F460476

General Info

Members Datasets Scaffolds Average Seq Length
533 230 1066 324

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_65574_c1|nmdc:mga05p37_65574_c1_2487_3527
Length 338
Sequence LAIGKNVIFSIILAMRIHVLALDGVFDLGLSAVLDTFQTANELIEMTGVAVPPFDVRLVGVRAAVTTSHGLSVPVQGAGRRAPDCIVVPAIGFKMPEPLETALARPDIADATSLLRRWADRDSMVAAACIGTFVVAESGLLDHLAPLFRKRYPNVLLDESNMIVKSGGFVTAGAALSHLDLALWLVRGASPQLAALTAKYLIVDSRPSQSAYALTDHLVHDDAIVQRFERWARARLTRGFSLDDAAKATGASKRTLARHMQRVLGKSPLSYFQSLRIERAVHLLKTGDASVDEVAARVGYADGTTLRTLLRRRLNVGIKEIRNASLTSVPPRRPRELR

Samples

Sample ID Description Type Environment
1 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
165 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
166 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
167 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
168 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
169 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
170 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
171 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
172 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
181 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
182 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
183 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
184 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
185 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
186 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
187 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
188 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
189 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
190 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
191 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
192 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
193 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
194 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
195 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
196 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
197 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
198 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
199 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
200 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
201 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
202 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
203 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
204 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
205 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
206 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
215 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
216 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
217 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
218 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
219 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
220 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
224 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
225 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
226 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
227 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
228 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
229 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
230 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.13
Nodule 0
Rhizoplane 2.06
Rhizosphere 96.81
Stem 0
Stem Tuber 0
Unclassified 12.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga05p37_65574_c1 3300050507 Bacteria 4467
2 MRS1b_contig_1063388 2162886011 Bacteria 2448
3 Ga0065704_10010495 3300005289 Bacteria 1814
4 Ga0065712_10000181 3300005290 Bacteria 61982
5 Ga0065715_10091995 3300005293 Bacteria 5403
6 Ga0065715_10116160 3300005293 Bacteria 2390
7 Ga0065715_10118481 3300005293 Bacteria 2295
8 Ga0065715_10169915 3300005293 Bacteria 1555
9 Ga0065707_10009653 3300005295 Bacteria 2001
10 Ga0065707_10018542 3300005295 Bacteria 1298
11 Ga0065707_10020857 3300005295 Bacteria 1577
12 Ga0070676_10001714 3300005328 Bacteria 11169
13 Ga0070683_100007831 3300005329 Bacteria 9048
14 Ga0070683_100033350 3300005329 Bacteria 4695
15 Ga0070683_100080508 3300005329 Unclassified 3049
16 Ga0070690_100034384 3300005330 Bacteria 3176
17 Ga0070690_100069116 3300005330 Bacteria 2292
18 Ga0070670_100042393 3300005331 Bacteria 3912
19 Ga0070677_10129633 3300005333 Bacteria 1150
20 Ga0068869_100011931 3300005334 Bacteria 5718
21 Ga0068869_100024186 3300005334 Bacteria 4206
22 Ga0070680_100083119 3300005336 Bacteria 2644
23 Ga0070682_100190727 3300005337 Bacteria 1439
24 Ga0068868_100000992 3300005338 Bacteria 19360
25 Ga0068868_100004038 3300005338 Bacteria 10230
26 Ga0068868_100037543 3300005338 Bacteria 3756
27 Ga0070660_100016878 3300005339 Bacteria 5311
28 Ga0070660_100281614 3300005339 Bacteria 1360
29 Ga0070689_100015959 3300005340 Bacteria 5490
30 Ga0070689_100110624 3300005340 Bacteria 2184
31 Ga0070689_100226082 3300005340 Bacteria 1537
32 Ga0070689_100311114 3300005340 Bacteria 1313
33 Ga0070687_100044080 3300005343 Bacteria 2271
34 Ga0070661_100068497 3300005344 Bacteria 2608
35 Ga0070661_100128176 3300005344 Unclassified 1904
36 Ga0070661_100174717 3300005344 Bacteria 1632
37 Ga0070692_10030497 3300005345 Bacteria 2696
38 Ga0070668_100003262 3300005347 Bacteria 11962
39 Ga0070668_100008341 3300005347 Bacteria 7694
40 Ga0070668_100093583 3300005347 Bacteria 2372
41 Ga0070669_100004190 3300005353 Bacteria 10450
