metagRoot

F460197

General Info

Members	Datasets	Scaffolds	Average Seq Length
531	275	523	404

Family's Representative Sequence

Representative Sequence	3300050507\|nmdc:mga05p37_472837_c1\|nmdc:mga05p37_472837_c1_100_1416
Length	438
Sequence	VRIDHVLEQRTVDKPCGMAHARGGTGMTRVATTSRNMAVVKTLTYLMFAXXXMTTDSVGLIIPEVVKTFRLSLTAAGTFQYATMTGIALAGLMLGQLADRFGRRPTIVIGLTVFAAACFLLAAGDTLSFFAVMLGVSGLAIGVFKTGALALIGDISTSTAQHTSIMNTVEGFFGVGAIIGPAILTRMLAAGMSWKWLYVMAGTICVVLIVLALLVQYPRTVTPARSGLSTGTMRAMKNGYVLAFSGGAFLYVGVEAAIYVWMPTLMAGYAGSAVTLATYSISIFFLLRAAGRFLGAWVLARVQWQTVLALFSGCILICFGLSVAGGMNWAVYLLPLSGLFMSVVYPTLNSKGISCLPKSEHGAAAGVILFFTCVSAVLAPLAIGAVSDAFGHIVYGFWLATGLAALLFVGLSLNWAFNPTRAMLEQLDVTEYRQNATA

Samples

	Sample ID	Description	Type	Environment
1	2582581279	Caulobacter henricii OK261	Isolate	Rhizosphere
2	2643221552	Caulobacter sp. Root1472	Isolate	Unclassified
3	2643221583	Caulobacter sp. Root655	Isolate	Unclassified
4	2643221584	Caulobacter sp. Root656	Isolate	Unclassified
5	2751185897	Sphingomonas panacis DCY99	Isolate	Unclassified
6	2818991435	Caulobacter henricii 536	Isolate	Unclassified
7	2818991454	Caulobacter rhizosphaerae 3260	Isolate	Rhizosphere
8	2919709256	Sphingobium xenophagum 4256	Isolate	Unclassified
9	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
10	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
11	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
12	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
13	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
14	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
15	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
16	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
17	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
18	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
19	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
20	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
21	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
22	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
23	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
24	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
25	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
26	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
27	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
28	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
29	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
30	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
31	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
32	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
33	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
34	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
35	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
36	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
37	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
38	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
39	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
40	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
41	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
42	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
43	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
44	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
45	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
46	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
47	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
48	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
49	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
50	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
51	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
52	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
53	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
54	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
55	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
56	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
57	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
58	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
59	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
60	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
61	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
62	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
63	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
64	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
65	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
66	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
67	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
68	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
69	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
70	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
71	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
72	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
73	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
74	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
75	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
76	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
77	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
78	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
79	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
80	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
81	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
82	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
83	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
84	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
85	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
86	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
87	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
88	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
89	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
90	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
91	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
92	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
93	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
94	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
95	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
96	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
97	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
98	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
99	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
100	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
101	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
102	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
103	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
104	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
105	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
106	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
107	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
108	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
109	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
110	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
111	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
112	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
167	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
168	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
170	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
171	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
172	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
173	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
174	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
175	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
176	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
177	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
178	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
179	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
180	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
181	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
182	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
183	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
184	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
185	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
186	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
187	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
188	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
189	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
190	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
191	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
192	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
193	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
194	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
195	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
196	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
197	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
198	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
199	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
200	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
201	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
202	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
203	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
204	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
205	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
206	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
207	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
208	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
209	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
210	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
211	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
212	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
213	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
214	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
215	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
216	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
217	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
218	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
219	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
220	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
221	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
222	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
223	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
224	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
225	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
226	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
227	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
228	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
229	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
230	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
231	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
232	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
233	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
234	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
235	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
236	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
237	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
238	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
239	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
240	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
241	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
242	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
243	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
244	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
245	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
246	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
247	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
248	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
249	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
250	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
251	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
252	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
253	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
254	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
255	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
256	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
257	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
258	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
259	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
260	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
261	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
262	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
263	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
264	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
265	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
266	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
267	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
268	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
269	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
270	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
271	3300053138	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere	Metagenome	Endosphere
272	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
273	3300053731	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere	Metagenome	Endosphere
274	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
275	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	98.49
Metatranscriptomes	0
Isolates	1.51

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	2.07
Nodule	0
Rhizoplane	1.69
Rhizosphere	93.97
Stem	0
Stem Tuber	0
Unclassified	2.26

