F460534

General Info

Members Datasets Scaffolds Average Seq Length
534 271 1068 81

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10334689|Ga0105245_103346892
Length 97
Sequence LSKVCTVPGRNLDRKEKDMKKLDVLAGVLVVVGALNWGLVAIAEFDLVATLFGLDFGETNAATRVIYGLVGAAAVYEIVQWPAMRRRWSRTPTPATA

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
178 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
179 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
182 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
183 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
184 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
185 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
186 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
189 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
190 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
191 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
192 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
193 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
194 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
195 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
196 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
197 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
198 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
199 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
200 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
201 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
202 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
203 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
204 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
205 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
206 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
207 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
208 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
209 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
210 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
211 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
212 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
213 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
214 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
217 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
218 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
225 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
226 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
227 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
243 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
244 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
245 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
246 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
247 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
248 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
249 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
250 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
251 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
252 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
253 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
254 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
255 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
256 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
257 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
260 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
261 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
262 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
263 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
266 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
267 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
268 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
269 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
270 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
271 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.31
Metatranscriptomes 1.69
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 0
Rhizoplane 8.8
Rhizosphere 90.45
Stem 0
Stem Tuber 0
Unclassified 20.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10334689 3300009098 Bacteria 1495
2 JGI25407J50210_10026879 3300003373 Unclassified 1492
3 Ga0070683_100003171 3300005329 Bacteria 13263
4 Ga0070683_100008282 3300005329 Bacteria 8837
5 Ga0070683_100019827 3300005329 Bacteria 5977
6 Ga0070683_100046004 3300005329 Bacteria 4030
7 Ga0070683_100288617 3300005329 Bacteria 1560
8 Ga0070690_100073620 3300005330 Bacteria 2223
9 Ga0070670_100696924 3300005331 Bacteria 913
10 Ga0070677_10041026 3300005333 Bacteria 1825
11 Ga0070677_10402003 3300005333 Unclassified 722
12 Ga0068869_100130952 3300005334 Unclassified 1928
13 Ga0070680_100033234 3300005336 Bacteria 4156
14 Ga0070680_100056852 3300005336 Bacteria 3198
15 Ga0070682_101723661 3300005337 Bacteria 545
16 Ga0068868_100082231 3300005338 Bacteria 2583
17 Ga0068868_100661548 3300005338 Bacteria 931
18 Ga0070660_100087202 3300005339 Bacteria 2457
19 Ga0070689_100112627 3300005340 Bacteria 2166
20 Ga0070689_101430112 3300005340 Unclassified 625
21 Ga0070691_10889053 3300005341 Bacteria 549
22 Ga0070687_100110146 3300005343 Unclassified 1557
23 Ga0070687_100470410 3300005343 Bacteria 840