42 Ga0070669_100011668 3300005353 Bacteria 6233
43 Ga0070675_100007847 3300005354 Bacteria 8272
44 Ga0070675_100008322 3300005354 Bacteria 8046
45 Ga0070675_100024016 3300005354 Bacteria 4879
46 Ga0070675_100030291 3300005354 Bacteria 4367
47 Ga0070675_100154296 3300005354 Bacteria 1971
48 Ga0070671_100030633 3300005355 Bacteria 4440
49 Ga0070671_100192082 3300005355 Bacteria 1730
50 Ga0070671_100367911 3300005355 Bacteria 1228
51 Ga0070674_100354413 3300005356 Bacteria 1186
52 Ga0070673_100045597 3300005364 Bacteria 3400
53 Ga0070673_100193163 3300005364 Unclassified 1750
54 Ga0070688_100024007 3300005365 Bacteria 3592
55 Ga0070688_100028432 3300005365 Bacteria 3337
56 Ga0070688_100071153 3300005365 Bacteria 2226
57 Ga0070688_100132463 3300005365 Bacteria 1684
58 Ga0070659_100094434 3300005366 Bacteria 2402
59 Ga0070659_100109191 3300005366 Bacteria 2232
60 Ga0070659_100120430 3300005366 Bacteria 2125
61 Ga0070659_100146753 3300005366 Unclassified 1922
62 Ga0070659_100177745 3300005366 Unclassified 1746
63 Ga0070667_100013719 3300005367 Bacteria 6697
64 Ga0070667_100101715 3300005367 Bacteria 2483
65 Ga0070667_100358635 3300005367 Bacteria 1321
66 Ga0070709_10002703 3300005434 Bacteria 9582
67 Ga0070709_10017457 3300005434 Bacteria 4117
68 Ga0070713_100030831 3300005436 Bacteria 4264
69 Ga0070713_100076600 3300005436 Bacteria 2841
70 Ga0070713_100090281 3300005436 Bacteria 2633
71 Ga0070713_100106160 3300005436 Bacteria 2441
72 Ga0070701_10022756 3300005438 Bacteria 3008
73 Ga0070711_100040031 3300005439 Plasmid 3159
74 Ga0070705_100020384 3300005440 Bacteria 3508
75 Ga0070700_100009677 3300005441 Bacteria 5296
76 Ga0070700_100021393 3300005441 Bacteria 3759
77 Ga0070700_100115883 3300005441 Bacteria 1788
78 Ga0070694_100130286 3300005444 Bacteria 1816
79 Ga0070708_100000812 3300005445 Bacteria 23564
80 Ga0070708_100118004 3300005445 Bacteria 2444
81 Ga0070663_100008546 3300005455 Bacteria 6306
82 Ga0070678_100031413 3300005456 Bacteria 3663
83 Ga0070678_100225065 3300005456 Bacteria 1561
84 Ga0070662_100004859 3300005457 Bacteria 8524
85 Ga0070662_100084704 3300005457 Bacteria 2368
86 Ga0070662_100100647 3300005457 Bacteria 2187
87 Ga0070662_100155204 3300005457 Bacteria 1786
88 Ga0070662_100221664 3300005457 Bacteria 1509
89 Ga0068867_100245972 3300005459 Bacteria 1452
90 Ga0070685_10016912 3300005466 Bacteria 3893
91 Ga0070685_10017064 3300005466 Bacteria 3879
92 Ga0070707_100088426 3300005468 Bacteria 2997
93 Ga0070707_100319810 3300005468 Bacteria 1508
94 Ga0070699_100002723 3300005518 Bacteria 15762
95 Ga0070684_100018414 3300005535 Bacteria 5753
96 Ga0070684_100219575 3300005535 Unclassified 1734
97 Ga0070684_100315223 3300005535 Bacteria 1436
98 Ga0070697_100006603 3300005536 Bacteria 8993
99 Ga0070697_100047552 3300005536 Bacteria 3478
100 Ga0068853_100050847 3300005539 Unclassified 3565
101 Ga0068853_100060172 3300005539 Unclassified 3281
102 Ga0070672_100000133 3300005543 Bacteria 39180
103 Ga0070672_100123246 3300005543 Bacteria 2124
104 Ga0070672_100136359 3300005543 Bacteria 2021
105 Ga0070672_100215435 3300005543 Bacteria 1609
106 Ga0070672_100255588 3300005543 Bacteria 1476
107 Ga0070672_100275853 3300005543 Bacteria 1421
108 Ga0070686_100056502 3300005544 Bacteria 2518
109 Ga0070686_100178460 3300005544 Bacteria 1507
110 Ga0070686_100320229 3300005544 Bacteria 1156
111 Ga0070696_100101313 3300005546 Bacteria 2064
112 Ga0070665_100031979 3300005548 Bacteria 5296
113 Ga0070665_100253595 3300005548 Bacteria 1760
114 Ga0070704_100172180 3300005549 Bacteria 1723
115 Ga0068855_100122995 3300005563 Bacteria 2969
116 Ga0070664_100025838 3300005564 Bacteria 4868
117 Ga0070664_100064185 3300005564 Bacteria 3132
118 Ga0070664_100150451 3300005564 Bacteria 2055
119 Ga0068857_100000158 3300005577 Bacteria 42040
120 Ga0068857_100032742 3300005577 Bacteria 4595
121 Ga0068857_100054781 3300005577 Bacteria 3540
122 Ga0068857_100056796 3300005577 Bacteria 3474
123 Ga0068857_100240779 3300005577 Bacteria 1656
124 Ga0068857_100440573 3300005577 Bacteria 1217
125 Ga0068854_100379894 3300005578 Unclassified 1164
126 Ga0070702_100019600 3300005615 Bacteria 3532
127 Ga0068852_100024984 3300005616 Bacteria 4835
128 Ga0068852_100253644 3300005616 Bacteria 1686
129 Ga0068852_100470313 3300005616 Unclassified 1247
130 Ga0068859_100059601 3300005617 Bacteria 3846
131 Ga0068859_100064955 3300005617 Bacteria 3683
132 Ga0068859_100203520 3300005617 Bacteria 2064
133 Ga0068859_100236809 3300005617 Unclassified 1914
134 Ga0068859_100344537 3300005617 Bacteria 1585
135 Ga0068864_100000046 3300005618 Bacteria 151661
136 Ga0068864_100071610 3300005618 Bacteria 3019
137 Ga0068864_100078866 3300005618 Bacteria 2883
138 Ga0068864_100097007 3300005618 Bacteria 2610
139 Ga0068864_100130689 3300005618 Bacteria 2255
140 Ga0068864_100403381 3300005618 Bacteria 1299
141 Ga0068866_10025917 3300005718 Bacteria 2762
142 Ga0068861_100002345 3300005719 Bacteria 12313
143 Ga0068870_10003054 3300005840 Bacteria 7052
144 Ga0068870_10050950 3300005840 Bacteria 2189
145 Ga0068870_10056433 3300005840 Bacteria 2096
146 Ga0068870_10163992 3300005840 Bacteria 1321
147 Ga0068863_100005119 3300005841 Bacteria 12928
148 Ga0068863_100253141 3300005841 Unclassified 1701
149 Ga0068863_100312439 3300005841 Bacteria 1526
150 Ga0068858_100044812 3300005842 Bacteria 4099
151 Ga0068858_100141861 3300005842 Bacteria 2255
152 Ga0068858_100267024 3300005842 Unclassified 1627
153 Ga0068860_100030406 3300005843 Bacteria 5194