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	rootH1_10125896	3300003316	Bacteria	1395
2	rootH1_10000304	3300003323	Bacteria	29274
3	Ga0055526_1030704	3300003771	Bacteria	1561
4	Ga0055531_10001113	3300003794	Bacteria	20882
5	Ga0065165_1002205	3300005262	Bacteria	17441
6	Ga0065712_10085572	3300005290	Bacteria	2687
7	Ga0065707_10123615	3300005295	Bacteria	2061
8	Ga0070683_100009538	3300005329	Bacteria	8310
9	Ga0070683_100018579	3300005329	Bacteria	6162
10	Ga0070683_100285513	3300005329	Bacteria	1570
11	Ga0070690_100000471	3300005330	Bacteria	20213
12	Ga0070690_100019755	3300005330	Bacteria	4097
13	Ga0070670_100015989	3300005331	Bacteria	6439
14	Ga0070670_100074991	3300005331	Bacteria	2907
15	Ga0070677_10076059	3300005333	Bacteria	1425
16	Ga0068869_100037743	3300005334	Bacteria	3436
17	Ga0068869_100050374	3300005334	Bacteria	3018
18	Ga0070666_10008680	3300005335	Bacteria	6320
19	Ga0070666_10022039	3300005335	Bacteria	4133
20	Ga0070666_10022643	3300005335	Bacteria	4082
21	Ga0070680_100024178	3300005336	Bacteria	4848
22	Ga0068868_100005204	3300005338	Bacteria	9131
23	Ga0068868_100048154	3300005338	Bacteria	3343
24	Ga0070689_100015852	3300005340	Bacteria	5505
25	Ga0070689_100037127	3300005340	Unclassified	3726
26	Ga0070689_100046391	3300005340	Bacteria	3349
27	Ga0070689_100130843	3300005340	Unclassified	2012
28	Ga0070691_10000546	3300005341	Bacteria	14269
29	Ga0070691_10035364	3300005341	Bacteria	2352
30	Ga0070661_100016060	3300005344	Bacteria	5284
31	Ga0070661_100121505	3300005344	Bacteria	1957
32	Ga0070669_100005783	3300005353	Bacteria	8916
33	Ga0070669_100215190	3300005353	Bacteria	1517
34	Ga0070675_100010724	3300005354	Bacteria	7168
35	Ga0070675_100036634	3300005354	Bacteria	3993
36	Ga0070675_100037431	3300005354	Bacteria	3952
37	Ga0070675_100130067	3300005354	Bacteria	2144
38	Ga0070671_100030341	3300005355	Unclassified	4462
39	Ga0070671_100050593	3300005355	Bacteria	3455
40	Ga0070674_100168581	3300005356	Bacteria	1667
41	Ga0070674_100275358	3300005356	Bacteria	1332
42	Ga0070673_100012899	3300005364	Bacteria	5756
43	Ga0070673_100025688	3300005364	Bacteria	4339
44	Ga0070673_100175465	3300005364	Bacteria	1831
45	Ga0070673_100237629	3300005364	Bacteria	1583
46	Ga0070688_100103819	3300005365	Bacteria	1878
47	Ga0070688_100118437	3300005365	Bacteria	1770
48	Ga0070688_100165579	3300005365	Bacteria	1522
49	Ga0070659_100077694	3300005366	Bacteria	2648
50	Ga0070667_100004308	3300005367	Bacteria	12011
51	Ga0070667_100005961	3300005367	Bacteria	10130
52	Ga0070667_100125445	3300005367	Bacteria	2237
53	Ga0070713_100008331	3300005436	Bacteria	7352
54	Ga0070713_100024067	3300005436	Bacteria	4737
55	Ga0070713_100225186	3300005436	Bacteria	1703
56	Ga0070701_10024516	3300005438	Unclassified	2918
57	Ga0070701_10052660	3300005438	Bacteria	2115
58	Ga0070711_100192606	3300005439	Bacteria	1568
59	Ga0070700_100138354	3300005441	Bacteria	1652
60	Ga0070708_100063418	3300005445	Unclassified	3308
61	Ga0070663_100040140	3300005455	Bacteria	3275
62	Ga0070678_100174754	3300005456	Bacteria	1753
63	Ga0070662_100049179	3300005457	Bacteria	3040
64	Ga0070681_10000717	3300005458	Bacteria	27458
65	Ga0070681_10128123	3300005458	Bacteria	2471
66	Ga0068867_100050134	3300005459	Bacteria	3075
67	Ga0068867_100066349	3300005459	Bacteria	2688
68	Ga0068867_100096429	3300005459	Bacteria	2252
69	Ga0068867_100128846	3300005459	Bacteria	1964
70	Ga0070699_100100242	3300005518	Bacteria	2538
71	Ga0070679_100009314	3300005530	Bacteria	9284
72	Ga0070679_100009336	3300005530	Bacteria	9274
73	Ga0070684_100010581	3300005535	Bacteria	7314
74	Ga0070684_100018837	3300005535	Bacteria	5697
75	Ga0068853_100009391	3300005539	Bacteria	7885