24 Ga0070661_100335215 3300005344 Bacteria 1184
25 Ga0070661_100579829 3300005344 Unclassified 905
26 Ga0070692_10080453 3300005345 Bacteria 1754
27 Ga0070692_10611145 3300005345 Unclassified 723
28 Ga0070668_100263099 3300005347 Bacteria 1435
29 Ga0070669_100766681 3300005353 Bacteria 818
30 Ga0070675_100169947 3300005354 Unclassified 1879
31 Ga0070675_100766574 3300005354 Bacteria 881
32 Ga0070675_101510313 3300005354 Bacteria 620
33 Ga0070671_100093976 3300005355 Unclassified 2513
34 Ga0070671_100458779 3300005355 Bacteria 1094
35 Ga0070671_100950067 3300005355 Unclassified 752
36 Ga0070674_100014665 3300005356 Bacteria 4875
37 Ga0070674_100082675 3300005356 Bacteria 2298
38 Ga0070674_100284159 3300005356 Bacteria 1313
39 Ga0070674_100298674 3300005356 Bacteria 1283
40 Ga0070673_100493529 3300005364 Bacteria 1107
41 Ga0070673_101624626 3300005364 Bacteria 611
42 Ga0070688_100839879 3300005365 Bacteria 721
43 Ga0070659_100339862 3300005366 Bacteria 1257
44 Ga0070659_100536017 3300005366 Unclassified 1001
45 Ga0070659_101888360 3300005366 Bacteria 535
46 Ga0070667_101324462 3300005367 Bacteria 675
47 Ga0070667_101532739 3300005367 Bacteria 626
48 Ga0070709_11324770 3300005434 Unclassified 581
49 Ga0070709_11719891 3300005434 Unclassified 512
50 Ga0070714_100272774 3300005435 Bacteria 1569
51 Ga0070714_101433076 3300005435 Bacteria 674
52 Ga0070714_101939618 3300005435 Unclassified 575
53 Ga0070713_100321601 3300005436 Bacteria 1429
54 Ga0070713_100477204 3300005436 Bacteria 1174
55 Ga0070713_100609585 3300005436 Bacteria 1037
56 Ga0070713_102111861 3300005436 Bacteria 546
57 Ga0070710_10027858 3300005437 Bacteria 3017
58 Ga0070710_10359840 3300005437 Bacteria 965
59 Ga0070710_10446072 3300005437 Unclassified 876
60 Ga0070701_10163273 3300005438 Unclassified 1292
61 Ga0070711_100054693 3300005439 Bacteria 2755
62 Ga0070711_100187727 3300005439 Bacteria 1586
63 Ga0070711_100503978 3300005439 Unclassified 998
64 Ga0070705_100065987 3300005440 Bacteria 2169
65 Ga0070705_100946324 3300005440 Bacteria 696
66 Ga0070700_100113034 3300005441 Bacteria 1809
67 Ga0070700_100211473 3300005441 Unclassified 1369
68 Ga0070700_100249453 3300005441 Bacteria 1272
69 Ga0070700_100835882 3300005441 Bacteria 744
70 Ga0070694_100377409 3300005444 Bacteria 1105
71 Ga0070663_100023629 3300005455 Bacteria 4123
72 Ga0070663_100473730 3300005455 Bacteria 1035
73 Ga0070678_100058479 3300005456 Bacteria 2829
74 Ga0070678_101015873 3300005456 Bacteria 763
75 Ga0070678_101621212 3300005456 Bacteria 608
76 Ga0070662_100217006 3300005457 Bacteria 1524
77 Ga0070662_100544696 3300005457 Unclassified 972
78 Ga0070681_10079126 3300005458 Bacteria 3244
79 Ga0070681_10671641 3300005458 Unclassified 951
80 Ga0068867_100050762 3300005459 Bacteria 3058
81 Ga0070685_10012043 3300005466 Bacteria 4535
82 Ga0070679_100023453 3300005530 Bacteria 6041
83 Ga0070679_100674648 3300005530 Unclassified 976
84 Ga0070684_100005603 3300005535 Bacteria 9650
85 Ga0070684_100048080 3300005535 Bacteria 3700
86 Ga0070684_100053202 3300005535 Bacteria 3523
87 Ga0070684_100075158 3300005535 Bacteria 2980
88 Ga0070684_100141575 3300005535 Bacteria 2175
89 Ga0070697_101250368 3300005536 Bacteria 662
90 Ga0068853_101227199 3300005539 Unclassified 724
91 Ga0070672_100067005 3300005543 Unclassified 2844
92 Ga0070672_101239196 3300005543 Bacteria 665
93 Ga0070686_100049514 3300005544 Bacteria 2666
94 Ga0070686_101313133 3300005544 Bacteria 604
95 Ga0070695_100265304 3300005545 Bacteria 1256
96 Ga0070695_100448885 3300005545 Bacteria 988
97 Ga0070696_100147984 3300005546 Bacteria 1721
98 Ga0070696_100149693 3300005546 Unclassified 1712
99 Ga0070693_100024642 3300005547 Bacteria 3228
100 Ga0070693_100092871 3300005547 Bacteria 1823
101 Ga0070693_101138180 3300005547 Bacteria 597
102 Ga0070693_101142589 3300005547 Unclassified 596
103 Ga0070665_100534530 3300005548 Bacteria 1184
104 Ga0070665_100920462 3300005548 Bacteria 887
105 Ga0070704_100054528 3300005549 Bacteria 2829
106 Ga0070704_100492941 3300005549 Bacteria 1062
107 Ga0070704_101064406 3300005549 Bacteria 734
108 Ga0068855_101791715 3300005563 Bacteria 624
109 Ga0070664_100090126 3300005564 Bacteria 2654
110 Ga0070664_100295980 3300005564 Bacteria 1462
111 Ga0070664_100538624 3300005564 Bacteria 1079
112 Ga0070664_100720580 3300005564 Bacteria 930
113 Ga0070664_101622311 3300005564 Bacteria 613
114 Ga0068857_100006768 3300005577 Bacteria 9861
115 Ga0068857_100146607 3300005577 Bacteria 2136
116 Ga0068857_100220576 3300005577 Bacteria 1732
117 Ga0068857_100513828 3300005577 Bacteria 1125
118 Ga0068857_100647126 3300005577 Bacteria 1001
119 Ga0068854_101507189 3300005578 Bacteria 611
120 Ga0068854_101745895 3300005578 Bacteria 570
121 Ga0068856_100008004 3300005614 Bacteria 10319
122 Ga0068856_100748777 3300005614 Bacteria 997
123 Ga0068856_100967699 3300005614 Bacteria 870
124 Ga0068856_101707485 3300005614 Unclassified 642
125 Ga0070702_100079625 3300005615 Unclassified 1958
126 Ga0070702_100149581 3300005615 Bacteria 1497
127 Ga0070702_101537172 3300005615 Bacteria 549
128 Ga0068852_101014265 3300005616 Bacteria 849
129 Ga0068859_100158202 3300005617 Unclassified 2344
130 Ga0068859_100358714 3300005617 Bacteria 1553
131 Ga0068859_100588506 3300005617 Bacteria 1206
132 Ga0068864_100131608 3300005618 Bacteria 2248
133 Ga0068864_100627088 3300005618 Bacteria 1045