154 Ga0068860_100039324 3300005843 Bacteria 4523
155 Ga0068860_100108896 3300005843 Bacteria 2648
156 Ga0068860_100116441 3300005843 Bacteria 2557
157 Ga0068860_100209318 3300005843 Bacteria 1891
158 Ga0068862_100000429 3300005844 Bacteria 45681
159 Ga0068862_100002305 3300005844 Bacteria 17036
160 Ga0068862_100011597 3300005844 Bacteria 7272
161 Ga0068862_100016382 3300005844 Bacteria 6169
162 Ga0068862_100153931 3300005844 Bacteria 2048
163 Ga0070717_10083648 3300006028 Plasmid 2684
164 Ga0070716_100053272 3300006173 Bacteria 2306
165 Ga0070712_100040179 3300006175 Bacteria 3206
166 Ga0070712_100188708 3300006175 Bacteria 1611
167 Ga0097621_100001745 3300006237 Bacteria 14892
168 Ga0097621_100016271 3300006237 Bacteria 5617
169 Ga0097621_100025968 3300006237 Bacteria 4589
170 Ga0097621_100323385 3300006237 Unclassified 1367
171 Ga0097621_100393447 3300006237 Unclassified 1240
172 Ga0068871_100004424 3300006358 Bacteria 9772
173 Ga0068871_100059349 3300006358 Bacteria 3117
174 Ga0068871_100079447 3300006358 Bacteria 2714
175 Ga0068871_100342190 3300006358 Bacteria 1321
176 Ga0075428_100011452 3300006844 Bacteria 9866
177 Ga0075428_100013349 3300006844 Bacteria 9137
178 Ga0075428_100091957 3300006844 Bacteria 3308
179 Ga0075431_100083732 3300006847 Bacteria 3293
180 Ga0075431_100121695 3300006847 Bacteria 2693
181 Ga0075433_10023427 3300006852 Bacteria 5197
182 Ga0075433_10270807 3300006852 Bacteria 1505
183 Ga0075434_100000866 3300006871 Bacteria 24166
184 Ga0075434_100111577 3300006871 Bacteria 2745
185 Ga0075434_100158297 3300006871 Bacteria 2285
186 Ga0075434_100179496 3300006871 Bacteria 2137
187 Ga0075429_100115114 3300006880 Bacteria 2351
188 Ga0068865_100076710 3300006881 Bacteria 2386
189 Ga0068865_100262711 3300006881 Bacteria 1367
190 Ga0097620_100059602 3300006931 Bacteria 3846
191 Ga0097620_100064953 3300006931 Bacteria 3683
192 Ga0097620_100203529 3300006931 Bacteria 2064
193 Ga0097620_100236814 3300006931 Unclassified 1914
194 Ga0097620_100344519 3300006931 Bacteria 1585
195 Ga0075435_100145626 3300007076 Unclassified 1990
196 Ga0105240_10020879 3300009093 Bacteria 8724
197 Ga0105240_10250189 3300009093 Bacteria 2050
198 Ga0111539_10074555 3300009094 Bacteria 3998
199 Ga0111539_10144917 3300009094 Bacteria 2781
200 Ga0111539_10187546 3300009094 Bacteria 2415
201 Ga0111539_10203337 3300009094 Bacteria 2309
202 Ga0111539_10372055 3300009094 Bacteria 1663
203 Ga0111539_10533356 3300009094 Unclassified 1367
204 Ga0105245_10016784 3300009098 Bacteria 6393
205 Ga0105245_10051023 3300009098 Bacteria 3709
206 Ga0105245_10092276 3300009098 Unclassified 2788
207 Ga0105245_10102488 3300009098 Bacteria 2651
208 Ga0114129_10003511 3300009147 Bacteria 22057
209 Ga0114129_10059398 3300009147 Bacteria 5346
210 Ga0114129_10114143 3300009147 Bacteria 3724
211 Ga0105243_10260288 3300009148 Bacteria 1553
212 Ga0105241_10058166 3300009174 Bacteria 2968
213 Ga0105241_10215114 3300009174 Bacteria 1612
214 Ga0105241_10384412 3300009174 Bacteria 1227
215 Ga0105242_10005778 3300009176 Bacteria 9530
216 Ga0105242_10021633 3300009176 Bacteria 5052
217 Ga0105242_10086811 3300009176 Bacteria 2626
218 Ga0105242_10180988 3300009176 Bacteria 1860
219 Ga0105248_10033858 3300009177 Bacteria 5708
220 Ga0105248_10056148 3300009177 Bacteria 4417
221 Ga0105248_10057488 3300009177 Unclassified 4366
222 Ga0105248_10089216 3300009177 Bacteria 3470
223 Ga0105248_10153308 3300009177 Bacteria 2600
224 Ga0105248_10191181 3300009177 Bacteria 2307
225 Ga0105237_10006912 3300009545 Bacteria 12512
226 Ga0105249_10000884 3300009553 Bacteria 26608
227 Ga0105249_10002252 3300009553 Bacteria 16737
228 Ga0105249_10011990 3300009553 Bacteria 7624
229 Ga0105249_10088161 3300009553 Unclassified 2897
230 Ga0105249_10098181 3300009553 Bacteria 2750
231 Ga0105249_10118343 3300009553 Bacteria 2514
232 Ga0105249_10341224 3300009553 Bacteria 1515
233 Ga0105239_10006869 3300010375 Bacteria 13131
234 Ga0105239_10011320 3300010375 Bacteria 9955
235 Ga0105239_10587205 3300010375 Bacteria 1270
236 Ga0157373_10110382 3300013100 Bacteria 1934
237 Ga0157374_10104854 3300013296 Bacteria 2715
238 Ga0157374_10244257 3300013296 Bacteria 1766
239 Ga0157378_10002692 3300013297 Bacteria 15819
240 Ga0157378_10162787 3300013297 Bacteria 2088
241 Ga0157378_10451558 3300013297 Bacteria 1276
242 Ga0163162_10070990 3300013306 Unclassified 3534
243 Ga0163162_10096982 3300013306 Bacteria 3037
244 Ga0163162_10178627 3300013306 Bacteria 2249
245 Ga0163162_10407456 3300013306 Unclassified 1492
246 Ga0157372_10073847 3300013307 Bacteria 3844
247 Ga0157372_10109687 3300013307 Bacteria 3161
248 Ga0157372_10305541 3300013307 Bacteria 1851
249 Ga0157375_10000002 3300013308 Bacteria 495826
250 Ga0157375_10033929 3300013308 Bacteria 4856
251 Ga0157375_10063919 3300013308 Unclassified 3663
252 Ga0157375_10112415 3300013308 Bacteria 2824
253 Ga0157375_10117223 3300013308 Bacteria 2768
254 Ga0157375_10197032 3300013308 Unclassified 2169
255 Ga0157375_10294138 3300013308 Bacteria 1787
256 Ga0157375_10604105 3300013308 Bacteria 1256
257 Ga0163163_10033011 3300014325 Bacteria 5003
258 Ga0163163_10036870 3300014325 Bacteria 4752
259 Ga0163163_10104583 3300014325 Bacteria 2857
260 Ga0163163_10213996 3300014325 Bacteria 1976
261 Ga0163163_10281190 3300014325 Bacteria 1715
262 Ga0163163_10287777 3300014325 Bacteria 1695
263 Ga0157380_10019207 3300014326 Bacteria 5091
264 Ga0157380_10033762 3300014326 Bacteria 3942
265 Ga0157380_10137967 3300014326 Unclassified 2090
