ga0070699_100940505 3300005518 Unclassified 792
110 Ga0070679_100231560 3300005530 Bacteria 1807
111 Ga0070679_101030386 3300005530 Unclassified 767
112 Ga0070684_100152416 3300005535 Unclassified 2094
113 Ga0070684_100300498 3300005535 Bacteria 1473
114 Ga0070684_100358284 3300005535 Bacteria 1342
115 Ga0070697_101326615 3300005536 Unclassified 642
116 Ga0068853_101155038 3300005539 Unclassified 747
117 Ga0070672_100001216 3300005543 Bacteria 15792
118 Ga0070672_100005375 3300005543 Bacteria 8487
119 Ga0070672_100012656 3300005543 Bacteria 5935
120 Ga0070686_100007412 3300005544 Bacteria 6121
121 Ga0070686_100049606 3300005544 Bacteria 2664
122 Ga0070695_100046726 3300005545 Unclassified 2763
123 Ga0070696_101714418 3300005546 Unclassified 542
124 Ga0070665_100077122 3300005548 Bacteria 3339
125 Ga0070665_100379711 3300005548 Bacteria 1420
126 Ga0070704_100431590 3300005549 Bacteria 1130
127 Ga0068855_100203985 3300005563 Bacteria 2225
128 Ga0070664_100004065 3300005564 Bacteria 11754
129 Ga0070664_100005088 3300005564 Bacteria 10546
130 Ga0070664_100010835 3300005564 Bacteria 7396
131 Ga0070664_100026771 3300005564 Bacteria 4787
132 Ga0070664_100098229 3300005564 Bacteria 2543
133 Ga0070664_100163586 3300005564 Unclassified 1970
134 Ga0068857_100353589 3300005577 Bacteria 1361
135 Ga0068856_100826117 3300005614 Bacteria 946
136 Ga0070702_100034399 3300005615 Unclassified 2793
137 Ga0070702_100049717 3300005615 Unclassified 2392
138 Ga0070702_100234525 3300005615 Unclassified 1235
139 Ga0068852_100242254 3300005616 Bacteria 1724
140 Ga0068859_100024731 3300005617 Bacteria 6027
141 Ga0068859_100192278 3300005617 Bacteria 2125
142 Ga0068859_100682007 3300005617 Bacteria 1119
143 Ga0068859_100838046 3300005617 Unclassified 1006
144 Ga0068864_100008312 3300005618 Bacteria 8560
145 Ga0068864_100012230 3300005618 Bacteria 7093
146 Ga0068864_100013355 3300005618 Bacteria 6805
147 Ga0068864_100213763 3300005618 Unclassified 1777
148 Ga0068864_101553133 3300005618 Bacteria 665
149 Ga0068851_10110853 3300005834 Bacteria 1465
150 Ga0068863_100000917 3300005841 Bacteria 29600
151 Ga0068863_100013933 3300005841 Bacteria 7751
152 Ga0068863_100034843 3300005841 Bacteria 4794
153 Ga0068863_100080904 3300005841 Unclassified 3077
154 Ga0068863_100146461 3300005841 Unclassified 2259
155 Ga0068863_101034511 3300005841 Bacteria 825
156 Ga0068863_101481943 3300005841 Bacteria 687
157 Ga0068858_100032307 3300005842 Bacteria 4862
158 Ga0068858_100038996 3300005842 Bacteria 4406
159 Ga0068858_100123016 3300005842 Unclassified 2428
160 Ga0068858_100198615 3300005842 Bacteria 1896
161 Ga0068858_100237483 3300005842 Bacteria 1729
162 Ga0068858_100328549 3300005842 Unclassified 1462
163 Ga0068858_100788311 3300005842 Unclassified 927
164 Ga0068858_101447272 3300005842 Bacteria 677
165 Ga0068860_100012216 3300005843 Bacteria 8462
166 Ga0068860_100109215 3300005843 Unclassified 2644
167 Ga0068860_100255360 3300005843 Bacteria 1708
168 Ga0068860_100293640 3300005843 Bacteria 1591
169 Ga0068862_100052001 3300005844 Bacteria 3504
170 Ga0068862_100368755 3300005844 Unclassified 1336
171 Ga0068862_100537788 3300005844 Unclassified 1114
172 Ga0068862_101454360 3300005844 Unclassified 690
173 Ga0070715_10288351 3300006163 Bacteria 873
174 Ga0097621_100010602 3300006237 Bacteria 6752
175 Ga0097621_100014517 3300006237 Bacteria 5897
176 Ga0097621_100214834 3300006237 Unclassified 1674
177 Ga0097621_100353145 3300006237 Bacteria 1308
178 Ga0068871_100002473 3300006358 Bacteria 12608
179 Ga0068871_100046344 3300006358 Bacteria 3501
180 Ga0068871_100160427 3300006358 Bacteria 1923
181 Ga0068871_101053985 3300006358 Bacteria 759
182 Ga0075428_100012929 3300006844 Bacteria 9285
183 Ga0075428_100111752 3300006844 Bacteria 2976
184 Ga0075428_102420091 3300006844 Viruses 539
185 Ga0075430_100225133 3300006846 Unclassified 1556
186 Ga0075431_100203134 3300006847 Bacteria 2027
187 Ga0075433_10032177 3300006852 Bacteria 4491
188 Ga0075434_100010254 3300006871 Bacteria 8778
189 Ga0075434_100373056 3300006871 Bacteria 1448
190 Ga0075434_101673066 3300006871 Unclassified 644
191 Ga0075434_101774839 3300006871 Unclassified 624
192 Ga0075429_100064751 3300006880 Bacteria 3183
193 Ga0075429_100222759 3300006880 Bacteria 1652
194 Ga0068865_100121177 3300006881 Bacteria 1945
195 Ga0075436_100106550 3300006914 Unclassified 1955
196 Ga0097620_100024732 3300006931 Bacteria 6027
