F460438

General Info

Members Datasets Scaffolds Average Seq Length
533 187 1066 219

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0103635|Ga0395900_0103635_788_1507
Length 239
Sequence LQGLPRQISGGGQALSSAPRRAQSVWDLPVRIVHWLLAALIAFSWWSVHXXXTDWHIWSGCAILTLLIFRLLWGFVGSSTARWTSFVGGPASVLAHLRGKWNGIGHTPLGAVSVVAIFLALTVQVGLGLISEDEDGIYTGPLSGLVSIDTSDKARDVHALWFDVILALILLHVAAIVYYRFRGRKLTKPMITGRAVLEPGTQPMRPGKWWVALICLAVGIGVTRWVIAGAPPFGHWTPS

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
148 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
153 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
154 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
155 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
156 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
157 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
158 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
159 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
160 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
161 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
162 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
163 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
164 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
167 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
187 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.25
Metatranscriptomes 0.75
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6
Rhizosphere 94
Stem 0
Stem Tuber 0
Unclassified 5.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0103635 3300037418 Bacteria 2922
2 JGI24752J21851_1010719 3300001976 Bacteria 1196
3 JGI24740J21852_10028415 3300001979 Bacteria 1848
4 JGI24740J21852_10028562 3300001979 Bacteria 1842
5 JGI24737J22298_10019577 3300001990 Bacteria 2164
6 JGI24735J21928_10031788 3300002067 Bacteria 1564
7 JGI24738J21930_10029111 3300002075 Bacteria 1130
8 JGI24744J21845_10000072 3300002077 Bacteria 12527
9 Ga0065715_10203744 3300005293 Bacteria 1294
10 Ga0070658_10012328 3300005327 Bacteria 6864
11 Ga0070658_10018678 3300005327 Bacteria 5553
12 Ga0070658_10025337 3300005327 Bacteria 4756
13 Ga0070658_10092103 3300005327 Bacteria 2499
14 Ga0070658_10158952 3300005327 Bacteria 1895
15 Ga0070676_10019947 3300005328 Bacteria 3735
16 Ga0070676_10354514 3300005328 Bacteria 1009
17 Ga0070683_100020037 3300005329 Bacteria 5947
18 Ga0070683_100029136 3300005329 Bacteria 4995
19 Ga0070683_100152703 3300005329 Bacteria 2189
20 Ga0070690_100008291 3300005330 Bacteria 5977
21 Ga0070670_100562064 3300005331 Bacteria 1018
22 Ga0070666_10001975 3300005335 Bacteria 12494
23 Ga0070666_10003290 3300005335 Bacteria 9807
24 Ga0070666_10204426 3300005335 Bacteria 1390
25 Ga0070680_100001960 3300005336 Bacteria 15158
26 Ga0070680_100007602 3300005336 Bacteria 8267
27 Ga0070680_100008811 3300005336 Bacteria 7739
28 Ga0070680_100011384 3300005336 Bacteria 6879
29 Ga0070680_100017846 3300005336 Bacteria 5599
30 Ga0070680_100059024 3300005336 Bacteria 3138
31 Ga0070682_100002765 3300005337 Bacteria 9713
32 Ga0070682_100086275 3300005337 Bacteria 2044
33 Ga0070682_100156071 3300005337 Bacteria 1571
34 Ga0068868_100001497 3300005338 Bacteria 16125
35 Ga0068868_100040484 3300005338 Bacteria 3627
36 Ga0068868_100055402 3300005338 Bacteria 3128
37 Ga0068868_100079400 3300005338 Bacteria 2628
38 Ga0070660_100012165 3300005339 Bacteria 6144
39 Ga0070660_100022407 3300005339 Bacteria 4671
40 Ga0070660_100037983 3300005339 Bacteria 3653
41 Ga0070660_100079712 3300005339 Bacteria 2569
42 Ga0070660_100087800 3300005339 Bacteria 2448
43 Ga0070660_100331902 3300005339 Bacteria 1250
44 Ga0070660_100438687 3300005339 Bacteria 1082
45 Ga0070689_100292869 3300005340 Bacteria 1353
46 Ga0070691_10012038 3300005341 Bacteria 3962
47 Ga0070687_100165315 3300005343 Unclassified 1312
48 Ga0070661_100009699 3300005344 Bacteria 6678
49 Ga0070661_100013255 3300005344 Bacteria 5786
50 Ga0070661_100024072 3300005344 Bacteria 4368
51 Ga0070661_100040242 3300005344 Bacteria 3409
52 Ga0070661_100485454 3300005344 Bacteria 987
53 Ga0070692_10029359 3300005345 Bacteria 2740
54 Ga0070675_100052515 3300005354 Bacteria 3351
55 Ga0070675_100065993 3300005354 Bacteria 2993
56 Ga0070675_100069765 3300005354 Bacteria 2912
57 Ga0070671_100023117 3300005355 Bacteria 5082
58 Ga0070671_100032123 3300005355 Bacteria 4341
59 Ga0070671_100083381 3300005355 Bacteria 2673
60 Ga0070671_100102644 3300005355 Bacteria 2399
61 Ga0070671_100105375 3300005355 Bacteria 2366
62 Ga0070674_100004983 3300005356 Bacteria 7614
63 Ga0070674_100043898 3300005356 Bacteria 3044
64 Ga0070674_100063650 3300005356 Bacteria 2582
65 Ga0070673_100001132 3300005364 Bacteria 15331
66 Ga0070673_100003531 3300005364 Bacteria 9752
67 Ga0070673_100361679 3300005364 Bacteria 1290
68 Ga0070673_100503552 3300005364 Bacteria 1096
69 Ga0070659_100019290 3300005366 Bacteria 5165
70 Ga0070659_100022605 3300005366 Bacteria 4801
71 Ga0070659_100028342 3300005366 Bacteria 4323
72 Ga0070659_100079490 3300005366 Bacteria 2617
73 Ga0070659_100174893 3300005366 Bacteria 1760
74 Ga0070659_100263080 3300005366 Bacteria 1431
75 Ga0070659_100490922 3300005366 Unclassified 1046
76 Ga0070667_100005255 3300005367 Bacteria 10826