266 Ga0157377_10005429 3300014745 Bacteria 5990
267 Ga0157377_10009827 3300014745 Bacteria 4713
268 Ga0157379_10019753 3300014968 Bacteria 5954
269 Ga0157379_10072057 3300014968 Bacteria 3091
270 Ga0157376_10011896 3300014969 Bacteria 6435
271 Ga0157376_10013579 3300014969 Bacteria 6084
272 Ga0157376_10085886 3300014969 Bacteria 2712
273 Ga0163161_10011106 3300017792 Bacteria 6239
274 Ga0163161_10187636 3300017792 Bacteria 1588
275 Ga0163161_10253781 3300017792 Bacteria 1372
276 Ga0209050_1015963 3300025298 Bacteria 3108
277 Ga0209051_1006139 3300025303 Bacteria 6825
278 Ga0209257_1000016 3300025304 Bacteria 908015
279 Ga0209257_1024669 3300025304 Bacteria 2076
280 Ga0207697_10007088 3300025315 Bacteria 5017
281 Ga0207688_10013677 3300025901 Bacteria 4411
282 Ga0207688_10039217 3300025901 Bacteria 2631
283 Ga0207680_10044844 3300025903 Bacteria 2604
284 Ga0207699_10000066 3300025906 Bacteria 83757
285 Ga0207699_10053337 3300025906 Bacteria 2397
286 Ga0207699_10120415 3300025906 Archaea 1696
287 Ga0207645_10000941 3300025907 Bacteria 24192
288 Ga0207645_10029285 3300025907 Bacteria 3551
289 Ga0207645_10049862 3300025907 Bacteria 2673
290 Ga0207643_10006059 3300025908 Bacteria 6461
291 Ga0207643_10006927 3300025908 Bacteria 6078
292 Ga0207643_10011891 3300025908 Bacteria 4698
293 Ga0207643_10033179 3300025908 Bacteria 2888
294 Ga0207643_10043116 3300025908 Bacteria 2545
295 Ga0207707_10283712 3300025912 Bacteria 1434
296 Ga0207707_10371053 3300025912 Bacteria 1231
297 Ga0207695_10136311 3300025913 Bacteria 2407
298 Ga0207695_10162617 3300025913 Bacteria 2163
299 Ga0207693_10055765 3300025915 Bacteria 3100
300 Ga0207693_10064457 3300025915 Bacteria 2870
301 Ga0207693_10110663 3300025915 Bacteria 2154
302 Ga0207660_10035175 3300025917 Unclassified 3476
303 Ga0207662_10105108 3300025918 Bacteria 1754
304 Ga0207662_10412617 3300025918 Bacteria 918
305 Ga0207657_10024733 3300025919 Bacteria 5552
306 Ga0207649_10049943 3300025920 Bacteria 2586
307 Ga0207646_10053331 3300025922 Bacteria 3617
308 Ga0207681_10001349 3300025923 Bacteria 15856
309 Ga0207681_10003246 3300025923 Bacteria 10196
310 Ga0207650_10022091 3300025925 Bacteria 4503
311 Ga0207650_10061244 3300025925 Unclassified 2809
312 Ga0207650_10080976 3300025925 Bacteria 2462
313 Ga0207659_10014126 3300025926 Bacteria 5141
314 Ga0207659_10017148 3300025926 Bacteria 4728
315 Ga0207659_10146011 3300025926 Bacteria 1842
316 Ga0207687_10003166 3300025927 Bacteria 11168
317 Ga0207687_10055309 3300025927 Bacteria 2780
318 Ga0207700_10030180 3300025928 Bacteria 3836
319 Ga0207700_10049649 3300025928 Bacteria 3122
320 Ga0207700_10091800 3300025928 Bacteria 2399
321 Ga0207700_10113201 3300025928 Bacteria 2187
322 Ga0207644_10366503 3300025931 Bacteria 1173
323 Ga0207690_10089560 3300025932 Bacteria 2170
324 Ga0207690_10136419 3300025932 Bacteria 1802
325 Ga0207706_10014329 3300025933 Bacteria 7186
326 Ga0207706_10084088 3300025933 Bacteria 2797
327 Ga0207706_10093200 3300025933 Bacteria 2649
328 Ga0207706_10115999 3300025933 Bacteria 2355
329 Ga0207686_10005561 3300025934 Bacteria 6755
330 Ga0207670_10003969 3300025936 Bacteria 7899
331 Ga0207670_10035244 3300025936 Bacteria 3243
332 Ga0207669_10035825 3300025937 Bacteria 2829
333 Ga0207704_10053569 3300025938 Bacteria 2453
334 Ga0207704_10061211 3300025938 Unclassified 2334
335 Ga0207665_10021925 3300025939 Bacteria 4200
336 Ga0207691_10000489 3300025940 Bacteria 39336
337 Ga0207691_10022099 3300025940 Bacteria 6002
338 Ga0207691_10033377 3300025940 Bacteria 4792
339 Ga0207691_10133724 3300025940 Bacteria 2189
340 Ga0207691_10146227 3300025940 Bacteria 2081
341 Ga0207711_10008252 3300025941 Bacteria 8722
342 Ga0207711_10068567 3300025941 Bacteria 3072
343 Ga0207711_10081297 3300025941 Bacteria 2831
344 Ga0207711_10189523 3300025941 Bacteria 1874
345 Ga0207711_10215631 3300025941 Bacteria 1754
346 Ga0207689_10012041 3300025942 Bacteria 7413
347 Ga0207689_10019266 3300025942 Bacteria 5753
348 Ga0207689_10034157 3300025942 Bacteria 4224
349 Ga0207689_10242486 3300025942 Bacteria 1490
350 Ga0207689_10267148 3300025942 Bacteria 1416
351 Ga0207661_10053198 3300025944 Unclassified 3239
352 Ga0207661_10055605 3300025944 Bacteria 3175
353 Ga0207679_10003148 3300025945 Bacteria 10188
354 Ga0207679_10034261 3300025945 Bacteria 3580
355 Ga0207679_10208743 3300025945 Bacteria 1636
356 Ga0207679_10214034 3300025945 Bacteria 1618
357 Ga0207679_10240312 3300025945 Unclassified 1534
358 Ga0207651_10230728 3300025960 Bacteria 1502
359 Ga0207712_10001250 3300025961 Bacteria 17553
360 Ga0207712_10001785 3300025961 Bacteria 14297
361 Ga0207712_10004318 3300025961 Bacteria 8977
362 Ga0207712_10005777 3300025961 Bacteria 7794
363 Ga0207668_10004434 3300025972 Bacteria 8244
364 Ga0207668_10018727 3300025972 Bacteria 4365
365 Ga0207668_10065239 3300025972 Bacteria 2576
366 Ga0207640_10193041 3300025981 Unclassified 1536
367 Ga0207658_10138073 3300025986 Bacteria 1969
368 Ga0207658_10166501 3300025986 Bacteria 1811
369 Ga0207677_10000069 3300026023 Bacteria 85177
370 Ga0207677_10035490 3300026023 Bacteria 3239
371 Ga0207677_10362872 3300026023 Bacteria 1217
372 Ga0207703_10123784 3300026035 Bacteria 2223
373 Ga0207703_10153297 3300026035 Unclassified 2011
374 Ga0207703_10419566 3300026035 Bacteria 1245
375 Ga0207639_10174930 3300026041 Unclassified 1821
376 Ga0207678_10025738 3300026067 Bacteria 5135
377 Ga0207708_10005035 3300026075 Bacteria 9746