197 Ga0097620_100192266 3300006931 Bacteria 2125
198 Ga0097620_100682095 3300006931 Bacteria 1119
199 Ga0097620_100837774 3300006931 Unclassified 1006
200 Ga0075435_100008548 3300007076 Bacteria 7357
201 Ga0075435_100017142 3300007076 Bacteria 5475
202 Ga0075435_100296541 3300007076 Bacteria 1382
203 Ga0075435_100333976 3300007076 Unclassified 1298
204 Ga0105240_10189711 3300009093 Unclassified 2418
205 Ga0111539_10010514 3300009094 Bacteria 11648
206 Ga0111539_10018256 3300009094 Bacteria 8688
207 Ga0111539_10125747 3300009094 Unclassified 3004
208 Ga0111539_10501523 3300009094 Bacteria 1414
209 Ga0111539_10638708 3300009094 Bacteria 1239
210 Ga0105245_10203772 3300009098 Bacteria 1901
211 Ga0105245_10313551 3300009098 Bacteria 1543
212 Ga0105245_10653965 3300009098 Bacteria 1081
213 Ga0105245_11390909 3300009098 Unclassified 752
214 Ga0105245_11503659 3300009098 Unclassified 724
215 Ga0105247_10002862 3300009101 Bacteria 11506
216 Ga0105247_10044229 3300009101 Bacteria 2730
217 Ga0105247_10052296 3300009101 Unclassified 2518
218 Ga0105247_10308686 3300009101 Bacteria 1100
219 Ga0114129_10009942 3300009147 Bacteria 13559
220 Ga0114129_10016107 3300009147 Bacteria 10635
221 Ga0114129_10077230 3300009147 Bacteria 4633
222 Ga0114129_10130391 3300009147 Unclassified 3453
223 Ga0114129_10840827 3300009147 Bacteria 1168
224 Ga0105243_10545976 3300009148 Unclassified 1106
225 Ga0105241_10675903 3300009174 Bacteria 940
226 Ga0105241_11572318 3300009174 Bacteria 635
227 Ga0105242_10603648 3300009176 Bacteria 1060
228 Ga0105242_11222692 3300009176 Unclassified 771
229 Ga0105242_12187546 3300009176 Unclassified 598
230 Ga0105242_12334164 3300009176 Bacteria 582
231 Ga0105248_10001192 3300009177 Bacteria 29043
232 Ga0105248_10035226 3300009177 Bacteria 5599
233 Ga0105248_10035394 3300009177 Bacteria 5586
234 Ga0105248_10052442 3300009177 Unclassified 4577
235 Ga0105248_10193945 3300009177 Bacteria 2289
236 Ga0105248_10404603 3300009177 Bacteria 1537
237 Ga0105248_10803200 3300009177 Unclassified 1062
238 Ga0105248_10910796 3300009177 Unclassified 993
239 Ga0105248_11321350 3300009177 Bacteria 816
240 Ga0105238_10011435 3300009551 Bacteria 8940
241 Ga0105249_10539769 3300009553 Bacteria 1216
242 Ga0105249_10579176 3300009553 Bacteria 1175
243 Ga0105249_11105371 3300009553 Bacteria 863
244 Ga0105249_12584762 3300009553 Bacteria 580
245 Ga0105239_10044232 3300010375 Bacteria 4882
246 Ga0105246_10112295 3300011119 Unclassified 2004
247 Ga0105246_10578486 3300011119 Unclassified 967
248 Ga0105246_11067999 3300011119 Unclassified 735
249 Ga0157374_10075553 3300013296 Bacteria 3183
250 Ga0157374_10105930 3300013296 Unclassified 2701
251 Ga0157378_10112973 3300013297 Unclassified 2493
252 Ga0157378_10695164 3300013297 Unclassified 1036
253 Ga0157378_10858957 3300013297 Bacteria 936
254 Ga0157378_10881089 3300013297 Bacteria 925
255 Ga0163162_10002322 3300013306 Bacteria 17849
256 Ga0163162_10008793 3300013306 Bacteria 9820
257 Ga0163162_10059882 3300013306 Bacteria 3841
258 Ga0163162_11325614 3300013306 Unclassified 818
259 Ga0163162_11864350 3300013306 Bacteria 688
260 Ga0157375_10000291 3300013308 Bacteria 45416
261 Ga0157375_10078207 3300013308 Bacteria 3340
262 Ga0157375_10404109 3300013308 Unclassified 1532
263 Ga0157375_10896147 3300013308 Bacteria 1031
264 Ga0157375_10919367 3300013308 Bacteria 1018
265 Ga0157375_13217108 3300013308 Unclassified 545
266 Ga0163163_10001141 3300014325 Bacteria 22608
267 Ga0163163_10001210 3300014325 Bacteria 21828
268 Ga0163163_10010912 3300014325 Bacteria 8206
269 Ga0163163_10011285 3300014325 Bacteria 8097
270 Ga0163163_10196416 3300014325 Bacteria 2065
271 Ga0157380_10345330 3300014326 Bacteria 1390
272 Ga0157377_10012810 3300014745 Bacteria 4228
273 Ga0157377_10377197 3300014745 Unclassified 959
274 Ga0157379_10000121 3300014968 Bacteria 54416
275 Ga0157379_10003915 3300014968 Bacteria 12693
276 Ga0157379_10008534 3300014968 Bacteria 8915
277 Ga0157379_10658457 3300014968 Bacteria 981
278 Ga0157379_10869800 3300014968 Bacteria 854
279 Ga0157376_10026897 3300014969 Bacteria 4553
280 Ga0157376_10036904 3300014969 Unclassified 3962
281 Ga0157376_10039475 3300014969 Bacteria 3851
282 Ga0157376_10474824 3300014969 Bacteria 1224
283 Ga0157376_12699740 3300014969 Unclassified 536
284 Ga0163161_10037853 3300017792 Unclassified 3458
285 Ga0207656_10086345 3300025321 Bacteria 1418