134 Ga0068866_10112370 3300005718 Unclassified 1522
135 Ga0068866_11133297 3300005718 Unclassified 562
136 Ga0068861_100234244 3300005719 Unclassified 1559
137 Ga0068861_101492073 3300005719 Bacteria 663
138 Ga0068870_11053316 3300005840 Bacteria 583
139 Ga0068870_11139325 3300005840 Unclassified 562
140 Ga0068863_100296455 3300005841 Bacteria 1568
141 Ga0068858_100087738 3300005842 Unclassified 2894
142 Ga0068860_100219330 3300005843 Unclassified 1847
143 Ga0068860_100381322 3300005843 Unclassified 1392
144 Ga0081455_10005990 3300005937 Bacteria 13184
145 Ga0081455_10020154 3300005937 Bacteria 6290
146 Ga0081455_10022710 3300005937 Bacteria 5855
147 Ga0081455_10078921 3300005937 Bacteria 2704
148 Ga0081455_10235533 3300005937 Bacteria 1348
149 Ga0081455_10965237 3300005937 Bacteria 528
150 Ga0081538_10000016 3300005981 Bacteria 147022
151 Ga0081538_10000076 3300005981 Bacteria 94022
152 Ga0081538_10029512 3300005981 Bacteria 3745
153 Ga0081538_10300216 3300005981 Bacteria 590
154 Ga0081539_10049182 3300005985 Bacteria 2394
155 Ga0070717_10087572 3300006028 Unclassified 2623
156 Ga0070717_10126823 3300006028 Bacteria 2191
157 Ga0070717_10176540 3300006028 Bacteria 1860
158 Ga0070717_11511876 3300006028 Viruses 609
159 Ga0075368_10219660 3300006042 Archaea 807
160 Ga0075363_100016546 3300006048 Bacteria 3644
161 Ga0075432_10229639 3300006058 Bacteria 745
162 Ga0075432_10266741 3300006058 Bacteria 700
163 Ga0070715_10000655 3300006163 Bacteria 9243
164 Ga0070716_100025832 3300006173 Bacteria 3139
165 Ga0070716_100042855 3300006173 Archaea 2528
166 Ga0070716_100591927 3300006173 Bacteria 833
167 Ga0070716_100945618 3300006173 Bacteria 678
168 Ga0070716_101415473 3300006173 Unclassified 566
169 Ga0070712_100024344 3300006175 Bacteria 4011
170 Ga0070712_100062042 3300006175 Bacteria 2642
171 Ga0070712_100136490 3300006175 Bacteria 1866
172 Ga0070712_100186151 3300006175 Bacteria 1621
173 Ga0070712_100861424 3300006175 Bacteria 780
174 Ga0070712_100956806 3300006175 Bacteria 740
175 Ga0097621_100071525 3300006237 Unclassified 2866
176 Ga0097621_100087796 3300006237 Bacteria 2597
177 Ga0097621_100256905 3300006237 Bacteria 1532
178 Ga0068871_100085624 3300006358 Bacteria 2618
179 Ga0068871_100187503 3300006358 Unclassified 1780
180 Ga0075428_100106827 3300006844 Bacteria 3051
181 Ga0075428_101382061 3300006844 Unclassified 739
182 Ga0075428_101812215 3300006844 Bacteria 635
183 Ga0075428_102393243 3300006844 Unclassified 542
184 Ga0075430_100006028 3300006846 Bacteria 10224
185 Ga0075430_100024100 3300006846 Bacteria 5181
186 Ga0075430_100196179 3300006846 Bacteria 1677
187 Ga0075431_100000291 3300006847 Bacteria 39272
188 Ga0075431_100036055 3300006847 Bacteria 5094
189 Ga0075431_100197180 3300006847 Archaea 2061
190 Ga0075431_101401420 3300006847 Bacteria 658
191 Ga0075433_10010120 3300006852 Bacteria 7561
192 Ga0075433_10795297 3300006852 Bacteria 826
193 Ga0075434_100016491 3300006871 Bacteria 7102
194 Ga0075434_100225173 3300006871 Unclassified 1895
195 Ga0075429_100068834 3300006880 Unclassified 3081
196 Ga0068865_100047402 3300006881 Unclassified 2953
197 Ga0068865_100293878 3300006881 Bacteria 1298
198 Ga0068865_100925507 3300006881 Unclassified 759
199 Ga0075436_100047515 3300006914 Bacteria 2960
200 Ga0097620_100158207 3300006931 Unclassified 2344
201 Ga0097620_100358702 3300006931 Bacteria 1553
202 Ga0097620_100588458 3300006931 Bacteria 1206
203 Ga0075435_100009308 3300007076 Bacteria 7102
204 Ga0105250_10376777 3300009092 Unclassified 625
205 Ga0105240_11046098 3300009093 Bacteria 871
206 Ga0111539_10004117 3300009094 Bacteria 19079
207 Ga0111539_10004170 3300009094 Bacteria 18956
208 Ga0111539_10037469 3300009094 Bacteria 5854
209 Ga0111539_11073331 3300009094 Unclassified 936
210 Ga0111539_11241946 3300009094 Bacteria 865
211 Ga0105245_10016528 3300009098 Bacteria 6438
212 Ga0105245_10038330 3300009098 Bacteria 4264
213 Ga0105245_10111036 3300009098 Bacteria 2549
214 Ga0105245_10316836 3300009098 Unclassified 1535
215 Ga0105245_10882902 3300009098 Unclassified 935
216 Ga0105247_10294298 3300009101 Bacteria 1124
217 Ga0114129_10004175 3300009147 Bacteria 20403
218 Ga0114129_10050162 3300009147 Bacteria 5862
219 Ga0114129_10115619 3300009147 Unclassified 3697
220 Ga0114129_10196412 3300009147 Bacteria 2735
221 Ga0105243_10006213 3300009148 Bacteria 9238
222 Ga0105243_10066690 3300009148 Bacteria 2895
223 Ga0105243_10349756 3300009148 Bacteria 1357
224 Ga0105243_10444185 3300009148 Unclassified 1215
225 Ga0105241_10186361 3300009174 Bacteria 1725
226 Ga0105241_10235117 3300009174 Unclassified 1546
227 Ga0105241_10697093 3300009174 Unclassified 927
228 Ga0105242_10083036 3300009176 Bacteria 2682
229 Ga0105242_10105571 3300009176 Bacteria 2393
230 Ga0105242_10117696 3300009176 Bacteria 2275
231 Ga0105242_10200373 3300009176 Bacteria 1773
232 Ga0105248_10014467 3300009177 Bacteria 8685
233 Ga0105248_10094608 3300009177 Bacteria 3364
234 Ga0105248_11480961 3300009177 Unclassified 768
235 Ga0105237_10324897 3300009545 Bacteria 1542
236 Ga0105238_10155323 3300009551 Unclassified 2263
237 Ga0105238_10630668 3300009551 Bacteria 1081
238 Ga0105249_10249654 3300009553 Bacteria 1759
239 Ga0105249_10840213 3300009553 Bacteria 983
240 Ga0105249_11362921 3300009553 Bacteria 781
241 Ga0105249_11608655 3300009553 Bacteria 722