378 Ga0207708_10053558 3300026075 Bacteria 3074
379 Ga0207708_10084889 3300026075 Bacteria 2435
380 Ga0207641_10021369 3300026088 Bacteria 5319
381 Ga0207641_10066872 3300026088 Bacteria 3077
382 Ga0207641_10381654 3300026088 Bacteria 1350
383 Ga0207648_10006525 3300026089 Bacteria 11578
384 Ga0207648_10009283 3300026089 Bacteria 9435
385 Ga0207648_10036547 3300026089 Bacteria 4327
386 Ga0207648_10062126 3300026089 Bacteria 3257
387 Ga0207648_10182295 3300026089 Bacteria 1859
388 Ga0207676_10000008 3300026095 Bacteria 588913
389 Ga0207676_10002682 3300026095 Bacteria 12654
390 Ga0207676_10069968 3300026095 Bacteria 2812
391 Ga0207676_10106454 3300026095 Bacteria 2337
392 Ga0207676_10117306 3300026095 Bacteria 2238
393 Ga0207676_10129389 3300026095 Bacteria 2144
394 Ga0207676_10350078 3300026095 Bacteria 1366
395 Ga0207676_10443836 3300026095 Bacteria 1222
396 Ga0207674_10000122 3300026116 Bacteria 90389
397 Ga0207674_10002153 3300026116 Bacteria 24913
398 Ga0207674_10003187 3300026116 Bacteria 20200
399 Ga0207674_10048737 3300026116 Bacteria 4335
400 Ga0207674_10112641 3300026116 Unclassified 2694
401 Ga0207674_10141173 3300026116 Bacteria 2368
402 Ga0207674_10149312 3300026116 Bacteria 2295
403 Ga0207675_100000379 3300026118 Bacteria 42654
404 Ga0207675_100000518 3300026118 Bacteria 37487
405 Ga0207675_100002313 3300026118 Bacteria 18927
406 Ga0207675_100541507 3300026118 Bacteria 1162
407 Ga0207683_10009477 3300026121 Bacteria 8296
408 Ga0207683_10345897 3300026121 Bacteria 1364
409 Ga0207698_10277397 3300026142 Bacteria 1549
410 Ga0207428_10213072 3300027907 Unclassified 1451
411 Ga0268266_10051330 3300028379 Bacteria 3540
412 Ga0268266_10064583 3300028379 Unclassified 3163
413 Ga0268265_10003411 3300028380 Bacteria 11433
414 Ga0268265_10110289 3300028380 Bacteria 2245
415 Ga0268265_10122289 3300028380 Bacteria 2146
416 Ga0268265_10168222 3300028380 Unclassified 1870
417 Ga0268265_10333791 3300028380 Bacteria 1378
418 Ga0268264_10037558 3300028381 Bacteria 3994
419 Ga0268264_10078992 3300028381 Bacteria 2806
420 Ga0268264_10109471 3300028381 Bacteria 2417
421 Ga0268264_10126948 3300028381 Bacteria 2256
422 Ga0307408_100166221 3300031548 Bacteria 1757
423 Ga0307406_10275428 3300031901 Bacteria 1280
424 Ga0307412_10202561 3300031911 Bacteria 1508
425 Ga0307411_10163579 3300032005 Bacteria 1670
426 Ga0373930_0012689 3300034816 Bacteria 1541
427 Ga0373958_0009634 3300034819 Bacteria 1593
428 Ga0373934_0052818 3300035086 Bacteria 1612
429 Ga0373932_0013978 3300035112 Bacteria 2009
430 Ga0373954_0006768 3300035118 Bacteria 5002
431 Ga0373956_0061649 3300035119 Unclassified 1699
432 Ga0373957_0043001 3300035120 Unclassified 1706
433 Ga0373943_0008262 3300035170 Bacteria 4671
434 Ga0373955_0060995 3300035172 Unclassified 2082
435 Ga0373931_0010772 3300035691 Bacteria 4402
436 Ga0373931_0010918 3300035691 Bacteria 4374
437 Ga0373931_0030207 3300035691 Bacteria 2788
438 Ga0373931_0222433 3300035691 Bacteria 1137
439 Ga0373935_0060610 3300035692 Unclassified 2421
440 Ga0373927_0010281 3300035695 Bacteria 6250
441 Ga0373927_0030281 3300035695 Unclassified 3531
442 Ga0373927_0106277 3300035695 Unclassified 1827
443 Ga0373947_0242290 3300035725 Bacteria 1190
444 Ga0373937_0006341 3300036401 Bacteria 10201
445 Ga0373937_0047169 3300036401 Bacteria 3941
446 Ga0373925_0162810 3300037068 Unclassified 1758
447 Ga0373925_0484736 3300037068 Bacteria 1014
448 Ga0395905_0114684 3300037471 Bacteria 2532
449 Ga0451577_0011643 3300042876 Bacteria 8305
450 Ga0451577_0424939 3300042876 Bacteria 1207
451 Ga0466963_0119357 3300044694 Unclassified 1814
452 Ga0451576_0001772 3300045051 Bacteria 35352
453 Ga0451576_0052037 3300045051 Bacteria 4291
454 Ga0451576_0057339 3300045051 Bacteria 4072
455 Ga0451576_0097897 3300045051 Bacteria 3050
456 Ga0451576_0145117 3300045051 Bacteria 2474
457 Ga0451576_0202060 3300045051 Unclassified 2075
458 Ga0451576_0678971 3300045051 Bacteria 1082
459 Ga0466967_0025612 3300045976 Bacteria 4868
460 Ga0495651_0183669 3300046462 Unclassified 1478
461 Ga0495580_0000126 3300046472 Bacteria 52702
462 Ga0495580_0025072 3300046472 Plasmid 4360
463 Ga0495580_0056395 3300046472 Unclassified 2766
464 Ga0495580_0108102 3300046472 Bacteria 1931
465 Ga0495582_0203405 3300046473 Bacteria 1131
466 Ga0495639_0007417 3300046475 Bacteria 4708
467 Ga0495664_0112343 3300046477 Bacteria 1645
468 Ga0495594_0024597 3300046499 Unclassified 3236
469 Ga0495594_0030789 3300046499 Unclassified 2906
470 Ga0495618_0078705 3300046514 Bacteria 2102
471 Ga0495628_0133262 3300046516 Bacteria 1900
472 Ga0495630_0023022 3300046517 Bacteria 4602
473 Ga0495666_0064178 3300046526 Unclassified 1753
474 Ga0495665_0019143 3300046531 Bacteria 3680
475 Ga0495665_0070217 3300046531 Bacteria 1846
476 Ga0495665_0085854 3300046531 Bacteria 1654
477 Ga0495586_0014305 3300046535 Bacteria 4215
478 Ga0495645_0043878 3300046543 Unclassified 3262
479 Ga0495645_0056305 3300046543 Bacteria 2855
480 Ga0495622_0052353 3300046557 Unclassified 1894
481 Ga0495668_0120082 3300046616 Bacteria 1438
482 Ga0495647_0044852 3300046681 Bacteria 1697
483 Ga0495658_0129069 3300046683 Unclassified 1537
484 Ga0495658_0150996 3300046683 Bacteria 1427
485 Ga0495669_0002726 3300046684 Bacteria 7240
486 Ga0495613_0016604 3300046689 Bacteria 5480
487 Ga0495670_0113101 3300046691 Unclassified 1406
488 Ga0495581_0001592 3300047315 Bacteria 12669
489 Ga0495674_0060494 3300047319 Bacteria 3305
490 Ga0495674_0116970 3300047319 Unclassified 2255