286 Ga0207653_10221969 3300025885 Bacteria 718
287 Ga0207710_10072351 3300025900 Unclassified 1583
288 Ga0207710_10091360 3300025900 Bacteria 1425
289 Ga0207710_10099776 3300025900 Unclassified 1368
290 Ga0207680_10003226 3300025903 Bacteria 7675
291 Ga0207680_10024315 3300025903 Unclassified 3323
292 Ga0207680_10041324 3300025903 Bacteria 2689
293 Ga0207699_10944560 3300025906 Unclassified 637
294 Ga0207645_10173795 3300025907 Bacteria 1412
295 Ga0207645_10243172 3300025907 Bacteria 1189
296 Ga0207707_10416572 3300025912 Bacteria 1152
297 Ga0207707_10660770 3300025912 Bacteria 880
298 Ga0207663_10811335 3300025916 Bacteria 746
299 Ga0207663_11047586 3300025916 Bacteria 655
300 Ga0207660_10481780 3300025917 Unclassified 1005
301 Ga0207662_10262244 3300025918 Bacteria 1138
302 Ga0207649_10032852 3300025920 Bacteria 3096
303 Ga0207649_10102126 3300025920 Unclassified 1900
304 Ga0207649_10399216 3300025920 Unclassified 1028
305 Ga0207652_10513884 3300025921 Unclassified 1078
306 Ga0207652_10674080 3300025921 Unclassified 924
307 Ga0207646_10611113 3300025922 Bacteria 978
308 Ga0207681_10112180 3300025923 Unclassified 1985
309 Ga0207694_10031192 3300025924 Bacteria 4070
310 Ga0207650_10003387 3300025925 Bacteria 10967
311 Ga0207650_11686620 3300025925 Unclassified 537
312 Ga0207659_10001460 3300025926 Bacteria 14106
313 Ga0207659_10041627 3300025926 Bacteria 3218
314 Ga0207659_10249869 3300025926 Unclassified 1439
315 Ga0207659_11192001 3300025926 Bacteria 655
316 Ga0207687_10134252 3300025927 Bacteria 1870
317 Ga0207687_10152170 3300025927 Bacteria 1766
318 Ga0207687_11533291 3300025927 Unclassified 572
319 Ga0207644_10006230 3300025931 Bacteria 7777
320 Ga0207644_10018319 3300025931 Bacteria 4735
321 Ga0207644_10813697 3300025931 Unclassified 781
322 Ga0207686_10134086 3300025934 Unclassified 1703
323 Ga0207670_10066857 3300025936 Bacteria 2471
324 Ga0207670_10596312 3300025936 Bacteria 907
325 Ga0207691_10002174 3300025940 Bacteria 19173
326 Ga0207691_10009685 3300025940 Bacteria 9242
327 Ga0207711_10000188 3300025941 Bacteria 65983
328 Ga0207711_10020097 3300025941 Bacteria 5565
329 Ga0207711_10050144 3300025941 Unclassified 3573
330 Ga0207711_10354768 3300025941 Unclassified 1358
331 Ga0207711_10379179 3300025941 Unclassified 1312
332 Ga0207711_10917854 3300025941 Bacteria 814
333 Ga0207711_11434584 3300025941 Unclassified 633
334 Ga0207689_10206402 3300025942 Unclassified 1623
335 Ga0207689_10642929 3300025942 Unclassified 893
336 Ga0207661_10181316 3300025944 Bacteria 1840
337 Ga0207661_10682535 3300025944 Unclassified 944
338 Ga0207661_11012840 3300025944 Bacteria 765
339 Ga0207679_10003529 3300025945 Bacteria 9682
340 Ga0207679_10011861 3300025945 Bacteria 5664
341 Ga0207679_10037764 3300025945 Unclassified 3436
342 Ga0207679_10564942 3300025945 Bacteria 1022
343 Ga0207667_10226748 3300025949 Unclassified 1914
344 Ga0207651_10000899 3300025960 Bacteria 13069
345 Ga0207651_10037506 3300025960 Bacteria 3176
346 Ga0207651_10577442 3300025960 Unclassified 980
347 Ga0207651_11125921 3300025960 Unclassified 704
348 Ga0207712_10213846 3300025961 Bacteria 1537
349 Ga0207668_10611786 3300025972 Bacteria 950
350 Ga0207658_10009275 3300025986 Bacteria 6674
351 Ga0207658_10046606 3300025986 Bacteria 3167
352 Ga0207658_10079575 3300025986 Bacteria 2507
353 Ga0207658_10165833 3300025986 Unclassified 1814
354 Ga0207677_10008423 3300026023 Bacteria 5756
355 Ga0207677_10020720 3300026023 Bacteria 3999
356 Ga0207677_10084787 3300026023 Bacteria 2285
357 Ga0207677_12143160 3300026023 Unclassified 520
358 Ga0207703_10009631 3300026035 Bacteria 7583
359 Ga0207703_10072119 3300026035 Bacteria 2854
360 Ga0207703_10153739 3300026035 Unclassified 2009
361 Ga0207703_10199839 3300026035 Bacteria 1776
362 Ga0207703_11576574 3300026035 Bacteria 632
363 Ga0207703_11833590 3300026035 Bacteria 583
364 Ga0207703_12392792 3300026035 Unclassified 504
365 Ga0207639_11018839 3300026041 Unclassified 776
366 Ga0207708_10005499 3300026075 Bacteria 9353
367 Ga0207641_10004377 3300026088 Bacteria 12242
368 Ga0207641_10013748 3300026088 Bacteria 6638
369 Ga0207641_10013863 3300026088 Bacteria 6612
370 Ga0207641_10037587 3300026088 Unclassified 4044
371 Ga0207648_10321481 3300026089 Bacteria 1391
372 Ga0207648_10328570 3300026089 Bacteria 1375
373 Ga0207648_10378864 3300026089 Unclassified 1279
374 Ga0207648_11102545 3300026089 Unclassified 744