77 Ga0070667_100020316 3300005367 Bacteria 5513
78 Ga0070667_100044768 3300005367 Bacteria 3718
79 Ga0070667_100548319 3300005367 Bacteria 1063
80 Ga0070714_100281075 3300005435 Bacteria 1546
81 Ga0070714_100760452 3300005435 Unclassified 937
82 Ga0070713_100014782 3300005436 Bacteria 5809
83 Ga0070663_100016007 3300005455 Bacteria 4856
84 Ga0070663_100052968 3300005455 Bacteria 2896
85 Ga0070663_100073497 3300005455 Bacteria 2494
86 Ga0070663_100176802 3300005455 Bacteria 1653
87 Ga0070663_100238366 3300005455 Bacteria 1435
88 Ga0070678_100005013 3300005456 Bacteria 7591
89 Ga0070678_100005250 3300005456 Bacteria 7459
90 Ga0070678_100081154 3300005456 Bacteria 2458
91 Ga0070662_100002632 3300005457 Bacteria 11074
92 Ga0070662_100005625 3300005457 Bacteria 8016
93 Ga0070662_100088946 3300005457 Bacteria 2316
94 Ga0070662_100153168 3300005457 Bacteria 1797
95 Ga0070681_10030807 3300005458 Bacteria 5384
96 Ga0070681_10067399 3300005458 Bacteria 3547
97 Ga0068867_100006361 3300005459 Bacteria 8348
98 Ga0070685_10032615 3300005466 Bacteria 2918
99 Ga0070679_100027755 3300005530 Bacteria 5575
100 Ga0070679_100030368 3300005530 Bacteria 5336
101 Ga0070679_100319850 3300005530 Bacteria 1501
102 Ga0070679_100482545 3300005530 Bacteria 1184
103 Ga0070679_100635212 3300005530 Unclassified 1011
104 Ga0070684_100016831 3300005535 Bacteria 5988
105 Ga0070684_100023225 3300005535 Bacteria 5183
106 Ga0070684_100076123 3300005535 Bacteria 2961
107 Ga0070684_100805962 3300005535 Unclassified 878
108 Ga0068853_100055802 3300005539 Bacteria 3405
109 Ga0068853_100064792 3300005539 Bacteria 3170
110 Ga0068853_100089050 3300005539 Bacteria 2710
111 Ga0068853_100189104 3300005539 Bacteria 1870
112 Ga0068853_100318290 3300005539 Bacteria 1442
113 Ga0068853_100530134 3300005539 Unclassified 1114
114 Ga0068853_100795068 3300005539 Bacteria 906
115 Ga0070672_100005635 3300005543 Bacteria 8330
116 Ga0070672_100006621 3300005543 Bacteria 7802
117 Ga0070672_100154751 3300005543 Bacteria 1898
118 Ga0070695_100253821 3300005545 Bacteria 1281
119 Ga0070696_100263916 3300005546 Bacteria 1307
120 Ga0070693_100001691 3300005547 Bacteria 10011
121 Ga0070665_100016126 3300005548 Bacteria 7498
122 Ga0070665_100034511 3300005548 Bacteria 5088
123 Ga0070665_100273007 3300005548 Bacteria 1692
124 Ga0068855_100019383 3300005563 Bacteria 8173
125 Ga0068855_100182411 3300005563 Bacteria 2372
126 Ga0068855_100274337 3300005563 Bacteria 1874
127 Ga0068855_100820224 3300005563 Bacteria 988
128 Ga0068855_100860789 3300005563 Bacteria 960
129 Ga0070664_100007622 3300005564 Bacteria 8740
130 Ga0070664_100010116 3300005564 Bacteria 7645
131 Ga0070664_100011689 3300005564 Bacteria 7125
132 Ga0070664_100022439 3300005564 Bacteria 5204
133 Ga0070664_100032733 3300005564 Bacteria 4349
134 Ga0070664_100065137 3300005564 Bacteria 3109
135 Ga0070664_100433187 3300005564 Bacteria 1205
136 Ga0068857_100002945 3300005577 Bacteria 14026
137 Ga0068857_100018000 3300005577 Bacteria 6197
138 Ga0068857_100044515 3300005577 Bacteria 3937
139 Ga0068857_100048254 3300005577 Bacteria 3781
140 Ga0068854_100041113 3300005578 Bacteria 3265
141 Ga0068854_100047870 3300005578 Bacteria 3048
142 Ga0068854_100052586 3300005578 Bacteria 2921
143 Ga0068854_100577930 3300005578 Bacteria 956
144 Ga0068856_100028185 3300005614 Bacteria 5482
145 Ga0068856_100039322 3300005614 Bacteria 4644
146 Ga0068856_100051429 3300005614 Bacteria 4062
147 Ga0068856_100088662 3300005614 Bacteria 3076
148 Ga0068856_100345389 3300005614 Bacteria 1507
149 Ga0068856_100483385 3300005614 Bacteria 1259
150 Ga0068856_100641792 3300005614 Bacteria 1082
151 Ga0068852_100004848 3300005616 Bacteria 9555
152 Ga0068852_100004886 3300005616 Bacteria 9519
153 Ga0068852_100021600 3300005616 Bacteria 5144
154 Ga0068852_100028783 3300005616 Bacteria 4552
155 Ga0068852_100083937 3300005616 Bacteria 2834
156 Ga0068852_100334674 3300005616 Bacteria 1474
157 Ga0068859_100017599 3300005617 Bacteria 7185
158 Ga0068859_100125068 3300005617 Bacteria 2640
159 Ga0068864_100001642 3300005618 Bacteria 18433
160 Ga0068864_100008878 3300005618 Bacteria 8288
161 Ga0068864_100028599 3300005618 Bacteria 4714
162 Ga0068866_10010216 3300005718 Bacteria 4016
163 Ga0068861_100494668 3300005719 Bacteria 1104
164 Ga0068851_10006186 3300005834 Bacteria 5464
165 Ga0068851_10216339 3300005834 Bacteria 1075
166 Ga0068863_100011068 3300005841 Bacteria 8749
167 Ga0068863_100033535 3300005841 Bacteria 4891
168 Ga0068863_100034907 3300005841 Bacteria 4791
169 Ga0068863_100124549 3300005841 Bacteria 2458
170 Ga0068858_100002545 3300005842 Bacteria 18388
171 Ga0068858_100014125 3300005842 Bacteria 7531
172 Ga0068858_100019058 3300005842 Bacteria 6419
173 Ga0068860_100034230 3300005843 Bacteria 4871
174 Ga0068860_100186149 3300005843 Bacteria 2008
175 Ga0070716_100060970 3300006173 Bacteria 2181
176 Ga0097621_100013293 3300006237 Bacteria 6132
177 Ga0097621_100015640 3300006237 Bacteria 5716
178 Ga0097621_100034267 3300006237 Bacteria 4049
179 Ga0068871_100007445 3300006358 Bacteria 7824
180 Ga0068871_100021153 3300006358 Bacteria 4995
181 Ga0068865_100006686 3300006881 Bacteria 7052
182 Ga0068865_100213440 3300006881 Bacteria 1505