242 Ga0105239_10063671 3300010375 Bacteria 4049
243 Ga0105239_10321082 3300010375 Unclassified 1746
244 Ga0105246_10042533 3300011119 Bacteria 3078
245 Ga0105246_10198342 3300011119 Bacteria 1558
246 Ga0105246_10495819 3300011119 Bacteria 1036
247 Ga0105246_10746944 3300011119 Bacteria 862
248 Ga0157373_10073393 3300013100 Bacteria 2414
249 Ga0157371_10143899 3300013102 Bacteria 1699
250 Ga0157374_10185207 3300013296 Unclassified 2035
251 Ga0157374_10275110 3300013296 Bacteria 1661
252 Ga0157378_10009966 3300013297 Bacteria 8285
253 Ga0157378_12207601 3300013297 Unclassified 602
254 Ga0157378_12334382 3300013297 Bacteria 586
255 Ga0163162_10427295 3300013306 Bacteria 1457
256 Ga0163162_12541306 3300013306 Bacteria 589
257 Ga0157375_10046881 3300013308 Archaea 4217
258 Ga0157375_10049893 3300013308 Bacteria 4103
259 Ga0163163_10033803 3300014325 Bacteria 4949
260 Ga0163163_10033968 3300014325 Bacteria 4937
261 Ga0157380_10229131 3300014326 Bacteria 1667
262 Ga0157380_10516684 3300014326 Bacteria 1164
263 Ga0182008_10147317 3300014497 Bacteria 1180
264 Ga0157377_10014493 3300014745 Archaea 4012
265 Ga0157377_10309974 3300014745 Bacteria 1045
266 Ga0157377_10615406 3300014745 Bacteria 777
267 Ga0157377_11166075 3300014745 Bacteria 594
268 Ga0157379_10012021 3300014968 Bacteria 7561
269 Ga0157379_10712157 3300014968 Unclassified 943
270 Ga0157379_12212106 3300014968 Bacteria 546
271 Ga0157376_10177433 3300014969 Bacteria 1944
272 Ga0157376_11172306 3300014969 Unclassified 796
273 Ga0163161_10912534 3300017792 Bacteria 745
274 Ga0206356_11303778 3300020070 Bacteria 628
275 Ga0154015_1114968 3300020610 Unclassified 554
276 Ga0207697_10274211 3300025315 Bacteria 747
277 Ga0207682_10346822 3300025893 Unclassified 699
278 Ga0207692_10075884 3300025898 Bacteria 1784
279 Ga0207642_10389777 3300025899 Unclassified 831
280 Ga0207688_10012881 3300025901 Bacteria 4545
281 Ga0207647_10127582 3300025904 Bacteria 1496
282 Ga0207685_10089371 3300025905 Bacteria 1293
283 Ga0207685_10605116 3300025905 Unclassified 589
284 Ga0207699_10768856 3300025906 Bacteria 707
285 Ga0207645_10158601 3300025907 Unclassified 1479
286 Ga0207643_10102433 3300025908 Unclassified 1679
287 Ga0207654_10285020 3300025911 Bacteria 1118
288 Ga0207654_10705005 3300025911 Bacteria 725
289 Ga0207707_10062139 3300025912 Bacteria 3250
290 Ga0207693_10183732 3300025915 Bacteria 1646
291 Ga0207693_10206724 3300025915 Bacteria 1543
292 Ga0207693_10644713 3300025915 Unclassified 823
293 Ga0207693_10693679 3300025915 Bacteria 789
294 Ga0207663_10047549 3300025916 Bacteria 2649
295 Ga0207663_10111037 3300025916 Bacteria 1860
296 Ga0207660_10103423 3300025917 Bacteria 2131
297 Ga0207660_10310577 3300025917 Unclassified 1257
298 Ga0207662_10430705 3300025918 Unclassified 899
299 Ga0207657_10087135 3300025919 Bacteria 2613
300 Ga0207657_10172591 3300025919 Bacteria 1751
301 Ga0207649_10092123 3300025920 Bacteria 1986
302 Ga0207649_10505069 3300025920 Bacteria 920
303 Ga0207652_10020432 3300025921 Bacteria 5451
304 Ga0207652_11290899 3300025921 Unclassified 633
305 Ga0207681_10223830 3300025923 Bacteria 1457
306 Ga0207694_10482726 3300025924 Unclassified 1037
307 Ga0207694_10745137 3300025924 Bacteria 827
308 Ga0207650_11209005 3300025925 Bacteria 643
309 Ga0207659_10589545 3300025926 Bacteria 947
310 Ga0207687_10027376 3300025927 Bacteria 3825
311 Ga0207700_10267273 3300025928 Bacteria 1467
312 Ga0207700_10345252 3300025928 Bacteria 1295
313 Ga0207700_10580414 3300025928 Bacteria 997
314 Ga0207664_10064567 3300025929 Bacteria 2928
315 Ga0207664_10111850 3300025929 Bacteria 2272
316 Ga0207644_10617573 3300025931 Bacteria 901
317 Ga0207644_11685859 3300025931 Unclassified 531
318 Ga0207690_10096213 3300025932 Unclassified 2105
319 Ga0207690_10212487 3300025932 Bacteria 1476
320 Ga0207690_11102714 3300025932 Bacteria 662
321 Ga0207706_10256458 3300025933 Unclassified 1527
322 Ga0207686_10040504 3300025934 Bacteria 2833
323 Ga0207709_10106026 3300025935 Unclassified 1869
324 Ga0207709_10483160 3300025935 Bacteria 963
325 Ga0207670_10564780 3300025936 Bacteria 931
326 Ga0207704_10199588 3300025938 Bacteria 1463
327 Ga0207665_10001453 3300025939 Bacteria 15941
328 Ga0207691_10411231 3300025940 Bacteria 1153
329 Ga0207691_11437031 3300025940 Bacteria 566
330 Ga0207689_10442799 3300025942 Bacteria 1085
331 Ga0207689_10813188 3300025942 Bacteria 789
332 Ga0207661_10004691 3300025944 Bacteria 9574
333 Ga0207661_10015094 3300025944 Bacteria 5676
334 Ga0207661_10481988 3300025944 Bacteria 1132
335 Ga0207679_10240104 3300025945 Bacteria 1535
336 Ga0207679_10341949 3300025945 Bacteria 1301
337 Ga0207679_10413450 3300025945 Bacteria 1189
338 Ga0207667_10861531 3300025949 Bacteria 900
339 Ga0207651_10236700 3300025960 Bacteria 1486
340 Ga0207651_10917071 3300025960 Bacteria 781
341 Ga0207668_10430554 3300025972 Unclassified 1122
342 Ga0207668_11692416 3300025972 Unclassified 571
343 Ga0207640_10509430 3300025981 Bacteria 1004
344 Ga0207640_10761898 3300025981 Bacteria 835
345 Ga0207677_10016163 3300026023 Bacteria 4411
346 Ga0207677_10248759 3300026023 Bacteria 1442
347 Ga0207677_11438965 3300026023 Bacteria 635
348 Ga0207678_10016349 3300026067 Bacteria 6514
349 Ga0207678_10026630 3300026067 Bacteria 5044
350 Ga0207678_10271253 3300026067 Bacteria 1455
351 Ga0207708_10045513 3300026075 Bacteria 3344