375 Ga0207676_10061417 3300026095 Bacteria 2975
376 Ga0207676_10078123 3300026095 Unclassified 2679
377 Ga0207676_10188951 3300026095 Bacteria 1811
378 Ga0207676_11413186 3300026095 Bacteria 692
379 Ga0207674_10433275 3300026116 Bacteria 1271
380 Ga0207675_100034808 3300026118 Bacteria 4697
381 Ga0207675_100165315 3300026118 Bacteria 2113
382 Ga0207675_102271826 3300026118 Bacteria 557
383 Ga0207683_10918590 3300026121 Unclassified 813
384 Ga0207698_10221726 3300026142 Bacteria 1709
385 Ga0209983_1104313 3300027665 Viruses 643
386 Ga0209971_1077647 3300027682 Bacteria 808
387 Ga0207428_10005507 3300027907 Bacteria 11796
388 Ga0207428_10500575 3300027907 Unclassified 882
389 Ga0268266_10396365 3300028379 Bacteria 1304
390 Ga0268266_10725672 3300028379 Bacteria 958
391 Ga0268266_11523042 3300028379 Bacteria 644
392 Ga0268265_10692918 3300028380 Unclassified 983
393 Ga0268265_11091895 3300028380 Bacteria 792
394 Ga0268265_12010158 3300028380 Bacteria 585
395 Ga0268264_10010529 3300028381 Bacteria 7647
396 Ga0307409_100210849 3300031995 Bacteria 1746
397 Ga0307411_10620925 3300032005 Bacteria 932
398 Ga0373938_0124641 3300034957 Unclassified 667
399 Ga0373928_0051050 3300035084 Unclassified 977
400 Ga0373934_0260089 3300035086 Bacteria 718
401 Ga0373949_0080365 3300035090 Unclassified 868
402 Ga0373953_0072898 3300035117 Bacteria 1419
403 Ga0373956_0164431 3300035119 Bacteria 1046
404 Ga0373955_0106443 3300035172 Unclassified 1617
405 Ga0373955_0331696 3300035172 Bacteria 920
406 Ga0373955_0559332 3300035172 Bacteria 700
407 Ga0373955_0630340 3300035172 Unclassified 657
408 Ga0373927_0824990 3300035695 Unclassified 612
409 Ga0373933_0651302 3300035724 Unclassified 692
410 Ga0373937_0005432 3300036401 Bacteria 10909
411 Ga0373937_0035441 3300036401 Bacteria 4542
412 Ga0373937_0205765 3300036401 Bacteria 1851
413 Ga0373937_0840482 3300036401 Unclassified 866
414 Ga0373937_1373413 3300036401 Unclassified 654
415 Ga0373937_1920003 3300036401 Bacteria 538
416 Ga0436362_0002013 3300039453 Bacteria 1504
417 Ga0453683_0587074 3300044673 Bacteria 726
418 Ga0451576_2041386 3300045051 Unclassified 590
419 Ga0495592_0029266 3300046454 Bacteria 4171
420 Ga0495603_0453941 3300046455 Unclassified 734
421 Ga0495629_0063386 3300046459 Bacteria 2582
422 Ga0495629_0112023 3300046459 Unclassified 1902
423 Ga0495629_0261773 3300046459 Unclassified 1189
424 Ga0495582_0578062 3300046473 Bacteria 650
425 Ga0495662_0025425 3300046476 Bacteria 2859
426 Ga0495662_0069015 3300046476 Unclassified 1712
427 Ga0495594_0148160 3300046499 Unclassified 1332
428 Ga0495608_0019196 3300046511 Unclassified 4708
429 Ga0495618_0053767 3300046514 Bacteria 2546
430 Ga0495618_0083401 3300046514 Bacteria 2042
431 Ga0495618_0321445 3300046514 Unclassified 958
432 Ga0495628_0706070 3300046516 Unclassified 712
433 Ga0495630_0247844 3300046517 Bacteria 1361
434 Ga0495652_0486549 3300046529 Unclassified 858
435 Ga0495652_0900236 3300046529 Unclassified 584
436 Ga0495640_0065128 3300046533 Bacteria 2462
437 Ga0495586_0073700 3300046535 Bacteria 1868
438 Ga0495586_0109217 3300046535 Unclassified 1539
439 Ga0495667_0000530 3300046559 Bacteria 24443
440 Ga0495634_0038930 3300046642 Bacteria 3240
441 Ga0495634_0319665 3300046642 Bacteria 935
442 Ga0495634_0327637 3300046642 Unclassified 921
443 Ga0495657_0002087 3300046675 Bacteria 16983
444 Ga0495599_0133187 3300046678 Bacteria 1543
445 Ga0495647_0036040 3300046681 Bacteria 1861
446 Ga0495647_0447959 3300046681 Bacteria 597
447 Ga0495658_0252919 3300046683 Bacteria 1108
448 Ga0495658_0651485 3300046683 Unclassified 675
449 Ga0495658_0817426 3300046683 Unclassified 596
450 Ga0495613_0019352 3300046689 Bacteria 5075
451 Ga0495613_0046854 3300046689 Unclassified 3195
452 Ga0495613_0057791 3300046689 Bacteria 2848
453 Ga0495613_0177684 3300046689 Bacteria 1508
454 Ga0495600_0822896 3300046809 Unclassified 552
455 Ga0495674_0006768 3300047319 Bacteria 10974
456 Ga0495676_0666213 3300047321 Unclassified 675
457 Ga0495684_0172744 3300047471 Bacteria 1606
458 Ga0495684_0390311 3300047471 Bacteria 980
459 Ga0495684_0854924 3300047471 Unclassified 590
460 Ga0495614_0288338 3300048089 Unclassified 757
461 Ga0496101_0190201 3300048904 Bacteria 1584
462 Ga0496102_0574340 3300048905 Unclassified 1050
463 Ga0496104_0170198 3300048907 Bacteria 2089
464 Ga0496104_1540021 3300048907 Unclassified 568
465 Ga0496106_0213399 3300048909 Bacteria 1538