183 Ga0097620_100017600 3300006931 Bacteria 7185
184 Ga0097620_100125064 3300006931 Bacteria 2640
185 Ga0105240_10050806 3300009093 Bacteria 5224
186 Ga0105240_10070774 3300009093 Bacteria 4314
187 Ga0105245_10010546 3300009098 Bacteria 8041
188 Ga0105245_10072184 3300009098 Bacteria 3135
189 Ga0105247_10115034 3300009101 Bacteria 1736
190 Ga0105243_10023919 3300009148 Bacteria 4655
191 Ga0105243_10220458 3300009148 Bacteria 1676
192 Ga0105241_10047638 3300009174 Bacteria 3260
193 Ga0105241_10160760 3300009174 Bacteria 1846
194 Ga0105242_10009591 3300009176 Bacteria 7420
195 Ga0105248_10005810 3300009177 Bacteria 13563
196 Ga0105248_10038332 3300009177 Bacteria 5363
197 Ga0105248_10180733 3300009177 Bacteria 2377
198 Ga0105237_10067334 3300009545 Bacteria 3575
199 Ga0105237_10121532 3300009545 Bacteria 2606
200 Ga0105238_10016671 3300009551 Bacteria 7443
201 Ga0105238_10163686 3300009551 Bacteria 2200
202 Ga0105238_10337677 3300009551 Bacteria 1494
203 Ga0105246_10144498 3300011119 Bacteria 1793
204 Ga0157373_10038000 3300013100 Bacteria 3450
205 Ga0157373_10044714 3300013100 Bacteria 3161
206 Ga0157373_10063921 3300013100 Bacteria 2605
207 Ga0157373_10213833 3300013100 Bacteria 1359
208 Ga0157373_10240053 3300013100 Unclassified 1281
209 Ga0157371_10021293 3300013102 Bacteria 4761
210 Ga0157371_10024685 3300013102 Bacteria 4386
211 Ga0157371_10138066 3300013102 Bacteria 1736
212 Ga0157371_10260802 3300013102 Bacteria 1249
213 Ga0157371_10384710 3300013102 Bacteria 1025
214 Ga0157371_10419056 3300013102 Bacteria 981
215 Ga0157370_10001875 3300013104 Bacteria 25926
216 Ga0157370_10023030 3300013104 Bacteria 6191
217 Ga0157370_10023359 3300013104 Bacteria 6140
218 Ga0157370_10042639 3300013104 Bacteria 4371
219 Ga0157370_10168638 3300013104 Bacteria 2035
220 Ga0157369_10034175 3300013105 Bacteria 5582
221 Ga0157369_10075809 3300013105 Bacteria 3605
222 Ga0157369_10246658 3300013105 Bacteria 1865
223 Ga0157374_10022956 3300013296 Bacteria 5572
224 Ga0157378_10012580 3300013297 Bacteria 7408
225 Ga0157378_10033888 3300013297 Bacteria 4517
226 Ga0157378_10157507 3300013297 Bacteria 2121
227 Ga0157378_10294945 3300013297 Bacteria 1567
228 Ga0163162_10020561 3300013306 Bacteria 6485
229 Ga0157372_10211590 3300013307 Bacteria 2247
230 Ga0157372_10284097 3300013307 Bacteria 1924
231 Ga0157372_10513842 3300013307 Unclassified 1396
232 Ga0157372_10727941 3300013307 Bacteria 1154
233 Ga0157375_10009954 3300013308 Bacteria 8358
234 Ga0163163_10055306 3300014325 Bacteria 3923
235 Ga0163163_10091322 3300014325 Bacteria 3059
236 Ga0157377_10349064 3300014745 Bacteria 992
237 Ga0157379_10002869 3300014968 Bacteria 14535
238 Ga0157379_10010521 3300014968 Bacteria 8064
239 Ga0157376_10030968 3300014969 Bacteria 4278
240 Ga0163161_10209610 3300017792 Bacteria 1505
241 Ga0197907_10814763 3300020069 Bacteria 2910
242 Ga0206356_11877315 3300020070 Unclassified 886
243 Ga0206354_10518832 3300020081 Unclassified 1056
244 Ga0206353_10080605 3300020082 Bacteria 2336
245 Ga0207656_10030437 3300025321 Bacteria 2230
246 Ga0207656_10144049 3300025321 Bacteria 1125
247 Ga0207656_10191381 3300025321 Bacteria 985
248 Ga0207642_10033971 3300025899 Bacteria 2164
249 Ga0207642_10045108 3300025899 Bacteria 1955
250 Ga0207710_10307425 3300025900 Unclassified 802
251 Ga0207688_10078702 3300025901 Bacteria 1879
252 Ga0207680_10001306 3300025903 Bacteria 11767
253 Ga0207680_10006317 3300025903 Bacteria 5720
254 Ga0207680_10010102 3300025903 Bacteria 4711
255 Ga0207647_10002598 3300025904 Bacteria 13647
256 Ga0207647_10015034 3300025904 Bacteria 5320
257 Ga0207647_10064097 3300025904 Bacteria 2233
258 Ga0207645_10026652 3300025907 Bacteria 3734
259 Ga0207645_10084796 3300025907 Bacteria 2033
260 Ga0207645_10388874 3300025907 Unclassified 937
261 Ga0207705_10001651 3300025909 Bacteria 17706
262 Ga0207705_10027003 3300025909 Bacteria 4092
263 Ga0207705_10028881 3300025909 Bacteria 3953
264 Ga0207705_10038012 3300025909 Bacteria 3445
265 Ga0207705_10056625 3300025909 Bacteria 2827
266 Ga0207705_10104353 3300025909 Bacteria 2088
267 Ga0207705_10182875 3300025909 Bacteria 1582
268 Ga0207705_10194416 3300025909 Bacteria 1535
269 Ga0207707_10117980 3300025912 Bacteria 2320
270 Ga0207695_10018678 3300025913 Bacteria 8007
271 Ga0207695_10748382 3300025913 Bacteria 858
272 Ga0207671_10096217 3300025914 Bacteria 2237
273 Ga0207660_10000716 3300025917 Bacteria 22075
274 Ga0207660_10001309 3300025917 Bacteria 16627
275 Ga0207660_10010110 3300025917 Bacteria 6111
276 Ga0207660_10066923 3300025917 Bacteria 2600
277 Ga0207660_10182978 3300025917 Bacteria 1628
278 Ga0207660_10203997 3300025917 Bacteria 1545
279 Ga0207657_10001862 3300025919 Bacteria 22804
280 Ga0207657_10005820 3300025919 Bacteria 12840
281 Ga0207657_10005882 3300025919 Bacteria 12778
282 Ga0207657_10011525 3300025919 Bacteria 8777
283 Ga0207657_10074217 3300025919 Bacteria 2873
284 Ga0207657_10107322 3300025919 Bacteria 2310
285 Ga0207657_10236927 3300025919 Bacteria 1458
286 Ga0207649_10002104 3300025920 Bacteria 11287
287 Ga0207649_10016221 3300025920 Bacteria 4196
288 Ga0207649_10027651 3300025920 Bacteria 3331
289 Ga0207649_10060930 3300025920 Bacteria 2373