352 Ga0207708_10069650 3300026075 Bacteria 2694
353 Ga0207708_10127487 3300026075 Bacteria 1987
354 Ga0207708_10218105 3300026075 Bacteria 1527
355 Ga0207708_11117696 3300026075 Bacteria 687
356 Ga0207702_10029504 3300026078 Bacteria 4564
357 Ga0207702_10275942 3300026078 Bacteria 1587
358 Ga0207641_11569458 3300026088 Unclassified 660
359 Ga0207648_10128169 3300026089 Bacteria 2233
360 Ga0207648_10132850 3300026089 Bacteria 2191
361 Ga0207648_10609587 3300026089 Bacteria 1007
362 Ga0207676_10110125 3300026095 Bacteria 2303
363 Ga0207674_10005269 3300026116 Bacteria 15389
364 Ga0207674_11949661 3300026116 Bacteria 553
365 Ga0207675_100135972 3300026118 Unclassified 2332
366 Ga0207683_10110811 3300026121 Bacteria 2457
367 Ga0207698_11522302 3300026142 Unclassified 684
368 Ga0209966_1047064 3300027695 Unclassified 911
369 Ga0209998_10078303 3300027717 Bacteria 798
370 Ga0207428_10013510 3300027907 Bacteria 7130
371 Ga0207428_10041659 3300027907 Bacteria 3716
372 Ga0268266_10493364 3300028379 Bacteria 1169
373 Ga0268265_10333817 3300028380 Bacteria 1378
374 Ga0268264_12518180 3300028381 Unclassified 520
375 Ga0265339_10212402 3300031249 Bacteria 950
376 Ga0307410_10379603 3300031852 Unclassified 1137
377 Ga0307409_100539208 3300031995 Unclassified 1143
378 Ga0307416_100447056 3300032002 Bacteria 1344
379 Ga0307416_103691059 3300032002 Unclassified 512
380 Ga0307411_11692153 3300032005 Bacteria 585
381 Ga0373958_0013475 3300034819 Bacteria 1417
382 Ga0373932_0112779 3300035112 Unclassified 898
383 Ga0373960_0020717 3300035121 Bacteria 1741
384 Ga0373962_0013287 3300035242 Bacteria 2082
385 Ga0373931_0410602 3300035691 Bacteria 859
386 Ga0373931_0452171 3300035691 Bacteria 822
387 Ga0373937_0501719 3300036401 Bacteria 1153
388 Ga0395905_0032653 3300037471 Bacteria 4895
389 Ga0451845_0651047 3300041501 Bacteria 959
390 Ga0439448_0165153 3300042005 Bacteria 771
391 Ga0439450_047938 3300042008 Bacteria 1008
392 Ga0466964_0684258 3300044706 Unclassified 570
393 Ga0466971_0074267 3300044719 Unclassified 1546
394 Ga0466957_0000509 3300044842 Bacteria 19422
395 Ga0466967_0004610 3300045976 Bacteria 9338
396 Ga0495641_0278549 3300046461 Bacteria 753
397 Ga0495651_0397171 3300046462 Bacteria 901
398 Ga0495582_0428490 3300046473 Unclassified 763
399 Ga0495596_0228931 3300046500 Bacteria 722
400 Ga0495630_0161527 3300046517 Bacteria 1706
401 Ga0495644_0229577 3300046523 Unclassified 718
402 Ga0495652_0525891 3300046529 Unclassified 817
403 Ga0495586_0012642 3300046535 Bacteria 4477
404 Ga0495667_0193266 3300046559 Bacteria 1304
405 Ga0495668_0357214 3300046616 Unclassified 802
406 Ga0495634_0029974 3300046642 Bacteria 3762
407 Ga0495589_0048059 3300046794 Bacteria 2113
408 Ga0495680_0111414 3300047322 Bacteria 2028
409 Ga0495680_0389670 3300047322 Bacteria 964
410 Ga0495677_0375722 3300047445 Unclassified 562
411 Ga0495602_0043104 3300048088 Bacteria 4106
412 Ga0496100_0117513 3300048903 Bacteria 1856
413 Ga0496100_0556975 3300048903 Bacteria 887
414 Ga0496100_1208576 3300048903 Unclassified 596
415 Ga0496101_0053032 3300048904 Bacteria 2925
416 Ga0496101_0145320 3300048904 Bacteria 1810
417 Ga0496101_0183645 3300048904 Bacteria 1611
418 Ga0496101_0657061 3300048904 Archaea 828
419 Ga0496102_0164554 3300048905 Bacteria 2087
420 Ga0496102_0820560 3300048905 Unclassified 852
421 Ga0496103_0005898 3300048906 Bacteria 7321
422 Ga0496103_0187715 3300048906 Bacteria 1329
423 Ga0496103_0554450 3300048906 Bacteria 733
424 Ga0496103_0668595 3300048906 Unclassified 659
425 Ga0496104_0003031 3300048907 Bacteria 14474
426 Ga0496104_0015893 3300048907 Bacteria 6830
427 Ga0496104_0215341 3300048907 Bacteria 1832
428 Ga0496105_0001301 3300048908 Bacteria 17470
429 Ga0496105_0021824 3300048908 Bacteria 5183
430 Ga0496105_0030204 3300048908 Bacteria 4440
431 Ga0496106_0051453 3300048909 Bacteria 3106
432 Ga0496106_0248315 3300048909 Bacteria 1422
433 Ga0496106_0335663 3300048909 Bacteria 1214
434 Ga0496106_1412653 3300048909 Unclassified 537
435 Ga0496107_0074609 3300048910 Bacteria 2468
436 Ga0496107_0156314 3300048910 Bacteria 1688
437 Ga0496107_0213527 3300048910 Bacteria 1435
438 Ga0496108_0001139 3300048911 Bacteria 20752
439 Ga0496108_0002738 3300048911 Bacteria 14096
440 Ga0496108_1468906 3300048911 Unclassified 568
441 Ga0496109_0007510 3300048912 Bacteria 9234
442 Ga0496109_0022413 3300048912 Bacteria 5593
443 Ga0496109_0891601 3300048912 Bacteria 827
444 Ga0496110_0000591 3300048913 Bacteria 24959
445 Ga0496111_0000183 3300048914 Bacteria 28637
446 Ga0496111_0006096 3300048914 Bacteria 7797
447 Ga0496111_0809692 3300048914 Bacteria 678
448 Ga0496112_0008015 3300048915 Bacteria 9423
449 Ga0496112_0772620 3300048915 Bacteria 886
450 Ga0496112_1430719 3300048915 Bacteria 606
451 Ga0496113_0001248 3300048916 Bacteria 13999
452 Ga0496113_0664211 3300048916 Bacteria 833
453 Ga0496113_1045224 3300048916 Unclassified 642
454 Ga0496114_0005362 3300048917 Bacteria 10025
455 Ga0496114_0108971 3300048917 Bacteria 2371
456 Ga0496115_0014681 3300048918 Bacteria 5932
457 Ga0496115_0031052 3300048918 Bacteria 4207
458 Ga0496115_0067814 3300048918 Bacteria 2886
459 Ga0501306_074400 3300049127 Unclassified 578
460 Ga0501306_090943 3300049127 Bacteria 536
461 Ga0501310_073601 3300049130 Bacteria 527
462 Ga0501318_083357 3300049534 Bacteria 521