466 Ga0496107_0800110 3300048910 Bacteria 690
467 Ga0496108_0378871 3300048911 Bacteria 1235
468 Ga0496108_0604917 3300048911 Bacteria 955
469 Ga0496108_1372356 3300048911 Bacteria 592
470 Ga0496112_0011951 3300048915 Bacteria 7956
471 Ga0496113_0018375 3300048916 Bacteria 4868
472 Ga0496113_1338032 3300048916 Unclassified 556
473 Ga0496114_0018504 3300048917 Bacteria 5633
474 Ga0496114_0904164 3300048917 Bacteria 764
475 Ga0496114_1327441 3300048917 Unclassified 606
476 Ga0496115_0105209 3300048918 Bacteria 2316
477 Ga0501036_0108090 3300049572 Bacteria 2352
478 Ga0501036_0831350 3300049572 Bacteria 760
479 Ga0501038_0050096 3300049574 Bacteria 3610
480 Ga0501039_0279491 3300049575 Bacteria 1312
481 Ga0501039_0307043 3300049575 Bacteria 1247
482 Ga0501040_0002766 3300049576 Bacteria 11298
483 Ga0501041_0227627 3300049577 Bacteria 1170
484 Ga0501042_0946323 3300049578 Bacteria 628
485 Ga0501046_0018606 3300049580 Bacteria 5776
486 Ga0501046_0341254 3300049580 Unclassified 1089
487 Ga0501048_0185170 3300049582 Unclassified 1476
488 Ga0501048_0844463 3300049582 Bacteria 658
489 Ga0501068_0149429 3300049584 Bacteria 1468
490 Ga0501071_0171647 3300049587 Unclassified 1623
491 Ga0501072_0020052 3300049588 Bacteria 5177
492 Ga0501074_0025178 3300049590 Bacteria 4323
493 Ga0501075_0222586 3300049591 Bacteria 1439
494 Ga0501076_0000655 3300049592 Bacteria 22191
495 Ga0501077_0013373 3300049593 Bacteria 5146
496 Ga0501079_0349722 3300049741 Unclassified 1158
497 Ga0501079_0389068 3300049741 Bacteria 1093
498 Ga0501079_1160987 3300049741 Unclassified 608
499 Ga0501080_0629755 3300049742 Bacteria 950
500 Ga0501080_0895291 3300049742 Unclassified 774
501 Ga0501081_0004487 3300049743 Bacteria 8958
502 Ga0501035_0242113 3300049822 Bacteria 1534
503 Ga0501035_1413386 3300049822 Bacteria 533
504 Ga0501045_0003528 3300049824 Bacteria 10722
505 nmdc:mga05p37_1892748_c1 3300050507 Unclassified 570
506 nmdc:mga05p37_319553_c1 3300050507 Bacteria 1838
507 nmdc:mga05p37_374642_c1 3300050507 Bacteria 1670
508 nmdc:mga05p37_73422_c1 3300050507 Bacteria 4210
509 nmdc:mga09592_1509866_c1 3300050508 Unclassified 546
510 nmdc:mga09592_322141_c1 3300050508 Bacteria 1339
511 nmdc:mga06r32_115894_c1 3300050510 Bacteria 2639
512 nmdc:mga08y16_1495483_c1 3300050511 Bacteria 636
513 nmdc:mga08y16_2323_c1 3300050511 Bacteria 19488
514 nmdc:mga08y16_316932_c1 3300050511 Unclassified 1606
515 nmdc:mga0n895_200475_c1 3300050512 Bacteria 2027
516 nmdc:mga0n895_614121_c1 3300050512 Unclassified 1089
517 nmdc:mga0n895_777038_c1 3300050512 Unclassified 949
518 nmdc:mga0rr50_272401_c1 3300050513 Bacteria 1411
519 nmdc:mga0rr50_428277_c1 3300050513 Unclassified 1120
520 nmdc:mga0rr50_55321_c1 3300050513 Bacteria 2296
521 nmdc:mga08x19_80999_c1 3300050514 Bacteria 2131
522 nmdc:mga0a205_318386_c1 3300050515 Bacteria 1427
523 nmdc:mga0a205_717276_c1 3300050515 Unclassified 849
524 nmdc:mga0a205_74771_c1 3300050515 Bacteria 3273
525 Ga0495601_0006320 3300053077 Bacteria 6925
526 Ga0495601_0345102 3300053077 Bacteria 968
527 Ga0495619_0013570 3300053085 Bacteria 5134
528 Ga0495619_0746512 3300053085 Bacteria 664
529 Ga0501084_0030174 3300054114 Bacteria 4534
530 Ga0501084_1338540 3300054114 Unclassified 600
531 Ga0590071_087894 3300059421 Unclassified 776
532 Ga0587084_115700 3300059477 Unclassified 559
533 Ga0501082_0002178 3300060353 Bacteria 17189
534 Ga0530510_0009659 3300061734 Bacteria 6768
535 Ga0105242_11800525
536 Ga0058863_11977491
537 Ga0058861_10658042
538 Ga0058861_11893714
539 Ga0058861_12066362
540 Ga0058862_12450620
541 Ga0058862_12488952
542 Ga0058862_12846190
543 Ga0065712_10145997
544 Ga0065712_10316805
545 Ga0065707_10270615
546 Ga0065707_10464090
547 Ga0070676_10062675
548 Ga0070683_100042966
549 Ga0070683_100075145
550 Ga0070690_100000820
551 Ga0070690_100028750
552 Ga0070690_100821678
553 Ga0070690_100986374
554 Ga0070670_100011107
555 Ga0070670_100011411
556 Ga0070670_100021627
557 Ga0070670_100162215
558 Ga0070670_100395017
559 Ga0070670_101983545
560 Ga0068869_100273517
561 Ga0068869_100656338
562 Ga0068869_100741641
563 Ga0070666_10005000
564 Ga0070666_10006577
565 Ga0070666_10006969
566 Ga0070680_100958894
567 Ga0070682_100016883
568 Ga0068868_100005627
569 Ga0068868_100032292
570 Ga0068868_100373712
571 Ga0068868_100539984
572 Ga0068868_101248999
573 Ga0068868_101264315
574 Ga0070689_100057893
575 Ga0070689_100067827
576 Ga0070689_100428200