290 Ga0207649_10110274 3300025920 Bacteria 1837
291 Ga0207652_10012439 3300025921 Bacteria 6878
292 Ga0207652_10317384 3300025921 Bacteria 1407
293 Ga0207652_10385286 3300025921 Unclassified 1265
294 Ga0207652_10439975 3300025921 Bacteria 1175
295 Ga0207694_10128992 3300025924 Bacteria 2026
296 Ga0207694_10196502 3300025924 Bacteria 1640
297 Ga0207650_10006964 3300025925 Bacteria 7708
298 Ga0207650_10094558 3300025925 Bacteria 2290
299 Ga0207659_10097392 3300025926 Bacteria 2210
300 Ga0207687_10070185 3300025927 Bacteria 2500
301 Ga0207700_10029593 3300025928 Bacteria 3866
302 Ga0207664_10095828 3300025929 Bacteria 2442
303 Ga0207664_10420214 3300025929 Unclassified 1191
304 Ga0207644_10001036 3300025931 Bacteria 17813
305 Ga0207644_10001055 3300025931 Bacteria 17632
306 Ga0207644_10020468 3300025931 Bacteria 4498
307 Ga0207690_10010318 3300025932 Bacteria 5545
308 Ga0207690_10033602 3300025932 Bacteria 3299
309 Ga0207690_10038177 3300025932 Bacteria 3124
310 Ga0207690_10038851 3300025932 Bacteria 3101
311 Ga0207690_10051428 3300025932 Bacteria 2755
312 Ga0207690_10062840 3300025932 Bacteria 2530
313 Ga0207690_10079576 3300025932 Bacteria 2284
314 Ga0207690_10174153 3300025932 Bacteria 1614
315 Ga0207690_10322539 3300025932 Bacteria 1214
316 Ga0207690_10519498 3300025932 Unclassified 965
317 Ga0207706_10002923 3300025933 Bacteria 16502
318 Ga0207706_10002977 3300025933 Bacteria 16347
319 Ga0207706_10054433 3300025933 Bacteria 3531
320 Ga0207706_10058767 3300025933 Bacteria 3387
321 Ga0207706_10225872 3300025933 Bacteria 1639
322 Ga0207706_10247901 3300025933 Bacteria 1556
323 Ga0207686_10004481 3300025934 Bacteria 7482
324 Ga0207670_10302586 3300025936 Bacteria 1252
325 Ga0207669_10005160 3300025937 Bacteria 5826
326 Ga0207704_10199193 3300025938 Bacteria 1464
327 Ga0207691_10001996 3300025940 Bacteria 19962
328 Ga0207691_10002787 3300025940 Bacteria 17036
329 Ga0207691_10153289 3300025940 Bacteria 2025
330 Ga0207711_10003024 3300025941 Bacteria 14701
331 Ga0207711_10009940 3300025941 Bacteria 7910
332 Ga0207711_10197864 3300025941 Bacteria 1833
333 Ga0207711_10539098 3300025941 Bacteria 1088
334 Ga0207711_10685372 3300025941 Bacteria 956
335 Ga0207661_10010079 3300025944 Bacteria 6792
336 Ga0207661_10021095 3300025944 Bacteria 4880
337 Ga0207661_10025169 3300025944 Bacteria 4522
338 Ga0207661_10238694 3300025944 Bacteria 1612
339 Ga0207679_10015997 3300025945 Bacteria 4972
340 Ga0207679_10021255 3300025945 Bacteria 4396
341 Ga0207679_10079600 3300025945 Bacteria 2499
342 Ga0207679_10127150 3300025945 Bacteria 2038
343 Ga0207679_10155444 3300025945 Bacteria 1867
344 Ga0207679_10360657 3300025945 Bacteria 1269
345 Ga0207667_10004287 3300025949 Bacteria 17471
346 Ga0207667_10089017 3300025949 Bacteria 3191
347 Ga0207667_10280616 3300025949 Bacteria 1702
348 Ga0207667_10737718 3300025949 Bacteria 985
349 Ga0207651_10001542 3300025960 Bacteria 10516
350 Ga0207651_10002725 3300025960 Bacteria 8474
351 Ga0207651_10283755 3300025960 Bacteria 1370
352 Ga0207640_10003404 3300025981 Bacteria 8569
353 Ga0207640_10031678 3300025981 Bacteria 3270
354 Ga0207640_10039030 3300025981 Bacteria 3002
355 Ga0207640_10047165 3300025981 Bacteria 2777
356 Ga0207658_10005276 3300025986 Bacteria 8889
357 Ga0207658_10012694 3300025986 Bacteria 5753
358 Ga0207658_10053374 3300025986 Bacteria 2986
359 Ga0207658_10498519 3300025986 Bacteria 1084
360 Ga0207677_10003171 3300026023 Bacteria 8683
361 Ga0207677_10003995 3300026023 Bacteria 7868
362 Ga0207677_10229420 3300026023 Bacteria 1494
363 Ga0207703_10019201 3300026035 Bacteria 5339
364 Ga0207703_10024121 3300026035 Bacteria 4785
365 Ga0207703_10036865 3300026035 Bacteria 3894
366 Ga0207639_10002075 3300026041 Bacteria 13498
367 Ga0207639_10153369 3300026041 Bacteria 1932
368 Ga0207639_10206811 3300026041 Bacteria 1687
369 Ga0207639_10511427 3300026041 Bacteria 1099
370 Ga0207678_10014800 3300026067 Bacteria 6864
371 Ga0207678_10083177 3300026067 Bacteria 2738
372 Ga0207678_10182624 3300026067 Bacteria 1791
373 Ga0207678_10235676 3300026067 Bacteria 1567
374 Ga0207678_10300474 3300026067 Bacteria 1379
375 Ga0207702_10005569 3300026078 Bacteria 11000
376 Ga0207702_10017951 3300026078 Bacteria 5854
377 Ga0207702_10038783 3300026078 Bacteria 3990
378 Ga0207702_10041446 3300026078 Bacteria 3861
379 Ga0207702_10069946 3300026078 Bacteria 3018
380 Ga0207702_10213409 3300026078 Bacteria 1795
381 Ga0207702_10526096 3300026078 Bacteria 1155
382 Ga0207702_10869715 3300026078 Bacteria 893
383 Ga0207641_10011882 3300026088 Bacteria 7142
384 Ga0207641_10042941 3300026088 Bacteria 3794
385 Ga0207641_11035411 3300026088 Bacteria 818
386 Ga0207648_10010598 3300026089 Bacteria 8718
387 Ga0207676_10006163 3300026095 Bacteria 8467
388 Ga0207676_10436464 3300026095 Unclassified 1231
389 Ga0207676_10495616 3300026095 Bacteria 1159
390 Ga0207674_10000271 3300026116 Bacteria 65366
391 Ga0207674_10000780 3300026116 Bacteria 41514
392 Ga0207674_10003100 3300026116 Bacteria 20520
393 Ga0207674_10004321 3300026116 Bacteria 17130
394 Ga0207674_10023046 3300026116 Bacteria 6677
395 Ga0207675_100408503 3300026118 Bacteria 1339
396 Ga0207683_10001537 3300026121 Bacteria 20804
397 Ga0207683_10006388 3300026121 Bacteria 10095