491 Ga0495684_0006275 3300047471 Bacteria 9239
492 Ga0495684_0045269 3300047471 Bacteria 3368
493 Ga0496102_0168958 3300048905 Unclassified 2059
494 Ga0496103_0267471 3300048906 Bacteria 1100
495 Ga0496104_0090346 3300048907 Unclassified 2926
496 Ga0496106_0240915 3300048909 Bacteria 1445
497 Ga0496107_0122303 3300048910 Bacteria 1918
498 Ga0496109_0004578 3300048912 Bacteria 11543
499 Ga0496109_0119943 3300048912 Unclassified 2450
500 Ga0496109_0120969 3300048912 Unclassified 2439
501 Ga0496112_0011838 3300048915 Bacteria 7988
502 Ga0496113_0115388 3300048916 Bacteria 2095
503 Ga0496113_0236823 3300048916 Bacteria 1456
504 Ga0501067_0029069 3300049583 Bacteria 3064
505 Ga0501068_0181966 3300049584 Unclassified 1329
506 Ga0501071_0013259 3300049587 Bacteria 5617
507 Ga0501071_0305076 3300049587 Unclassified 1207
508 Ga0501072_0084538 3300049588 Bacteria 2516
509 Ga0501077_0111654 3300049593 Bacteria 1733
510 Ga0501045_0062644 3300049824 Bacteria 2729
511 nmdc:mga05p37_277037_c1 3300050507 Bacteria 2002
512 nmdc:mga05p37_574_c1 3300050507 Bacteria 40354
513 nmdc:mga05p37_57535_c1 3300050507 Bacteria 4789
514 nmdc:mga08y16_157792_c1 3300050511 Bacteria 2358
515 nmdc:mga08y16_25759_c1 3300050511 Bacteria 6206
516 nmdc:mga08y16_264798_c1 3300050511 Unclassified 1775
517 nmdc:mga08y16_276311_c1 3300050511 Bacteria 1733
518 nmdc:mga0n895_10872_c1 3300050512 Bacteria 8079
519 nmdc:mga0n895_178140_c1 3300050512 Bacteria 2157
520 nmdc:mga0n895_222856_c1 3300050512 Unclassified 1914
521 nmdc:mga0n895_472073_c1 3300050512 Bacteria 1265
522 nmdc:mga0n895_8124_c1 3300050512 Bacteria 9066
523 nmdc:mga0n895_931_c1 3300050512 Bacteria 21135
524 nmdc:mga0rr50_155066_c1 3300050513 Bacteria 1854
525 nmdc:mga08x19_191535_c1 3300050514 Bacteria 1399
526 nmdc:mga08x19_7901_c1 3300050514 Bacteria 6318
527 nmdc:mga0a205_32661_c1 3300050515 Bacteria 4989
528 nmdc:mga0a205_34488_c1 3300050515 Bacteria 4854
529 Ga0500618_028275 3300053125 Bacteria 1329
530 Ga0500637_0289620 3300053178 Bacteria 897
531 Ga0590074_001995 3300059423 Unclassified 3338
532 Ga0590075_001103 3300059424 Bacteria 6966
533 Ga0590077_000603 3300059426 Bacteria 9734
534 nmdc:mga05p37_65574_c1
535 MRS1b_contig_1063388
536 Ga0065704_10010495
537 Ga0065712_10000181
538 Ga0065715_10091995
539 Ga0065715_10116160
540 Ga0065715_10118481
541 Ga0065715_10169915
542 Ga0065707_10009653
543 Ga0065707_10018542
544 Ga0065707_10020857
545 Ga0070676_10001714
546 Ga0070683_100007831
547 Ga0070683_100033350
548 Ga0070683_100080508
549 Ga0070690_100034384
550 Ga0070690_100069116
551 Ga0070670_100042393
552 Ga0070677_10129633
553 Ga0068869_100011931
554 Ga0068869_100024186
555 Ga0070680_100083119
556 Ga0070682_100190727
557 Ga0068868_100000992
558 Ga0068868_100004038
559 Ga0068868_100037543
560 Ga0070660_100016878
561 Ga0070660_100281614
562 Ga0070689_100015959
563 Ga0070689_100110624
564 Ga0070689_100226082
565 Ga0070689_100311114
566 Ga0070687_100044080
567 Ga0070661_100068497
568 Ga0070661_100128176
569 Ga0070661_100174717
570 Ga0070692_10030497
571 Ga0070668_100003262
572 Ga0070668_100008341
573 Ga0070668_100093583
574 Ga0070669_100004190
575 Ga0070669_100011668
576 Ga0070675_100007847
577 Ga0070675_100008322
578 Ga0070675_100024016
579 Ga0070675_100030291
580 Ga0070675_100154296
581 Ga0070671_100030633
582 Ga0070671_100192082
583 Ga0070671_100367911
584 Ga0070674_100354413
585 Ga0070673_100045597
586 Ga0070673_100193163
587 Ga0070688_100024007
588 Ga0070688_100028432
589 Ga0070688_100071153
590 Ga0070688_100132463
591 Ga0070659_100094434
592 Ga0070659_100109191
593 Ga0070659_100120430
594 Ga0070659_100146753
595 Ga0070659_100177745
596 Ga0070667_100013719
597 Ga0070667_100101715
598 Ga0070667_100358635
599 Ga0070709_10002703
600 Ga0070709_10017457
601 Ga0070713_100030831
602 Ga0070713_100076600
603 Ga0070713_100090281
604 Ga0070713_100106160
605 Ga0070701_10022756
606 Ga0070711_100040031
607 Ga0070705_100020384
608 Ga0070700_100009677
609 Ga0070700_100021393
610 Ga0070700_100115883
611 Ga0070694_100130286
612 Ga0070708_100000812
613 Ga0070708_100118004
614 Ga0070663_100008546
615 Ga0070678_100031413
616 Ga0070678_100225065
617 Ga0070662_100004859
618 Ga0070662_100084704
619 Ga0070662_100100647
620 Ga0070662_100155204
621 Ga0070662_100221664
622 Ga0068867_100245972
623 Ga0070685_10016912
624 Ga0070685_10017064
625 Ga0070707_100088426
626 Ga0070707_100319810
627 Ga0070699_100002723
628 Ga0070684_100018414
629 Ga0070684_100219575
630 Ga0070684_100315223
631 Ga0070697_100006603
632 Ga0070697_100047552
633 Ga0068853_100050847
634 Ga0068853_100060172
635 Ga0070672_100000133
636 Ga0070672_100123246
637 Ga0070672_100136359
638 Ga0070672_100215435
639 Ga0070672_100255588
640 Ga0070672_100275853
641 Ga0070686_100056502
642 Ga0070686_100178460
643 Ga0070686_100320229
644 Ga0070696_100101313
645 Ga0070665_100031979
646 Ga0070665_100253595
647 Ga0070704_100172180
648 Ga0068855_100122995
649 Ga0070664_100025838
650 Ga0070664_100064185
651 Ga0070664_100150451
652 Ga0068857_100000158
653 Ga0068857_100032742
654 Ga0068857_100054781
655 Ga0068857_100056796
656 Ga0068857_100240779
657 Ga0068857_100440573
658 Ga0068854_100379894
659 Ga0070702_100019600
660 Ga0068852_100024984
661 Ga0068852_100253644
662 Ga0068852_100470313
663 Ga0068859_100059601
664 Ga0068859_100064955
665 Ga0068859_100203520
666 Ga0068859_100236809
667 Ga0068859_100344537
668 Ga0068864_100000046
669 Ga0068864_100071610
670 Ga0068864_100078866
671 Ga0068864_100097007
672 Ga0068864_100130689