577 Ga0070689_100707490
578 Ga0070687_100081248
579 Ga0070687_100195297
580 Ga0070661_100006147
581 Ga0070661_100129671
582 Ga0070661_100357980
583 Ga0070661_100689694
584 Ga0070661_101079796
585 Ga0070692_10645346
586 Ga0070668_100709123
587 Ga0070668_100810349
588 Ga0070669_100094553
589 Ga0070669_100262311
590 Ga0070675_100000795
591 Ga0070675_100167274
592 Ga0070675_100234412
593 Ga0070675_100550854
594 Ga0070675_100666771
595 Ga0070675_101402998
596 Ga0070671_100001590
597 Ga0070671_100010823
598 Ga0070671_100026326
599 Ga0070671_100039643
600 Ga0070671_101692563
601 Ga0070673_100001700
602 Ga0070673_100025071
603 Ga0070673_100031485
604 Ga0070673_100040449
605 Ga0070673_100100892
606 Ga0070673_101341864
607 Ga0070688_100053640
608 Ga0070688_100092412
609 Ga0070688_100687542
610 Ga0070667_100008499
611 Ga0070667_100013080
612 Ga0070667_100019984
613 Ga0070667_100028469
614 Ga0070709_11158472
615 Ga0070701_10055157
616 Ga0070711_100437644
617 Ga0070711_100961476
618 Ga0070705_101417970
619 Ga0070694_100069668
620 Ga0070694_100116639
621 Ga0070694_100497908
622 Ga0070708_100523871
623 Ga0070708_100641635
624 Ga0070708_101001102
625 Ga0070678_100739525
626 Ga0070678_101551674
627 Ga0070678_101950279
628 Ga0070662_100124121
629 Ga0070681_10320702
630 Ga0070681_10621600
631 Ga0068867_100127022
632 Ga0068867_100190413
633 Ga0068867_100415513
634 Ga0068867_100782931
635 Ga0068867_101094735
636 Ga0068867_101112225
637 Ga0068867_101203918
638 Ga0070685_10073515
639 Ga0070685_10245163
640 Ga0070706_100212180
641 Ga0070707_100217286
642 Ga0070699_100277140
643 Ga0070699_100940505
644 Ga0070679_100231560
645 Ga0070679_101030386
646 Ga0070684_100152416
647 Ga0070684_100300498
648 Ga0070684_100358284
649 Ga0070697_101326615
650 Ga0068853_101155038
651 Ga0070672_100001216
652 Ga0070672_100005375
653 Ga0070672_100012656
654 Ga0070686_100007412
655 Ga0070686_100049606
656 Ga0070695_100046726
657 Ga0070696_101714418
658 Ga0070665_100077122
659 Ga0070665_100379711
660 Ga0070704_100431590
661 Ga0068855_100203985
662 Ga0070664_100004065
663 Ga0070664_100005088
664 Ga0070664_100010835
665 Ga0070664_100026771
666 Ga0070664_100098229
667 Ga0070664_100163586
668 Ga0068857_100353589
669 Ga0068856_100826117
670 Ga0070702_100034399
671 Ga0070702_100049717
672 Ga0070702_100234525
673 Ga0068852_100242254
674 Ga0068859_100024731
675 Ga0068859_100192278
676 Ga0068859_100682007
677 Ga0068859_100838046
678 Ga0068864_100008312
679 Ga0068864_100012230
680 Ga0068864_100013355
681 Ga0068864_100213763
682 Ga0068864_101553133
683 Ga0068851_10110853
684 Ga0068863_100000917
685 Ga0068863_100013933
686 Ga0068863_100034843
687 Ga0068863_100080904
688 Ga0068863_100146461
689 Ga0068863_101034511
690 Ga0068863_101481943
691 Ga0068858_100032307
692 Ga0068858_100038996
693 Ga0068858_100123016
694 Ga0068858_100198615
695 Ga0068858_100237483
696 Ga0068858_100328549
697 Ga0068858_100788311
698 Ga0068858_101447272
699 Ga0068860_100012216
700 Ga0068860_100109215
701 Ga0068860_100255360
702 Ga0068860_100293640
703 Ga0068862_100052001
704 Ga0068862_100368755
705 Ga0068862_100537788
706 Ga0068862_101454360
707 Ga0070715_10288351
708 Ga0097621_100010602
709 Ga0097621_100014517
710 Ga0097621_100214834
711 Ga0097621_100353145
712 Ga0068871_100002473
713 Ga0068871_100046344
714 Ga0068871_100160427
715 Ga0068871_101053985
716 Ga0075428_100012929
717 Ga0075428_100111752
718 Ga0075428_102420091
719 Ga0075430_100225133
720 Ga0075431_100203134
721 Ga0075433_10032177
722 Ga0075434_100010254
723 Ga0075434_100373056
724 Ga0075434_101673066
725 Ga0075434_101774839
726 Ga0075429_100064751
727 Ga0075429_100222759
728 Ga0068865_100121177
729 Ga0075436_100106550
730 Ga0097620_100024732
731 Ga0097620_100192266
732 Ga0097620_100682095
733 Ga0097620_100837774
734 Ga0075435_100008548
735 Ga0075435_100017142
736 Ga0075435_100296541
737 Ga0075435_100333976
738 Ga0105240_10189711
739 Ga0111539_10010514
740 Ga0111539_10018256
741 Ga0111539_10125747
742 Ga0111539_10501523
743 Ga0111539_10638708
744 Ga0105245_10203772
745 Ga0105245_10313551
746 Ga0105245_10653965
747 Ga0105245_11390909
748 Ga0105245_11503659
749 Ga0105247_10002862
750 Ga0105247_10044229
751 Ga0105247_10052296
752 Ga0105247_10308686
753 Ga0114129_10009942
754 Ga0114129_10016107
755 Ga0114129_10077230
756 Ga0114129_10130391
757 Ga0114129_10840827
758 Ga0105243_10545976
759 Ga0105241_10675903
760 Ga0105241_11572318
761 Ga0105242_10603648