398 Ga0207683_10326801 3300026121 Bacteria 1405
399 Ga0207698_10001436 3300026142 Bacteria 13841
400 Ga0207698_10002802 3300026142 Bacteria 10414
401 Ga0207698_10006239 3300026142 Bacteria 7424
402 Ga0207698_10016104 3300026142 Bacteria 5030
403 Ga0207698_10057796 3300026142 Bacteria 3003
404 Ga0207698_10532649 3300026142 Bacteria 1148
405 Ga0268266_10000458 3300028379 Bacteria 59553
406 Ga0268266_10010398 3300028379 Bacteria 8134
407 Ga0268266_10044171 3300028379 Bacteria 3809
408 Ga0268264_10132428 3300028381 Bacteria 2212
409 Ga0307405_10140896 3300031731 Bacteria 1681
410 Ga0307416_100570360 3300032002 Bacteria 1208
411 Ga0373955_0062725 3300035172 Bacteria 2056
412 Ga0373935_0025493 3300035692 Bacteria 3644
413 Ga0373933_0212425 3300035724 Unclassified 1240
414 Ga0395899_0008499 3300037312 Bacteria 7909
415 Ga0395899_0014094 3300037312 Bacteria 6103
416 Ga0395899_0060488 3300037312 Bacteria 2791
417 Ga0395899_0219057 3300037312 Unclassified 1319
418 Ga0395900_0013711 3300037418 Bacteria 8274
419 Ga0395900_0013806 3300037418 Bacteria 8244
420 Ga0395900_0062328 3300037418 Bacteria 3833
421 Ga0395900_0081116 3300037418 Bacteria 3333
422 Ga0395900_0126912 3300037418 Bacteria 2616
423 Ga0395900_0170507 3300037418 Bacteria 2216
424 Ga0395900_0171352 3300037418 Bacteria 2209
425 Ga0395900_0236107 3300037418 Bacteria 1836
426 Ga0395900_0245191 3300037418 Bacteria 1795
427 Ga0395900_0279343 3300037418 Bacteria 1662
428 Ga0395900_0315736 3300037418 Bacteria 1544
429 Ga0395900_0732598 3300037418 Unclassified 920
430 Ga0395900_0817642 3300037418 Bacteria 859
431 Ga0395898_0087043 3300037466 Bacteria 3010
432 Ga0395898_0089055 3300037466 Bacteria 2970
433 Ga0395898_0097940 3300037466 Bacteria 2816
434 Ga0395898_0098845 3300037466 Bacteria 2802
435 Ga0395898_0100821 3300037466 Bacteria 2773
436 Ga0395898_0104116 3300037466 Bacteria 2722
437 Ga0395898_0127566 3300037466 Bacteria 2437
438 Ga0395898_0215257 3300037466 Bacteria 1832
439 Ga0395905_0001997 3300037471 Bacteria 23312
440 Ga0395905_0006735 3300037471 Bacteria 11506
441 Ga0395905_0008262 3300037471 Bacteria 10278
442 Ga0395905_0010132 3300037471 Bacteria 9188
443 Ga0395905_0023006 3300037471 Bacteria 5890
444 Ga0395905_0040830 3300037471 Bacteria 4353
445 Ga0395905_0083847 3300037471 Bacteria 2986
446 Ga0395905_0091575 3300037471 Bacteria 2851
447 Ga0395905_0144388 3300037471 Bacteria 2239
448 Ga0395905_0175109 3300037471 Bacteria 2014
449 Ga0395905_0422312 3300037471 Bacteria 1229
450 Ga0395905_0461524 3300037471 Bacteria 1168
451 Ga0395905_0607572 3300037471 Bacteria 995
452 Ga0395901_0002513 3300038443 Bacteria 18561
453 Ga0395901_0006861 3300038443 Bacteria 11503
454 Ga0395901_0007314 3300038443 Bacteria 11145
455 Ga0395901_0008904 3300038443 Bacteria 10165
456 Ga0395901_0036368 3300038443 Bacteria 5089
457 Ga0395901_0100253 3300038443 Bacteria 3037
458 Ga0395901_0132884 3300038443 Bacteria 2615
459 Ga0395901_0153405 3300038443 Bacteria 2419
460 Ga0395901_0159760 3300038443 Bacteria 2367
461 Ga0395901_0245769 3300038443 Bacteria 1865
462 Ga0395901_0258554 3300038443 Bacteria 1812
463 Ga0395901_0289461 3300038443 Bacteria 1700
464 Ga0395901_0302019 3300038443 Bacteria 1659
465 Ga0395901_0306141 3300038443 Bacteria 1647
466 Ga0395901_0488155 3300038443 Bacteria 1255
467 Ga0439448_0004171 3300042005 Bacteria 4068
468 Ga0439455_0027992 3300042012 Bacteria 1384
469 Ga0439458_0022391 3300042157 Bacteria 1468
470 Ga0466972_0059516 3300044658 Bacteria 1833
471 Ga0466965_0246232 3300044683 Unclassified 958
472 Ga0466966_0042918 3300044684 Bacteria 2900
473 Ga0466963_0023695 3300044694 Bacteria 3901
474 Ga0466963_0032333 3300044694 Bacteria 3387
475 Ga0466963_0066689 3300044694 Bacteria 2415
476 Ga0466964_0090420 3300044706 Bacteria 1331
477 Ga0466968_0004672 3300044735 Bacteria 5128
478 Ga0466970_0007504 3300044765 Bacteria 5469
479 Ga0466970_0079639 3300044765 Unclassified 1769
480 Ga0466957_0140179 3300044842 Bacteria 1557
481 Ga0466959_0006389 3300045049 Bacteria 8159
482 Ga0466959_0056203 3300045049 Bacteria 2872
483 Ga0466959_0099974 3300045049 Bacteria 2077
484 Ga0466959_0311946 3300045049 Bacteria 1076
485 Ga0466959_0331623 3300045049 Unclassified 1039
486 Ga0466958_0011056 3300045836 Bacteria 5074
487 Ga0466958_0119283 3300045836 Bacteria 1651
488 Ga0466967_0003513 3300045976 Bacteria 10246
489 Ga0466967_0034884 3300045976 Bacteria 4275
490 Ga0466967_0092201 3300045976 Bacteria 2754
491 Ga0466967_0239483 3300045976 Bacteria 1730
492 Ga0466967_0292447 3300045976 Bacteria 1565
493 Ga0495643_0186689 3300046522 Unclassified 1004
494 Ga0495647_0013059 3300046681 Bacteria 2871
495 Ga0496100_0061673 3300048903 Bacteria 2471
496 Ga0496100_0093938 3300048903 Bacteria 2053
497 Ga0496101_0011745 3300048904 Bacteria 5822
498 Ga0496101_0024318 3300048904 Bacteria 4192
499 Ga0496101_0054058 3300048904 Bacteria 2899
500 Ga0496102_0022268 3300048905 Bacteria 5614
501 Ga0496102_0221350 3300048905 Bacteria 1784
502 Ga0496103_0474623 3300048906 Unclassified 801
503 Ga0496104_0211029 3300048907 Bacteria 1853
504 Ga0496105_0016317 3300048908 Bacteria 5928
505 Ga0496105_0018231 3300048908 Bacteria 5636
506 Ga0496106_0003210 3300048909 Bacteria 12244