673 Ga0068864_100403381
674 Ga0068866_10025917
675 Ga0068861_100002345
676 Ga0068870_10003054
677 Ga0068870_10050950
678 Ga0068870_10056433
679 Ga0068870_10163992
680 Ga0068863_100005119
681 Ga0068863_100253141
682 Ga0068863_100312439
683 Ga0068858_100044812
684 Ga0068858_100141861
685 Ga0068858_100267024
686 Ga0068860_100030406
687 Ga0068860_100039324
688 Ga0068860_100108896
689 Ga0068860_100116441
690 Ga0068860_100209318
691 Ga0068862_100000429
692 Ga0068862_100002305
693 Ga0068862_100011597
694 Ga0068862_100016382
695 Ga0068862_100153931
696 Ga0070717_10083648
697 Ga0070716_100053272
698 Ga0070712_100040179
699 Ga0070712_100188708
700 Ga0097621_100001745
701 Ga0097621_100016271
702 Ga0097621_100025968
703 Ga0097621_100323385
704 Ga0097621_100393447
705 Ga0068871_100004424
706 Ga0068871_100059349
707 Ga0068871_100079447
708 Ga0068871_100342190
709 Ga0075428_100011452
710 Ga0075428_100013349
711 Ga0075428_100091957
712 Ga0075431_100083732
713 Ga0075431_100121695
714 Ga0075433_10023427
715 Ga0075433_10270807
716 Ga0075434_100000866
717 Ga0075434_100111577
718 Ga0075434_100158297
719 Ga0075434_100179496
720 Ga0075429_100115114
721 Ga0068865_100076710
722 Ga0068865_100262711
723 Ga0097620_100059602
724 Ga0097620_100064953
725 Ga0097620_100203529
726 Ga0097620_100236814
727 Ga0097620_100344519
728 Ga0075435_100145626
729 Ga0105240_10020879
730 Ga0105240_10250189
731 Ga0111539_10074555
732 Ga0111539_10144917
733 Ga0111539_10187546
734 Ga0111539_10203337
735 Ga0111539_10372055
736 Ga0111539_10533356
737 Ga0105245_10016784
738 Ga0105245_10051023
739 Ga0105245_10092276
740 Ga0105245_10102488
741 Ga0114129_10003511
742 Ga0114129_10059398
743 Ga0114129_10114143
744 Ga0105243_10260288
745 Ga0105241_10058166
746 Ga0105241_10215114
747 Ga0105241_10384412
748 Ga0105242_10005778
749 Ga0105242_10021633
750 Ga0105242_10086811
751 Ga0105242_10180988
752 Ga0105248_10033858
753 Ga0105248_10056148
754 Ga0105248_10057488
755 Ga0105248_10089216
756 Ga0105248_10153308
757 Ga0105248_10191181
758 Ga0105237_10006912
759 Ga0105249_10000884
760 Ga0105249_10002252
761 Ga0105249_10011990
762 Ga0105249_10088161
763 Ga0105249_10098181
764 Ga0105249_10118343
765 Ga0105249_10341224
766 Ga0105239_10006869
767 Ga0105239_10011320
768 Ga0105239_10587205
769 Ga0157373_10110382
770 Ga0157374_10104854
771 Ga0157374_10244257
772 Ga0157378_10002692
773 Ga0157378_10162787
774 Ga0157378_10451558
775 Ga0163162_10070990
776 Ga0163162_10096982
777 Ga0163162_10178627
778 Ga0163162_10407456
779 Ga0157372_10073847
780 Ga0157372_10109687
781 Ga0157372_10305541
782 Ga0157375_10000002
783 Ga0157375_10033929
784 Ga0157375_10063919
785 Ga0157375_10112415
786 Ga0157375_10117223
787 Ga0157375_10197032
788 Ga0157375_10294138
789 Ga0157375_10604105
790 Ga0163163_10033011
791 Ga0163163_10036870
792 Ga0163163_10104583
793 Ga0163163_10213996
794 Ga0163163_10281190
795 Ga0163163_10287777
796 Ga0157380_10019207
797 Ga0157380_10033762
798 Ga0157380_10137967
799 Ga0157377_10005429
800 Ga0157377_10009827
801 Ga0157379_10019753
802 Ga0157379_10072057
803 Ga0157376_10011896
804 Ga0157376_10013579
805 Ga0157376_10085886
806 Ga0163161_10011106
807 Ga0163161_10187636
808 Ga0163161_10253781
809 Ga0209050_1015963
810 Ga0209051_1006139
811 Ga0209257_1000016
812 Ga0209257_1024669
813 Ga0207697_10007088
814 Ga0207688_10013677
815 Ga0207688_10039217
816 Ga0207680_10044844
817 Ga0207699_10000066
818 Ga0207699_10053337
819 Ga0207699_10120415
820 Ga0207645_10000941
821 Ga0207645_10029285
822 Ga0207645_10049862
823 Ga0207643_10006059
824 Ga0207643_10006927
825 Ga0207643_10011891
826 Ga0207643_10033179
827 Ga0207643_10043116
828 Ga0207707_10283712
829 Ga0207707_10371053
830 Ga0207695_10136311
831 Ga0207695_10162617
832 Ga0207693_10055765
833 Ga0207693_10064457
834 Ga0207693_10110663
835 Ga0207660_10035175
836 Ga0207662_10105108
837 Ga0207662_10412617
838 Ga0207657_10024733
839 Ga0207649_10049943
840 Ga0207646_10053331
841 Ga0207681_10001349
842 Ga0207681_10003246
843 Ga0207650_10022091
844 Ga0207650_10061244
845 Ga0207650_10080976
846 Ga0207659_10014126
847 Ga0207659_10017148
848 Ga0207659_10146011
849 Ga0207687_10003166
850 Ga0207687_10055309
851 Ga0207700_10030180
852 Ga0207700_10049649
853 Ga0207700_10091800
854 Ga0207700_10113201
855 Ga0207644_10366503
856 Ga0207690_10089560
857 Ga0207690_10136419
858 Ga0207706_10014329
859 Ga0207706_10084088
860 Ga0207706_10093200
861 Ga0207706_10115999
862 Ga0207686_10005561
863 Ga0207670_10003969
864 Ga0207670_10035244
865 Ga0207669_10035825
866 Ga0207704_10053569
867 Ga0207704_10061211
868 Ga0207665_10021925
869 Ga0207691_10000489
870 Ga0207691_10022099
871 Ga0207691_10033377
872 Ga0207691_10133724
873 Ga0207691_10146227
874 Ga0207711_10008252
875 Ga0207711_10068567
876 Ga0207711_10081297
877 Ga0207711_10189523
878 Ga0207711_10215631
879 Ga0207689_10012041
880 Ga0207689_10019266
881 Ga0207689_10034157
882 Ga0207689_10242486
883 Ga0207689_10267148
884 Ga0207661_10053198
885 Ga0207661_10055605
886 Ga0207679_10003148
887 Ga0207679_10034261
888 Ga0207679_10208743
889 Ga0207679_10214034
890 Ga0207679_10240312
891 Ga0207651_10230728
892 Ga0207712_10001250
893 Ga0207712_10001785
894 Ga0207712_10004318
895 Ga0207712_10005777
896 Ga0207668_10004434
897 Ga0207668_10018727
898 Ga0207668_10065239
899 Ga0207640_10193041
900 Ga0207658_10138073
901 Ga0207658_10166501
902 Ga0207677_10000069
903 Ga0207677_10035490
904 Ga0207677_10362872
905 Ga0207703_10123784
906 Ga0207703_10153297
907 Ga0207703_10419566
908 Ga0207639_10174930