762 Ga0105242_11222692
763 Ga0105242_12187546
764 Ga0105242_12334164
765 Ga0105248_10001192
766 Ga0105248_10035226
767 Ga0105248_10035394
768 Ga0105248_10052442
769 Ga0105248_10193945
770 Ga0105248_10404603
771 Ga0105248_10803200
772 Ga0105248_10910796
773 Ga0105248_11321350
774 Ga0105238_10011435
775 Ga0105249_10539769
776 Ga0105249_10579176
777 Ga0105249_11105371
778 Ga0105249_12584762
779 Ga0105239_10044232
780 Ga0105246_10112295
781 Ga0105246_10578486
782 Ga0105246_11067999
783 Ga0157374_10075553
784 Ga0157374_10105930
785 Ga0157378_10112973
786 Ga0157378_10695164
787 Ga0157378_10858957
788 Ga0157378_10881089
789 Ga0163162_10002322
790 Ga0163162_10008793
791 Ga0163162_10059882
792 Ga0163162_11325614
793 Ga0163162_11864350
794 Ga0157375_10000291
795 Ga0157375_10078207
796 Ga0157375_10404109
797 Ga0157375_10896147
798 Ga0157375_10919367
799 Ga0157375_13217108
800 Ga0163163_10001141
801 Ga0163163_10001210
802 Ga0163163_10010912
803 Ga0163163_10011285
804 Ga0163163_10196416
805 Ga0157380_10345330
806 Ga0157377_10012810
807 Ga0157377_10377197
808 Ga0157379_10000121
809 Ga0157379_10003915
810 Ga0157379_10008534
811 Ga0157379_10658457
812 Ga0157379_10869800
813 Ga0157376_10026897
814 Ga0157376_10036904
815 Ga0157376_10039475
816 Ga0157376_10474824
817 Ga0157376_12699740
818 Ga0163161_10037853
819 Ga0207656_10086345
820 Ga0207653_10221969
821 Ga0207710_10072351
822 Ga0207710_10091360
823 Ga0207710_10099776
824 Ga0207680_10003226
825 Ga0207680_10024315
826 Ga0207680_10041324
827 Ga0207699_10944560
828 Ga0207645_10173795
829 Ga0207645_10243172
830 Ga0207707_10416572
831 Ga0207707_10660770
832 Ga0207663_10811335
833 Ga0207663_11047586
834 Ga0207660_10481780
835 Ga0207662_10262244
836 Ga0207649_10032852
837 Ga0207649_10102126
838 Ga0207649_10399216
839 Ga0207652_10513884
840 Ga0207652_10674080
841 Ga0207646_10611113
842 Ga0207681_10112180
843 Ga0207694_10031192
844 Ga0207650_10003387
845 Ga0207650_11686620
846 Ga0207659_10001460
847 Ga0207659_10041627
848 Ga0207659_10249869
849 Ga0207659_11192001
850 Ga0207687_10134252
851 Ga0207687_10152170
852 Ga0207687_11533291
853 Ga0207644_10006230
854 Ga0207644_10018319
855 Ga0207644_10813697
856 Ga0207686_10134086
857 Ga0207670_10066857
858 Ga0207670_10596312
859 Ga0207691_10002174
860 Ga0207691_10009685
861 Ga0207711_10000188
862 Ga0207711_10020097
863 Ga0207711_10050144
864 Ga0207711_10354768
865 Ga0207711_10379179
866 Ga0207711_10917854
867 Ga0207711_11434584
868 Ga0207689_10206402
869 Ga0207689_10642929
870 Ga0207661_10181316
871 Ga0207661_10682535
872 Ga0207661_11012840
873 Ga0207679_10003529
874 Ga0207679_10011861
875 Ga0207679_10037764
876 Ga0207679_10564942
877 Ga0207667_10226748
878 Ga0207651_10000899
879 Ga0207651_10037506
880 Ga0207651_10577442
881 Ga0207651_11125921
882 Ga0207712_10213846
883 Ga0207668_10611786
884 Ga0207658_10009275
885 Ga0207658_10046606
886 Ga0207658_10079575
887 Ga0207658_10165833
888 Ga0207677_10008423
889 Ga0207677_10020720
890 Ga0207677_10084787
891 Ga0207677_12143160
892 Ga0207703_10009631
893 Ga0207703_10072119
894 Ga0207703_10153739
895 Ga0207703_10199839
896 Ga0207703_11576574
897 Ga0207703_11833590
898 Ga0207703_12392792
899 Ga0207639_11018839
900 Ga0207708_10005499
901 Ga0207641_10004377
902 Ga0207641_10013748
903 Ga0207641_10013863
904 Ga0207641_10037587
905 Ga0207648_10321481
906 Ga0207648_10328570
907 Ga0207648_10378864
908 Ga0207648_11102545
909 Ga0207676_10061417
910 Ga0207676_10078123
911 Ga0207676_10188951
912 Ga0207676_11413186
913 Ga0207674_10433275
914 Ga0207675_100034808
915 Ga0207675_100165315
916 Ga0207675_102271826
917 Ga0207683_10918590
918 Ga0207698_10221726
919 Ga0209983_1104313
920 Ga0209971_1077647
921 Ga0207428_10005507
922 Ga0207428_10500575
923 Ga0268266_10396365
924 Ga0268266_10725672
925 Ga0268266_11523042
926 Ga0268265_10692918
927 Ga0268265_11091895
928 Ga0268265_12010158
929 Ga0268264_10010529
930 Ga0307409_100210849
931 Ga0307411_10620925
932 Ga0373938_0124641
933 Ga0373928_0051050
934 Ga0373934_0260089
935 Ga0373949_0080365
936 Ga0373953_0072898
937 Ga0373956_0164431
938 Ga0373955_0106443
939 Ga0373955_0331696
940 Ga0373955_0559332
941 Ga0373955_0630340
942 Ga0373927_0824990
943 Ga0373933_0651302
944 Ga0373937_0005432
945 Ga0373937_0035441
946 Ga0373937_0205765
947 Ga0373937_0840482
948 Ga0373937_1373413
949 Ga0373937_1920003
950 Ga0436362_0002013
951 Ga0453683_0587074
952 Ga0451576_2041386
953 Ga0495592_0029266