507 Ga0496107_0001852 3300048910 Bacteria 13357
508 Ga0496107_0070176 3300048910 Bacteria 2543
509 Ga0496108_0000578 3300048911 Bacteria 28619
510 Ga0496108_0003009 3300048911 Bacteria 13547
511 Ga0496108_0018738 3300048911 Bacteria 5673
512 Ga0496109_0004627 3300048912 Bacteria 11488
513 Ga0496109_0013232 3300048912 Bacteria 7144
514 Ga0496109_0032517 3300048912 Bacteria 4689
515 Ga0496110_0004837 3300048913 Bacteria 10498
516 Ga0496110_0009281 3300048913 Bacteria 7955
517 Ga0496111_0000970 3300048914 Bacteria 15674
518 Ga0496111_0088831 3300048914 Bacteria 2263
519 Ga0496111_0362539 3300048914 Unclassified 1072
520 Ga0496112_0013295 3300048915 Bacteria 7599
521 Ga0496112_0020194 3300048915 Bacteria 6308
522 Ga0496112_0023255 3300048915 Bacteria 5917
523 Ga0496113_0000659 3300048916 Bacteria 17462
524 Ga0496113_0012992 3300048916 Bacteria 5618
525 Ga0496114_0040584 3300048917 Bacteria 3854
526 Ga0496115_0010245 3300048918 Bacteria 6995
527 Ga0501070_0097861 3300049586 Bacteria 2427
528 Ga0501080_0554370 3300049742 Unclassified 1023
529 Ga0495612_0179505 3300053078 Unclassified 929
530 Ga0466962_0028790 3300061719 Bacteria 2661
531 Ga0466962_0227549 3300061719 Unclassified 914
532 Ga0466962_0295513 3300061719 Bacteria 801
533 Ga0466962_0335164 3300061719 Unclassified 752
534 Ga0395900_0103635
535 JGI24752J21851_1010719
536 JGI24740J21852_10028415
537 JGI24740J21852_10028562
538 JGI24737J22298_10019577
539 JGI24735J21928_10031788
540 JGI24738J21930_10029111
541 JGI24744J21845_10000072
542 Ga0065715_10203744
543 Ga0070658_10012328
544 Ga0070658_10018678
545 Ga0070658_10025337
546 Ga0070658_10092103
547 Ga0070658_10158952
548 Ga0070676_10019947
549 Ga0070676_10354514
550 Ga0070683_100020037
551 Ga0070683_100029136
552 Ga0070683_100152703
553 Ga0070690_100008291
554 Ga0070670_100562064
555 Ga0070666_10001975
556 Ga0070666_10003290
557 Ga0070666_10204426
558 Ga0070680_100001960
559 Ga0070680_100007602
560 Ga0070680_100008811
561 Ga0070680_100011384
562 Ga0070680_100017846
563 Ga0070680_100059024
564 Ga0070682_100002765
565 Ga0070682_100086275
566 Ga0070682_100156071
567 Ga0068868_100001497
568 Ga0068868_100040484
569 Ga0068868_100055402
570 Ga0068868_100079400
571 Ga0070660_100012165
572 Ga0070660_100022407
573 Ga0070660_100037983
574 Ga0070660_100079712
575 Ga0070660_100087800
576 Ga0070660_100331902
577 Ga0070660_100438687
578 Ga0070689_100292869
579 Ga0070691_10012038
580 Ga0070687_100165315
581 Ga0070661_100009699
582 Ga0070661_100013255
583 Ga0070661_100024072
584 Ga0070661_100040242
585 Ga0070661_100485454
586 Ga0070692_10029359
587 Ga0070675_100052515
588 Ga0070675_100065993
589 Ga0070675_100069765
590 Ga0070671_100023117
591 Ga0070671_100032123
592 Ga0070671_100083381
593 Ga0070671_100102644
594 Ga0070671_100105375
595 Ga0070674_100004983
596 Ga0070674_100043898
597 Ga0070674_100063650
598 Ga0070673_100001132
599 Ga0070673_100003531
600 Ga0070673_100361679
601 Ga0070673_100503552
602 Ga0070659_100019290
603 Ga0070659_100022605
604 Ga0070659_100028342
605 Ga0070659_100079490
606 Ga0070659_100174893
607 Ga0070659_100263080
608 Ga0070659_100490922
609 Ga0070667_100005255
610 Ga0070667_100020316
611 Ga0070667_100044768
612 Ga0070667_100548319
613 Ga0070714_100281075
614 Ga0070714_100760452
615 Ga0070713_100014782
616 Ga0070663_100016007
617 Ga0070663_100052968
618 Ga0070663_100073497
619 Ga0070663_100176802
620 Ga0070663_100238366
621 Ga0070678_100005013
622 Ga0070678_100005250
623 Ga0070678_100081154
624 Ga0070662_100002632
625 Ga0070662_100005625
626 Ga0070662_100088946
627 Ga0070662_100153168
628 Ga0070681_10030807
629 Ga0070681_10067399
630 Ga0068867_100006361
631 Ga0070685_10032615
632 Ga0070679_100027755
633 Ga0070679_100030368
634 Ga0070679_100319850
635 Ga0070679_100482545
636 Ga0070679_100635212
637 Ga0070684_100016831
638 Ga0070684_100023225
639 Ga0070684_100076123
640 Ga0070684_100805962
641 Ga0068853_100055802
642 Ga0068853_100064792
643 Ga0068853_100089050
644 Ga0068853_100189104
645 Ga0068853_100318290
646 Ga0068853_100530134
647 Ga0068853_100795068
648 Ga0070672_100005635
649 Ga0070672_100006621
650 Ga0070672_100154751
651 Ga0070695_100253821
652 Ga0070696_100263916
653 Ga0070693_100001691
654 Ga0070665_100016126
655 Ga0070665_100034511
656 Ga0070665_100273007
657 Ga0068855_100019383
658 Ga0068855_100182411
659 Ga0068855_100274337
660 Ga0068855_100820224
661 Ga0068855_100860789
662 Ga0070664_100007622
663 Ga0070664_100010116
664 Ga0070664_100011689
665 Ga0070664_100022439
666 Ga0070664_100032733
667 Ga0070664_100065137
668 Ga0070664_100433187
669 Ga0068857_100002945
670 Ga0068857_100018000
671 Ga0068857_100044515
672 Ga0068857_100048254
673 Ga0068854_100041113
674 Ga0068854_100047870
675 Ga0068854_100052586
676 Ga0068854_100577930
677 Ga0068856_100028185
678 Ga0068856_100039322
679 Ga0068856_100051429
680 Ga0068856_100088662
681 Ga0068856_100345389
682 Ga0068856_100483385
683 Ga0068856_100641792
684 Ga0068852_100004848
685 Ga0068852_100004886
686 Ga0068852_100021600
687 Ga0068852_100028783
688 Ga0068852_100083937
689 Ga0068852_100334674
690 Ga0068859_100017599
691 Ga0068859_100125068
692 Ga0068864_100001642
693 Ga0068864_100008878
694 Ga0068864_100028599