463 Ga0501321_068459 3300049537 Bacteria 548
464 Ga0501322_020815 3300049538 Unclassified 575
465 Ga0501323_032453 3300049539 Bacteria 738
466 Ga0501033_0494580 3300049570 Bacteria 846
467 Ga0501036_0033882 3300049572 Bacteria 4320
468 Ga0501036_0131752 3300049572 Bacteria 2110
469 Ga0501038_0380945 3300049574 Bacteria 1094
470 Ga0501039_1196062 3300049575 Bacteria 588
471 Ga0501040_0004157 3300049576 Bacteria 9421
472 Ga0501040_0111020 3300049576 Bacteria 1917
473 Ga0501041_0029170 3300049577 Bacteria 3328
474 Ga0501041_0194975 3300049577 Bacteria 1269
475 Ga0501042_0033922 3300049578 Bacteria 3619
476 Ga0501042_0598251 3300049578 Bacteria 802
477 Ga0501046_0027728 3300049580 Bacteria 4618
478 Ga0501046_0178613 3300049580 Bacteria 1588
479 Ga0501048_0057249 3300049582 Bacteria 2764
480 Ga0501048_0058225 3300049582 Bacteria 2739
481 Ga0501067_0285165 3300049583 Bacteria 919
482 Ga0501067_0597733 3300049583 Bacteria 619
483 Ga0501068_0022220 3300049584 Bacteria 3707
484 Ga0501068_0102027 3300049584 Bacteria 1779
485 Ga0501069_0022994 3300049585 Bacteria 3395
486 Ga0501069_0300277 3300049585 Bacteria 942
487 Ga0501069_0321354 3300049585 Bacteria 909
488 Ga0501070_0256247 3300049586 Unclassified 1431
489 Ga0501071_0083821 3300049587 Bacteria 2335
490 Ga0501071_0122326 3300049587 Unclassified 1929
491 Ga0501071_0709732 3300049587 Bacteria 774
492 Ga0501072_0004414 3300049588 Bacteria 10685
493 Ga0501072_0005527 3300049588 Bacteria 9619
494 Ga0501072_0232531 3300049588 Bacteria 1468
495 Ga0501072_0991127 3300049588 Unclassified 655
496 Ga0501073_0045850 3300049589 Bacteria 3078
497 Ga0501074_0004044 3300049590 Bacteria 10465
498 Ga0501074_0047145 3300049590 Bacteria 3115
499 Ga0501075_0002456 3300049591 Bacteria 12357
500 Ga0501075_0005034 3300049591 Bacteria 9024
501 Ga0501075_0842785 3300049591 Bacteria 697
502 Ga0501076_0003752 3300049592 Bacteria 10682
503 Ga0501076_0085965 3300049592 Bacteria 2527
504 Ga0501076_0417255 3300049592 Bacteria 1104
505 Ga0501077_0028160 3300049593 Bacteria 3570
506 Ga0501077_0031878 3300049593 Bacteria 3353
507 Ga0501079_0676402 3300049741 Unclassified 812
508 Ga0501080_0422343 3300049742 Bacteria 1197
509 Ga0501081_0002626 3300049743 Bacteria 11365
510 Ga0501081_0015564 3300049743 Bacteria 5020
511 Ga0501081_1379672 3300049743 Bacteria 535
512 Ga0501083_0896646 3300049744 Unclassified 577
513 Ga0501035_0352496 3300049822 Bacteria 1231
514 Ga0501044_0766379 3300049823 Bacteria 846
515 Ga0501045_0000582 3300049824 Bacteria 22920
516 Ga0501045_0006308 3300049824 Bacteria 8201
517 Ga0501045_1336007 3300049824 Unclassified 521
518 nmdc:mga04h51_187946_c1 3300050495 Archaea 807
519 nmdc:mga05p37_8652_c1 3300050507 Bacteria 12033
520 nmdc:mga06r32_198470_c1 3300050510 Archaea 1994
521 nmdc:mga08y16_33053_c1 3300050511 Bacteria 5435
522 nmdc:mga0n895_9074_c1 3300050512 Bacteria 8675
523 nmdc:mga0rr50_2960_c1 3300050513 Bacteria 9714
524 nmdc:mga08x19_42355_c1 3300050514 Unclassified 2903
525 nmdc:mga0a205_5546_c1 3300050515 Bacteria 11366
526 Ga0501084_0004673 3300054114 Bacteria 11183
527 Ga0501084_0019062 3300054114 Bacteria 5714
528 Ga0501082_0008247 3300060353 Bacteria 8982
529 Ga0501082_0020058 3300060353 Bacteria 5760
530 Ga0501082_1253860 3300060353 Unclassified 648
531 Ga0466962_0259574 3300061719 Bacteria 855
532 Ga0530510_0003595 3300061734 Bacteria 10671
533 Ga0530510_0004252 3300061734 Bacteria 9902
534 Ga0530510_0297723 3300061734 Bacteria 1207
535 Ga0105245_10334689
536 JGI25407J50210_10026879
537 Ga0070683_100003171
538 Ga0070683_100008282
539 Ga0070683_100019827
540 Ga0070683_100046004
541 Ga0070683_100288617
542 Ga0070690_100073620
543 Ga0070670_100696924
544 Ga0070677_10041026
545 Ga0070677_10402003
546 Ga0068869_100130952
547 Ga0070680_100033234
548 Ga0070680_100056852
549 Ga0070682_101723661
550 Ga0068868_100082231
551 Ga0068868_100661548
552 Ga0070660_100087202
553 Ga0070689_100112627
554 Ga0070689_101430112
555 Ga0070691_10889053
556 Ga0070687_100110146
557 Ga0070687_100470410
558 Ga0070661_100335215
559 Ga0070661_100579829
560 Ga0070692_10080453
561 Ga0070692_10611145
562 Ga0070668_100263099
563 Ga0070669_100766681
564 Ga0070675_100169947
565 Ga0070675_100766574
566 Ga0070675_101510313
567 Ga0070671_100093976
568 Ga0070671_100458779
569 Ga0070671_100950067
570 Ga0070674_100014665
571 Ga0070674_100082675
572 Ga0070674_100284159
573 Ga0070674_100298674
574 Ga0070673_100493529
575 Ga0070673_101624626
576 Ga0070688_100839879
577 Ga0070659_100339862
578 Ga0070659_100536017
579 Ga0070659_101888360
580 Ga0070667_101324462
581 Ga0070667_101532739
582 Ga0070709_11324770
583 Ga0070709_11719891
584 Ga0070714_100272774
585 Ga0070714_101433076
586 Ga0070714_101939618
587 Ga0070713_100321601
588 Ga0070713_100477204
589 Ga0070713_100609585
590 Ga0070713_102111861
591 Ga0070710_10027858
592 Ga0070710_10359840
593 Ga0070710_10446072
594 Ga0070701_10163273
595 Ga0070711_100054693
596 Ga0070711_100187727
597 Ga0070711_100503978
598 Ga0070705_100065987
599 Ga0070705_100946324
600 Ga0070700_100113034
601 Ga0070700_100211473
602 Ga0070700_100249453
603 Ga0070700_100835882
604 Ga0070694_100377409
605 Ga0070663_100023629
606 Ga0070663_100473730
607 Ga0070678_100058479
608 Ga0070678_101015873
609 Ga0070678_101621212
610 Ga0070662_100217006
611 Ga0070662_100544696
612 Ga0070681_10079126
613 Ga0070681_10671641