909 Ga0207678_10025738
910 Ga0207708_10005035
911 Ga0207708_10053558
912 Ga0207708_10084889
913 Ga0207641_10021369
914 Ga0207641_10066872
915 Ga0207641_10381654
916 Ga0207648_10006525
917 Ga0207648_10009283
918 Ga0207648_10036547
919 Ga0207648_10062126
920 Ga0207648_10182295
921 Ga0207676_10000008
922 Ga0207676_10002682
923 Ga0207676_10069968
924 Ga0207676_10106454
925 Ga0207676_10117306
926 Ga0207676_10129389
927 Ga0207676_10350078
928 Ga0207676_10443836
929 Ga0207674_10000122
930 Ga0207674_10002153
931 Ga0207674_10003187
932 Ga0207674_10048737
933 Ga0207674_10112641
934 Ga0207674_10141173
935 Ga0207674_10149312
936 Ga0207675_100000379
937 Ga0207675_100000518
938 Ga0207675_100002313
939 Ga0207675_100541507
940 Ga0207683_10009477
941 Ga0207683_10345897
942 Ga0207698_10277397
943 Ga0207428_10213072
944 Ga0268266_10051330
945 Ga0268266_10064583
946 Ga0268265_10003411
947 Ga0268265_10110289
948 Ga0268265_10122289
949 Ga0268265_10168222
950 Ga0268265_10333791
951 Ga0268264_10037558
952 Ga0268264_10078992
953 Ga0268264_10109471
954 Ga0268264_10126948
955 Ga0307408_100166221
956 Ga0307406_10275428
957 Ga0307412_10202561
958 Ga0307411_10163579
959 Ga0373930_0012689
960 Ga0373958_0009634
961 Ga0373934_0052818
962 Ga0373932_0013978
963 Ga0373954_0006768
964 Ga0373956_0061649
965 Ga0373957_0043001
966 Ga0373943_0008262
967 Ga0373955_0060995
968 Ga0373931_0010772
969 Ga0373931_0010918
970 Ga0373931_0030207
971 Ga0373931_0222433
972 Ga0373935_0060610
973 Ga0373927_0010281
974 Ga0373927_0030281
975 Ga0373927_0106277
976 Ga0373947_0242290
977 Ga0373937_0006341
978 Ga0373937_0047169
979 Ga0373925_0162810
980 Ga0373925_0484736
981 Ga0395905_0114684
982 Ga0451577_0011643
983 Ga0451577_0424939
984 Ga0466963_0119357
985 Ga0451576_0001772
986 Ga0451576_0052037
987 Ga0451576_0057339
988 Ga0451576_0097897
989 Ga0451576_0145117
990 Ga0451576_0202060
991 Ga0451576_0678971
992 Ga0466967_0025612
993 Ga0495651_0183669
994 Ga0495580_0000126
995 Ga0495580_0025072
996 Ga0495580_0056395
997 Ga0495580_0108102
998 Ga0495582_0203405
999 Ga0495639_0007417
1000 Ga0495664_0112343
1001 Ga0495594_0024597
1002 Ga0495594_0030789
1003 Ga0495618_0078705
1004 Ga0495628_0133262
1005 Ga0495630_0023022
1006 Ga0495666_0064178
1007 Ga0495665_0019143
1008 Ga0495665_0070217
1009 Ga0495665_0085854
1010 Ga0495586_0014305
1011 Ga0495645_0043878
1012 Ga0495645_0056305
1013 Ga0495622_0052353
1014 Ga0495668_0120082
1015 Ga0495647_0044852
1016 Ga0495658_0129069
1017 Ga0495658_0150996
1018 Ga0495669_0002726
1019 Ga0495613_0016604
1020 Ga0495670_0113101
1021 Ga0495581_0001592
1022 Ga0495674_0060494
1023 Ga0495674_0116970
1024 Ga0495684_0006275
1025 Ga0495684_0045269
1026 Ga0496102_0168958
1027 Ga0496103_0267471
1028 Ga0496104_0090346
1029 Ga0496106_0240915
1030 Ga0496107_0122303
1031 Ga0496109_0004578
1032 Ga0496109_0119943
1033 Ga0496109_0120969
1034 Ga0496112_0011838
1035 Ga0496113_0115388
1036 Ga0496113_0236823
1037 Ga0501067_0029069
1038 Ga0501068_0181966
1039 Ga0501071_0013259
1040 Ga0501071_0305076
1041 Ga0501072_0084538
1042 Ga0501077_0111654
1043 Ga0501045_0062644
1044 nmdc:mga05p37_277037_c1
1045 nmdc:mga05p37_574_c1
1046 nmdc:mga05p37_57535_c1
1047 nmdc:mga08y16_157792_c1
1048 nmdc:mga08y16_25759_c1
1049 nmdc:mga08y16_264798_c1
1050 nmdc:mga08y16_276311_c1
1051 nmdc:mga0n895_10872_c1
1052 nmdc:mga0n895_178140_c1
1053 nmdc:mga0n895_222856_c1
1054 nmdc:mga0n895_472073_c1
1055 nmdc:mga0n895_8124_c1
1056 nmdc:mga0n895_931_c1
1057 nmdc:mga0rr50_155066_c1
1058 nmdc:mga08x19_191535_c1
1059 nmdc:mga08x19_7901_c1
1060 nmdc:mga0a205_32661_c1
1061 nmdc:mga0a205_34488_c1
1062 Ga0500618_028275
1063 Ga0500637_0289620
1064 Ga0590074_001995
1065 Ga0590075_001103
1066 Ga0590077_000603

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12833

HTH_18

Helix-turn-helix domain

245

324

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oio-assembly1.cif.gz_A crystal structure of transcriptional regulator (arac-type dna-binding domain-containing proteins) from chromobacterium violaceum 0.937 217 316
2k9s-assembly1.cif.gz_A solution structure of dna binding domain of e. coli arac 0.9216 216 316
3mkl-assembly2.cif.gz_B crystal structure of dna-binding transcriptional dual regulator from escherichia coli k-12 0.8855 218 316
6swi-assembly1.cif.gz_A the c-terminal domain of arat, a response regulator from geobacillus stearothermophilus 0.8818 216 319
3lsg-assembly3.cif.gz_E the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.8754 220 306
ID Description Score Start End Superfamily
af_P0A9E0_176_235_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9565 216 271 1.10.10.60
3lsgC02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9511 272 316 1.10.10.60
3lsgB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.95 272 316 1.10.10.60
3lsgA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9381 272 316 1.10.10.60
3lsgE02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9322 272 306 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A1F8V3J0-F1-model_v4 HTH araC/xylS-type domain-containing protein 0.9453 220 317 GO:0003700
GO:0043565
AF-A0A656K2C5-F1-model_v4 AraC family transcriptional regulator 0.931 218 317 GO:0003700
GO:0043565
AF-A0A3A8WRE6-F1-model_v4 AraC family transcriptional regulator 0.9277 218 316 GO:0003700
GO:0043565
AF-A0A644U0M6-F1-model_v4 DNA gyrase inhibitor 0.9224 217 316 GO:0003700
GO:0043565
AF-A0A484XH48-F1-model_v4 AraC family transcriptional regulator 0.9206 218 318 GO:0003700
GO:0043565

Map