695 Ga0068866_10010216
696 Ga0068861_100494668
697 Ga0068851_10006186
698 Ga0068851_10216339
699 Ga0068863_100011068
700 Ga0068863_100033535
701 Ga0068863_100034907
702 Ga0068863_100124549
703 Ga0068858_100002545
704 Ga0068858_100014125
705 Ga0068858_100019058
706 Ga0068860_100034230
707 Ga0068860_100186149
708 Ga0070716_100060970
709 Ga0097621_100013293
710 Ga0097621_100015640
711 Ga0097621_100034267
712 Ga0068871_100007445
713 Ga0068871_100021153
714 Ga0068865_100006686
715 Ga0068865_100213440
716 Ga0097620_100017600
717 Ga0097620_100125064
718 Ga0105240_10050806
719 Ga0105240_10070774
720 Ga0105245_10010546
721 Ga0105245_10072184
722 Ga0105247_10115034
723 Ga0105243_10023919
724 Ga0105243_10220458
725 Ga0105241_10047638
726 Ga0105241_10160760
727 Ga0105242_10009591
728 Ga0105248_10005810
729 Ga0105248_10038332
730 Ga0105248_10180733
731 Ga0105237_10067334
732 Ga0105237_10121532
733 Ga0105238_10016671
734 Ga0105238_10163686
735 Ga0105238_10337677
736 Ga0105246_10144498
737 Ga0157373_10038000
738 Ga0157373_10044714
739 Ga0157373_10063921
740 Ga0157373_10213833
741 Ga0157373_10240053
742 Ga0157371_10021293
743 Ga0157371_10024685
744 Ga0157371_10138066
745 Ga0157371_10260802
746 Ga0157371_10384710
747 Ga0157371_10419056
748 Ga0157370_10001875
749 Ga0157370_10023030
750 Ga0157370_10023359
751 Ga0157370_10042639
752 Ga0157370_10168638
753 Ga0157369_10034175
754 Ga0157369_10075809
755 Ga0157369_10246658
756 Ga0157374_10022956
757 Ga0157378_10012580
758 Ga0157378_10033888
759 Ga0157378_10157507
760 Ga0157378_10294945
761 Ga0163162_10020561
762 Ga0157372_10211590
763 Ga0157372_10284097
764 Ga0157372_10513842
765 Ga0157372_10727941
766 Ga0157375_10009954
767 Ga0163163_10055306
768 Ga0163163_10091322
769 Ga0157377_10349064
770 Ga0157379_10002869
771 Ga0157379_10010521
772 Ga0157376_10030968
773 Ga0163161_10209610
774 Ga0197907_10814763
775 Ga0206356_11877315
776 Ga0206354_10518832
777 Ga0206353_10080605
778 Ga0207656_10030437
779 Ga0207656_10144049
780 Ga0207656_10191381
781 Ga0207642_10033971
782 Ga0207642_10045108
783 Ga0207710_10307425
784 Ga0207688_10078702
785 Ga0207680_10001306
786 Ga0207680_10006317
787 Ga0207680_10010102
788 Ga0207647_10002598
789 Ga0207647_10015034
790 Ga0207647_10064097
791 Ga0207645_10026652
792 Ga0207645_10084796
793 Ga0207645_10388874
794 Ga0207705_10001651
795 Ga0207705_10027003
796 Ga0207705_10028881
797 Ga0207705_10038012
798 Ga0207705_10056625
799 Ga0207705_10104353
800 Ga0207705_10182875
801 Ga0207705_10194416
802 Ga0207707_10117980
803 Ga0207695_10018678
804 Ga0207695_10748382
805 Ga0207671_10096217
806 Ga0207660_10000716
807 Ga0207660_10001309
808 Ga0207660_10010110
809 Ga0207660_10066923
810 Ga0207660_10182978
811 Ga0207660_10203997
812 Ga0207657_10001862
813 Ga0207657_10005820
814 Ga0207657_10005882
815 Ga0207657_10011525
816 Ga0207657_10074217
817 Ga0207657_10107322
818 Ga0207657_10236927
819 Ga0207649_10002104
820 Ga0207649_10016221
821 Ga0207649_10027651
822 Ga0207649_10060930
823 Ga0207649_10110274
824 Ga0207652_10012439
825 Ga0207652_10317384
826 Ga0207652_10385286
827 Ga0207652_10439975
828 Ga0207694_10128992
829 Ga0207694_10196502
830 Ga0207650_10006964
831 Ga0207650_10094558
832 Ga0207659_10097392
833 Ga0207687_10070185
834 Ga0207700_10029593
835 Ga0207664_10095828
836 Ga0207664_10420214
837 Ga0207644_10001036
838 Ga0207644_10001055
839 Ga0207644_10020468
840 Ga0207690_10010318
841 Ga0207690_10033602
842 Ga0207690_10038177
843 Ga0207690_10038851
844 Ga0207690_10051428
845 Ga0207690_10062840
846 Ga0207690_10079576
847 Ga0207690_10174153
848 Ga0207690_10322539
849 Ga0207690_10519498
850 Ga0207706_10002923
851 Ga0207706_10002977
852 Ga0207706_10054433
853 Ga0207706_10058767
854 Ga0207706_10225872
855 Ga0207706_10247901
856 Ga0207686_10004481
857 Ga0207670_10302586
858 Ga0207669_10005160
859 Ga0207704_10199193
860 Ga0207691_10001996
861 Ga0207691_10002787
862 Ga0207691_10153289
863 Ga0207711_10003024
864 Ga0207711_10009940
865 Ga0207711_10197864
866 Ga0207711_10539098
867 Ga0207711_10685372
868 Ga0207661_10010079
869 Ga0207661_10021095
870 Ga0207661_10025169
871 Ga0207661_10238694
872 Ga0207679_10015997
873 Ga0207679_10021255
874 Ga0207679_10079600
875 Ga0207679_10127150
876 Ga0207679_10155444
877 Ga0207679_10360657
878 Ga0207667_10004287
879 Ga0207667_10089017
880 Ga0207667_10280616
881 Ga0207667_10737718
882 Ga0207651_10001542
883 Ga0207651_10002725
884 Ga0207651_10283755
885 Ga0207640_10003404
886 Ga0207640_10031678
887 Ga0207640_10039030
888 Ga0207640_10047165
889 Ga0207658_10005276
890 Ga0207658_10012694
891 Ga0207658_10053374
892 Ga0207658_10498519
893 Ga0207677_10003171
894 Ga0207677_10003995
895 Ga0207677_10229420
896 Ga0207703_10019201
897 Ga0207703_10024121
898 Ga0207703_10036865
899 Ga0207639_10002075
900 Ga0207639_10153369
901 Ga0207639_10206811
902 Ga0207639_10511427
903 Ga0207678_10014800
904 Ga0207678_10083177
905 Ga0207678_10182624
906 Ga0207678_10235676
907 Ga0207678_10300474
908 Ga0207702_10005569
909 Ga0207702_10017951
910 Ga0207702_10038783
911 Ga0207702_10041446
912 Ga0207702_10069946
913 Ga0207702_10213409
914 Ga0207702_10526096
915 Ga0207702_10869715
916 Ga0207641_10011882
917 Ga0207641_10042941
918 Ga0207641_11035411
919 Ga0207648_10010598