614 Ga0068867_100050762
615 Ga0070685_10012043
616 Ga0070679_100023453
617 Ga0070679_100674648
618 Ga0070684_100005603
619 Ga0070684_100048080
620 Ga0070684_100053202
621 Ga0070684_100075158
622 Ga0070684_100141575
623 Ga0070697_101250368
624 Ga0068853_101227199
625 Ga0070672_100067005
626 Ga0070672_101239196
627 Ga0070686_100049514
628 Ga0070686_101313133
629 Ga0070695_100265304
630 Ga0070695_100448885
631 Ga0070696_100147984
632 Ga0070696_100149693
633 Ga0070693_100024642
634 Ga0070693_100092871
635 Ga0070693_101138180
636 Ga0070693_101142589
637 Ga0070665_100534530
638 Ga0070665_100920462
639 Ga0070704_100054528
640 Ga0070704_100492941
641 Ga0070704_101064406
642 Ga0068855_101791715
643 Ga0070664_100090126
644 Ga0070664_100295980
645 Ga0070664_100538624
646 Ga0070664_100720580
647 Ga0070664_101622311
648 Ga0068857_100006768
649 Ga0068857_100146607
650 Ga0068857_100220576
651 Ga0068857_100513828
652 Ga0068857_100647126
653 Ga0068854_101507189
654 Ga0068854_101745895
655 Ga0068856_100008004
656 Ga0068856_100748777
657 Ga0068856_100967699
658 Ga0068856_101707485
659 Ga0070702_100079625
660 Ga0070702_100149581
661 Ga0070702_101537172
662 Ga0068852_101014265
663 Ga0068859_100158202
664 Ga0068859_100358714
665 Ga0068859_100588506
666 Ga0068864_100131608
667 Ga0068864_100627088
668 Ga0068866_10112370
669 Ga0068866_11133297
670 Ga0068861_100234244
671 Ga0068861_101492073
672 Ga0068870_11053316
673 Ga0068870_11139325
674 Ga0068863_100296455
675 Ga0068858_100087738
676 Ga0068860_100219330
677 Ga0068860_100381322
678 Ga0081455_10005990
679 Ga0081455_10020154
680 Ga0081455_10022710
681 Ga0081455_10078921
682 Ga0081455_10235533
683 Ga0081455_10965237
684 Ga0081538_10000016
685 Ga0081538_10000076
686 Ga0081538_10029512
687 Ga0081538_10300216
688 Ga0081539_10049182
689 Ga0070717_10087572
690 Ga0070717_10126823
691 Ga0070717_10176540
692 Ga0070717_11511876
693 Ga0075368_10219660
694 Ga0075363_100016546
695 Ga0075432_10229639
696 Ga0075432_10266741
697 Ga0070715_10000655
698 Ga0070716_100025832
699 Ga0070716_100042855
700 Ga0070716_100591927
701 Ga0070716_100945618
702 Ga0070716_101415473
703 Ga0070712_100024344
704 Ga0070712_100062042
705 Ga0070712_100136490
706 Ga0070712_100186151
707 Ga0070712_100861424
708 Ga0070712_100956806
709 Ga0097621_100071525
710 Ga0097621_100087796
711 Ga0097621_100256905
712 Ga0068871_100085624
713 Ga0068871_100187503
714 Ga0075428_100106827
715 Ga0075428_101382061
716 Ga0075428_101812215
717 Ga0075428_102393243
718 Ga0075430_100006028
719 Ga0075430_100024100
720 Ga0075430_100196179
721 Ga0075431_100000291
722 Ga0075431_100036055
723 Ga0075431_100197180
724 Ga0075431_101401420
725 Ga0075433_10010120
726 Ga0075433_10795297
727 Ga0075434_100016491
728 Ga0075434_100225173
729 Ga0075429_100068834
730 Ga0068865_100047402
731 Ga0068865_100293878
732 Ga0068865_100925507
733 Ga0075436_100047515
734 Ga0097620_100158207
735 Ga0097620_100358702
736 Ga0097620_100588458
737 Ga0075435_100009308
738 Ga0105250_10376777
739 Ga0105240_11046098
740 Ga0111539_10004117
741 Ga0111539_10004170
742 Ga0111539_10037469
743 Ga0111539_11073331
744 Ga0111539_11241946
745 Ga0105245_10016528
746 Ga0105245_10038330
747 Ga0105245_10111036
748 Ga0105245_10316836
749 Ga0105245_10882902
750 Ga0105247_10294298
751 Ga0114129_10004175
752 Ga0114129_10050162
753 Ga0114129_10115619
754 Ga0114129_10196412
755 Ga0105243_10006213
756 Ga0105243_10066690
757 Ga0105243_10349756
758 Ga0105243_10444185
759 Ga0105241_10186361
760 Ga0105241_10235117
761 Ga0105241_10697093
762 Ga0105242_10083036
763 Ga0105242_10105571
764 Ga0105242_10117696
765 Ga0105242_10200373
766 Ga0105248_10014467
767 Ga0105248_10094608
768 Ga0105248_11480961
769 Ga0105237_10324897
770 Ga0105238_10155323
771 Ga0105238_10630668
772 Ga0105249_10249654
773 Ga0105249_10840213
774 Ga0105249_11362921
775 Ga0105249_11608655
776 Ga0105239_10063671
777 Ga0105239_10321082
778 Ga0105246_10042533
779 Ga0105246_10198342
780 Ga0105246_10495819
781 Ga0105246_10746944
782 Ga0157373_10073393
783 Ga0157371_10143899
784 Ga0157374_10185207
785 Ga0157374_10275110
786 Ga0157378_10009966
787 Ga0157378_12207601
788 Ga0157378_12334382
789 Ga0163162_10427295
790 Ga0163162_12541306
791 Ga0157375_10046881
792 Ga0157375_10049893
793 Ga0163163_10033803
794 Ga0163163_10033968
795 Ga0157380_10229131
796 Ga0157380_10516684
797 Ga0182008_10147317
798 Ga0157377_10014493
799 Ga0157377_10309974
800 Ga0157377_10615406
801 Ga0157377_11166075
802 Ga0157379_10012021
803 Ga0157379_10712157
804 Ga0157379_12212106
805 Ga0157376_10177433
806 Ga0157376_11172306
807 Ga0163161_10912534
808 Ga0206356_11303778
809 Ga0154015_1114968
810 Ga0207697_10274211
811 Ga0207682_10346822
812 Ga0207692_10075884
813 Ga0207642_10389777
814 Ga0207688_10012881
815 Ga0207647_10127582
816 Ga0207685_10089371
817 Ga0207685_10605116
818 Ga0207699_10768856
819 Ga0207645_10158601
820 Ga0207643_10102433
821 Ga0207654_10285020
822 Ga0207654_10705005
823 Ga0207707_10062139
824 Ga0207693_10183732
825 Ga0207693_10206724
826 Ga0207693_10644713
827 Ga0207693_10693679
828 Ga0207663_10047549
829 Ga0207663_10111037
830 Ga0207660_10103423
831 Ga0207660_10310577
832 Ga0207662_10430705
833 Ga0207657_10087135
834 Ga0207657_10172591
835 Ga0207649_10092123
836 Ga0207649_10505069
837 Ga0207652_10020432
838 Ga0207652_11290899
839 Ga0207681_10223830
840 Ga0207694_10482726