954 Ga0495603_0453941
955 Ga0495629_0063386
956 Ga0495629_0112023
957 Ga0495629_0261773
958 Ga0495582_0578062
959 Ga0495662_0025425
960 Ga0495662_0069015
961 Ga0495594_0148160
962 Ga0495608_0019196
963 Ga0495618_0053767
964 Ga0495618_0083401
965 Ga0495618_0321445
966 Ga0495628_0706070
967 Ga0495630_0247844
968 Ga0495652_0486549
969 Ga0495652_0900236
970 Ga0495640_0065128
971 Ga0495586_0073700
972 Ga0495586_0109217
973 Ga0495667_0000530
974 Ga0495634_0038930
975 Ga0495634_0319665
976 Ga0495634_0327637
977 Ga0495657_0002087
978 Ga0495599_0133187
979 Ga0495647_0036040
980 Ga0495647_0447959
981 Ga0495658_0252919
982 Ga0495658_0651485
983 Ga0495658_0817426
984 Ga0495613_0019352
985 Ga0495613_0046854
986 Ga0495613_0057791
987 Ga0495613_0177684
988 Ga0495600_0822896
989 Ga0495674_0006768
990 Ga0495676_0666213
991 Ga0495684_0172744
992 Ga0495684_0390311
993 Ga0495684_0854924
994 Ga0495614_0288338
995 Ga0496101_0190201
996 Ga0496102_0574340
997 Ga0496104_0170198
998 Ga0496104_1540021
999 Ga0496106_0213399
1000 Ga0496107_0800110
1001 Ga0496108_0378871
1002 Ga0496108_0604917
1003 Ga0496108_1372356
1004 Ga0496112_0011951
1005 Ga0496113_0018375
1006 Ga0496113_1338032
1007 Ga0496114_0018504
1008 Ga0496114_0904164
1009 Ga0496114_1327441
1010 Ga0496115_0105209
1011 Ga0501036_0108090
1012 Ga0501036_0831350
1013 Ga0501038_0050096
1014 Ga0501039_0279491
1015 Ga0501039_0307043
1016 Ga0501040_0002766
1017 Ga0501041_0227627
1018 Ga0501042_0946323
1019 Ga0501046_0018606
1020 Ga0501046_0341254
1021 Ga0501048_0185170
1022 Ga0501048_0844463
1023 Ga0501068_0149429
1024 Ga0501071_0171647
1025 Ga0501072_0020052
1026 Ga0501074_0025178
1027 Ga0501075_0222586
1028 Ga0501076_0000655
1029 Ga0501077_0013373
1030 Ga0501079_0349722
1031 Ga0501079_0389068
1032 Ga0501079_1160987
1033 Ga0501080_0629755
1034 Ga0501080_0895291
1035 Ga0501081_0004487
1036 Ga0501035_0242113
1037 Ga0501035_1413386
1038 Ga0501045_0003528
1039 nmdc:mga05p37_1892748_c1
1040 nmdc:mga05p37_319553_c1
1041 nmdc:mga05p37_374642_c1
1042 nmdc:mga05p37_73422_c1
1043 nmdc:mga09592_1509866_c1
1044 nmdc:mga09592_322141_c1
1045 nmdc:mga06r32_115894_c1
1046 nmdc:mga08y16_1495483_c1
1047 nmdc:mga08y16_2323_c1
1048 nmdc:mga08y16_316932_c1
1049 nmdc:mga0n895_200475_c1
1050 nmdc:mga0n895_614121_c1
1051 nmdc:mga0n895_777038_c1
1052 nmdc:mga0rr50_272401_c1
1053 nmdc:mga0rr50_428277_c1
1054 nmdc:mga0rr50_55321_c1
1055 nmdc:mga08x19_80999_c1
1056 nmdc:mga0a205_318386_c1
1057 nmdc:mga0a205_717276_c1
1058 nmdc:mga0a205_74771_c1
1059 Ga0495601_0006320
1060 Ga0495601_0345102
1061 Ga0495619_0013570
1062 Ga0495619_0746512
1063 Ga0501084_0030174
1064 Ga0501084_1338540
1065 Ga0590071_087894
1066 Ga0587084_115700
1067 Ga0501082_0002178
1068 Ga0530510_0009659

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19649

DUF6152

Family of unknown function (DUF6152)

42

142

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6cqm-assembly2.cif.gz_H-3 crystal structure of mitochondrial single-stranded dna binding proteins from s. cerevisiae, rim1 (form2) 0.7572 30 118
4ywk-assembly3.cif.gz_B pyrococcus furiosus mcm n-terminal domain with zinc-binding subdomain b deleted 0.737 35 100
2i1y-assembly1.cif.gz_A crystal structure of the phosphatase domain of human ptp ia-2 0.732 43 73
6cqo-assembly1.cif.gz_G crystal structure of mitochondrial single-stranded dna binding proteins from s. cerevisiae (semet labeled), rim1 (form2) 0.7285 30 118
7u5c-assembly1.cif.gz_C cryo-em structure of human cst bound to dna polymerase alpha-primase in a recruitment state 0.7264 37 76
ID Description Score Start End Superfamily
2awoD03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8127 37 95 2.40.50.140
3rlfA03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7993 37 98 2.40.50.140
3rlfA03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7719 37 98 2.40.50.140
af_P87307_123_212_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7697 36 117 2.40.50.140
3au7A02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.7554 36 117 2.40.50.1010
ID Description Score Start End GO Terms
AF-A0A2T5GGJ4-F1-model_v4 Uncharacterized protein 0.9559 35 125
AF-A0A1M3P5H5-F1-model_v4 DUF5666 domain-containing protein 0.9533 40 124
AF-A0A2V8DL04-F1-model_v4 DUF5666 domain-containing protein 0.948 37 132
AF-A0A383CUF3-F1-model_v4 OB domain-containing protein 0.9468 31 125
AF-A0A2V9CMM4-F1-model_v4 Uncharacterized protein 0.9435 35 124

Map