920 Ga0207676_10006163
921 Ga0207676_10436464
922 Ga0207676_10495616
923 Ga0207674_10000271
924 Ga0207674_10000780
925 Ga0207674_10003100
926 Ga0207674_10004321
927 Ga0207674_10023046
928 Ga0207675_100408503
929 Ga0207683_10001537
930 Ga0207683_10006388
931 Ga0207683_10326801
932 Ga0207698_10001436
933 Ga0207698_10002802
934 Ga0207698_10006239
935 Ga0207698_10016104
936 Ga0207698_10057796
937 Ga0207698_10532649
938 Ga0268266_10000458
939 Ga0268266_10010398
940 Ga0268266_10044171
941 Ga0268264_10132428
942 Ga0307405_10140896
943 Ga0307416_100570360
944 Ga0373955_0062725
945 Ga0373935_0025493
946 Ga0373933_0212425
947 Ga0395899_0008499
948 Ga0395899_0014094
949 Ga0395899_0060488
950 Ga0395899_0219057
951 Ga0395900_0013711
952 Ga0395900_0013806
953 Ga0395900_0062328
954 Ga0395900_0081116
955 Ga0395900_0126912
956 Ga0395900_0170507
957 Ga0395900_0171352
958 Ga0395900_0236107
959 Ga0395900_0245191
960 Ga0395900_0279343
961 Ga0395900_0315736
962 Ga0395900_0732598
963 Ga0395900_0817642
964 Ga0395898_0087043
965 Ga0395898_0089055
966 Ga0395898_0097940
967 Ga0395898_0098845
968 Ga0395898_0100821
969 Ga0395898_0104116
970 Ga0395898_0127566
971 Ga0395898_0215257
972 Ga0395905_0001997
973 Ga0395905_0006735
974 Ga0395905_0008262
975 Ga0395905_0010132
976 Ga0395905_0023006
977 Ga0395905_0040830
978 Ga0395905_0083847
979 Ga0395905_0091575
980 Ga0395905_0144388
981 Ga0395905_0175109
982 Ga0395905_0422312
983 Ga0395905_0461524
984 Ga0395905_0607572
985 Ga0395901_0002513
986 Ga0395901_0006861
987 Ga0395901_0007314
988 Ga0395901_0008904
989 Ga0395901_0036368
990 Ga0395901_0100253
991 Ga0395901_0132884
992 Ga0395901_0153405
993 Ga0395901_0159760
994 Ga0395901_0245769
995 Ga0395901_0258554
996 Ga0395901_0289461
997 Ga0395901_0302019
998 Ga0395901_0306141
999 Ga0395901_0488155
1000 Ga0439448_0004171
1001 Ga0439455_0027992
1002 Ga0439458_0022391
1003 Ga0466972_0059516
1004 Ga0466965_0246232
1005 Ga0466966_0042918
1006 Ga0466963_0023695
1007 Ga0466963_0032333
1008 Ga0466963_0066689
1009 Ga0466964_0090420
1010 Ga0466968_0004672
1011 Ga0466970_0007504
1012 Ga0466970_0079639
1013 Ga0466957_0140179
1014 Ga0466959_0006389
1015 Ga0466959_0056203
1016 Ga0466959_0099974
1017 Ga0466959_0311946
1018 Ga0466959_0331623
1019 Ga0466958_0011056
1020 Ga0466958_0119283
1021 Ga0466967_0003513
1022 Ga0466967_0034884
1023 Ga0466967_0092201
1024 Ga0466967_0239483
1025 Ga0466967_0292447
1026 Ga0495643_0186689
1027 Ga0495647_0013059
1028 Ga0496100_0061673
1029 Ga0496100_0093938
1030 Ga0496101_0011745
1031 Ga0496101_0024318
1032 Ga0496101_0054058
1033 Ga0496102_0022268
1034 Ga0496102_0221350
1035 Ga0496103_0474623
1036 Ga0496104_0211029
1037 Ga0496105_0016317
1038 Ga0496105_0018231
1039 Ga0496106_0003210
1040 Ga0496107_0001852
1041 Ga0496107_0070176
1042 Ga0496108_0000578
1043 Ga0496108_0003009
1044 Ga0496108_0018738
1045 Ga0496109_0004627
1046 Ga0496109_0013232
1047 Ga0496109_0032517
1048 Ga0496110_0004837
1049 Ga0496110_0009281
1050 Ga0496111_0000970
1051 Ga0496111_0088831
1052 Ga0496111_0362539
1053 Ga0496112_0013295
1054 Ga0496112_0020194
1055 Ga0496112_0023255
1056 Ga0496113_0000659
1057 Ga0496113_0012992
1058 Ga0496114_0040584
1059 Ga0496115_0010245
1060 Ga0501070_0097861
1061 Ga0501080_0554370
1062 Ga0495612_0179505
1063 Ga0466962_0028790
1064 Ga0466962_0227549
1065 Ga0466962_0295513
1066 Ga0466962_0335164

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01292

Ni_hydr_CYTB

Prokaryotic cytochrome b561

25

193

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ch4-assembly1.cif.gz_G peptide-bound state of thermus thermophilus secyeg 0.664 102 164
5ch4-assembly1.cif.gz_G peptide-bound state of thermus thermophilus secyeg 0.5703 102 164
4gd3-assembly1.cif.gz_A structure of e. coli hydrogenase-1 in complex with cytochrome b 0.5621 18 177
8akn-assembly1.cif.gz_W cryo-em structure of the proline-rich antimicrobial peptide drosocin bound to the terminating ribosome 0.5196 81 161
8u4v-assembly1.cif.gz_A cryo-em structure of human claudin-4 complex with clostridium perfringens enterotoxin c-terminal domain, sfab cop-1, and nanobody 0.5187 101 221
ID Description Score Start End Superfamily
1kqgC00 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.6122 13 188 1.20.950.20
af_P0AAM1_1_207_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.5971 1 173 1.20.950.20
4gd3B00 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.5623 18 177 1.20.950.20
af_D3YXS5_690_1028_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.5551 82 175 2.60.40.150
af_V6CKM5_1256_1408_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.5435 18 185 1.20.120.350
ID Description Score Start End GO Terms
AF-A0A6J4TLL8-F1-model_v4 Cytochrome b561 bacterial/Ni-hydrogenase domain-containing protein 0.8821 14 228 GO:0005886
GO:0009055
GO:0020037
GO:0022904
AF-A0A1U9JLL2-F1-model_v4 Hydrogenase 0.8777 14 222 GO:0005886
GO:0009055
GO:0020037
GO:0022904
AF-A0A537MGM9-F1-model_v4 Ni/Fe-hydrogenase 1 b-type cytochrome subunit 0.8714 14 219 GO:0005886
GO:0009055
GO:0020037
GO:0022904
AF-A9LZ79-F1-model_v4 deleted 0.8713 47 221
AF-A0A850KKC3-F1-model_v4 Cytochrome b/b6 domain-containing protein 0.8693 14 218 GO:0005886
GO:0009055
GO:0020037
GO:0022904

Map