841 Ga0207694_10745137
842 Ga0207650_11209005
843 Ga0207659_10589545
844 Ga0207687_10027376
845 Ga0207700_10267273
846 Ga0207700_10345252
847 Ga0207700_10580414
848 Ga0207664_10064567
849 Ga0207664_10111850
850 Ga0207644_10617573
851 Ga0207644_11685859
852 Ga0207690_10096213
853 Ga0207690_10212487
854 Ga0207690_11102714
855 Ga0207706_10256458
856 Ga0207686_10040504
857 Ga0207709_10106026
858 Ga0207709_10483160
859 Ga0207670_10564780
860 Ga0207704_10199588
861 Ga0207665_10001453
862 Ga0207691_10411231
863 Ga0207691_11437031
864 Ga0207689_10442799
865 Ga0207689_10813188
866 Ga0207661_10004691
867 Ga0207661_10015094
868 Ga0207661_10481988
869 Ga0207679_10240104
870 Ga0207679_10341949
871 Ga0207679_10413450
872 Ga0207667_10861531
873 Ga0207651_10236700
874 Ga0207651_10917071
875 Ga0207668_10430554
876 Ga0207668_11692416
877 Ga0207640_10509430
878 Ga0207640_10761898
879 Ga0207677_10016163
880 Ga0207677_10248759
881 Ga0207677_11438965
882 Ga0207678_10016349
883 Ga0207678_10026630
884 Ga0207678_10271253
885 Ga0207708_10045513
886 Ga0207708_10069650
887 Ga0207708_10127487
888 Ga0207708_10218105
889 Ga0207708_11117696
890 Ga0207702_10029504
891 Ga0207702_10275942
892 Ga0207641_11569458
893 Ga0207648_10128169
894 Ga0207648_10132850
895 Ga0207648_10609587
896 Ga0207676_10110125
897 Ga0207674_10005269
898 Ga0207674_11949661
899 Ga0207675_100135972
900 Ga0207683_10110811
901 Ga0207698_11522302
902 Ga0209966_1047064
903 Ga0209998_10078303
904 Ga0207428_10013510
905 Ga0207428_10041659
906 Ga0268266_10493364
907 Ga0268265_10333817
908 Ga0268264_12518180
909 Ga0265339_10212402
910 Ga0307410_10379603
911 Ga0307409_100539208
912 Ga0307416_100447056
913 Ga0307416_103691059
914 Ga0307411_11692153
915 Ga0373958_0013475
916 Ga0373932_0112779
917 Ga0373960_0020717
918 Ga0373962_0013287
919 Ga0373931_0410602
920 Ga0373931_0452171
921 Ga0373937_0501719
922 Ga0395905_0032653
923 Ga0451845_0651047
924 Ga0439448_0165153
925 Ga0439450_047938
926 Ga0466964_0684258
927 Ga0466971_0074267
928 Ga0466957_0000509
929 Ga0466967_0004610
930 Ga0495641_0278549
931 Ga0495651_0397171
932 Ga0495582_0428490
933 Ga0495596_0228931
934 Ga0495630_0161527
935 Ga0495644_0229577
936 Ga0495652_0525891
937 Ga0495586_0012642
938 Ga0495667_0193266
939 Ga0495668_0357214
940 Ga0495634_0029974
941 Ga0495589_0048059
942 Ga0495680_0111414
943 Ga0495680_0389670
944 Ga0495677_0375722
945 Ga0495602_0043104
946 Ga0496100_0117513
947 Ga0496100_0556975
948 Ga0496100_1208576
949 Ga0496101_0053032
950 Ga0496101_0145320
951 Ga0496101_0183645
952 Ga0496101_0657061
953 Ga0496102_0164554
954 Ga0496102_0820560
955 Ga0496103_0005898
956 Ga0496103_0187715
957 Ga0496103_0554450
958 Ga0496103_0668595
959 Ga0496104_0003031
960 Ga0496104_0015893
961 Ga0496104_0215341
962 Ga0496105_0001301
963 Ga0496105_0021824
964 Ga0496105_0030204
965 Ga0496106_0051453
966 Ga0496106_0248315
967 Ga0496106_0335663
968 Ga0496106_1412653
969 Ga0496107_0074609
970 Ga0496107_0156314
971 Ga0496107_0213527
972 Ga0496108_0001139
973 Ga0496108_0002738
974 Ga0496108_1468906
975 Ga0496109_0007510
976 Ga0496109_0022413
977 Ga0496109_0891601
978 Ga0496110_0000591
979 Ga0496111_0000183
980 Ga0496111_0006096
981 Ga0496111_0809692
982 Ga0496112_0008015
983 Ga0496112_0772620
984 Ga0496112_1430719
985 Ga0496113_0001248
986 Ga0496113_0664211
987 Ga0496113_1045224
988 Ga0496114_0005362
989 Ga0496114_0108971
990 Ga0496115_0014681
991 Ga0496115_0031052
992 Ga0496115_0067814
993 Ga0501306_074400
994 Ga0501306_090943
995 Ga0501310_073601
996 Ga0501318_083357
997 Ga0501321_068459
998 Ga0501322_020815
999 Ga0501323_032453
1000 Ga0501033_0494580
1001 Ga0501036_0033882
1002 Ga0501036_0131752
1003 Ga0501038_0380945
1004 Ga0501039_1196062
1005 Ga0501040_0004157
1006 Ga0501040_0111020
1007 Ga0501041_0029170
1008 Ga0501041_0194975
1009 Ga0501042_0033922
1010 Ga0501042_0598251
1011 Ga0501046_0027728
1012 Ga0501046_0178613
1013 Ga0501048_0057249
1014 Ga0501048_0058225
1015 Ga0501067_0285165
1016 Ga0501067_0597733
1017 Ga0501068_0022220
1018 Ga0501068_0102027
1019 Ga0501069_0022994
1020 Ga0501069_0300277
1021 Ga0501069_0321354
1022 Ga0501070_0256247
1023 Ga0501071_0083821
1024 Ga0501071_0122326
1025 Ga0501071_0709732
1026 Ga0501072_0004414
1027 Ga0501072_0005527
1028 Ga0501072_0232531
1029 Ga0501072_0991127
1030 Ga0501073_0045850
1031 Ga0501074_0004044
1032 Ga0501074_0047145
1033 Ga0501075_0002456
1034 Ga0501075_0005034
1035 Ga0501075_0842785
1036 Ga0501076_0003752
1037 Ga0501076_0085965
1038 Ga0501076_0417255
1039 Ga0501077_0028160
1040 Ga0501077_0031878
1041 Ga0501079_0676402
1042 Ga0501080_0422343
1043 Ga0501081_0002626
1044 Ga0501081_0015564
1045 Ga0501081_1379672
1046 Ga0501083_0896646
1047 Ga0501035_0352496
1048 Ga0501044_0766379
1049 Ga0501045_0000582
1050 Ga0501045_0006308
1051 Ga0501045_1336007
1052 nmdc:mga04h51_187946_c1
1053 nmdc:mga05p37_8652_c1
1054 nmdc:mga06r32_198470_c1
1055 nmdc:mga08y16_33053_c1
1056 nmdc:mga0n895_9074_c1
1057 nmdc:mga0rr50_2960_c1
1058 nmdc:mga08x19_42355_c1
1059 nmdc:mga0a205_5546_c1
1060 Ga0501084_0004673
1061 Ga0501084_0019062
1062 Ga0501082_0008247
1063 Ga0501082_0020058
1064 Ga0501082_1253860
1065 Ga0466962_0259574
1066 Ga0530510_0003595
1067 Ga0530510_0004252
1068 Ga0530510_0297723

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04070

DUF378

Domain of unknown function (DUF378)

20

81

0.93

Map