76	Ga0068853_100057450	3300005539	Bacteria	3358
77	Ga0070672_100003460	3300005543	Bacteria	10233
78	Ga0070672_100024625	3300005543	Bacteria	4452
79	Ga0070672_100214677	3300005543	Bacteria	1612
80	Ga0070672_100276950	3300005543	Bacteria	1418
81	Ga0070686_100008251	3300005544	Bacteria	5832
82	Ga0070686_100061150	3300005544	Bacteria	2432
83	Ga0070686_100061954	3300005544	Bacteria	2419
84	Ga0070693_100076326	3300005547	Bacteria	1986
85	Ga0070665_100028208	3300005548	Bacteria	5653
86	Ga0070665_100264075	3300005548	Bacteria	1723
87	Ga0068855_100003383	3300005563	Bacteria	19524
88	Ga0068855_100092629	3300005563	Bacteria	3485
89	Ga0068855_100155604	3300005563	Bacteria	2597
90	Ga0070664_100012376	3300005564	Bacteria	6934
91	Ga0070664_100012384	3300005564	Bacteria	6932
92	Ga0070664_100025241	3300005564	Bacteria	4924
93	Ga0068857_100003164	3300005577	Bacteria	13655
94	Ga0068857_100135437	3300005577	Bacteria	2224
95	Ga0068854_100034770	3300005578	Bacteria	3522
96	Ga0068856_100002183	3300005614	Bacteria	20301
97	Ga0068856_100002236	3300005614	Bacteria	19976
98	Ga0068856_100027729	3300005614	Bacteria	5525
99	Ga0070702_100163765	3300005615	Bacteria	1440
100	Ga0068852_100081677	3300005616	Bacteria	2870
101	Ga0068859_100025410	3300005617	Bacteria	5941
102	Ga0068859_100033881	3300005617	Bacteria	5128
103	Ga0068859_100099066	3300005617	Bacteria	2970
104	Ga0068864_100004651	3300005618	Bacteria	11256
105	Ga0068866_10020880	3300005718	Bacteria	3008
106	Ga0068870_10001929	3300005840	Bacteria	8559
107	Ga0068863_100001928	3300005841	Bacteria	20597
108	Ga0068863_100041143	3300005841	Bacteria	4393
109	Ga0068863_100134376	3300005841	Bacteria	2363
110	Ga0068863_100156375	3300005841	Bacteria	2183
111	Ga0068863_100310243	3300005841	Bacteria	1531
112	Ga0068858_100007179	3300005842	Bacteria	10802
113	Ga0068858_100028455	3300005842	Bacteria	5191
114	Ga0068858_100034959	3300005842	Bacteria	4661
115	Ga0068858_100067137	3300005842	Bacteria	3322
116	Ga0068858_100143576	3300005842	Bacteria	2241
117	Ga0068860_100043302	3300005843	Bacteria	4295
118	Ga0068860_100131395	3300005843	Bacteria	2403
119	Ga0081539_10000016	3300005985	Bacteria	381648
120	Ga0070717_10019572	3300006028	Bacteria	5312
121	Ga0070717_10082973	3300006028	Bacteria	2694
122	Ga0070715_10009732	3300006163	Bacteria	3399
123	Ga0097621_100000409	3300006237	Bacteria	29993
124	Ga0097621_100000993	3300006237	Bacteria	19926
125	Ga0097621_100002957	3300006237	Bacteria	11664
126	Ga0097621_100015161	3300006237	Bacteria	5791
127	Ga0097621_100024846	3300006237	Unclassified	4684
128	Ga0097621_100157292	3300006237	Bacteria	1951
129	Ga0097621_100166573	3300006237	Bacteria	1897
130	Ga0097621_100168946	3300006237	Unclassified	1884
131	Ga0097621_100242479	3300006237	Bacteria	1576
132	Ga0068871_100000126	3300006358	Bacteria	48480
133	Ga0068871_100001020	3300006358	Bacteria	18762
134	Ga0068871_100002455	3300006358	Bacteria	12658
135	Ga0068871_100002702	3300006358	Bacteria	12100
136	Ga0068871_100006820	3300006358	Bacteria	8122
137	Ga0068871_100010197	3300006358	Bacteria	6843
138	Ga0068871_100043931	3300006358	Unclassified	3592
139	Ga0068871_100099891	3300006358	Bacteria	2430
140	Ga0068871_100195587	3300006358	Bacteria	1744
141	Ga0075428_100008696	3300006844	Bacteria	11264
142	Ga0075428_100011465	3300006844	Bacteria	9860
143	Ga0075428_100037614	3300006844	Bacteria	5326
144	Ga0075430_100009276	3300006846	Bacteria	8314
145	Ga0075431_100004514	3300006847	Bacteria	13665
146	Ga0075431_100035566	3300006847	Bacteria	5128
147	Ga0075431_100115033	3300006847	Bacteria	2777
148	Ga0075433_10006743	3300006852	Bacteria	9099
149	Ga0075433_10017899	3300006852	Bacteria	5877
150	Ga0075433_10042253	3300006852	Bacteria	3954
151	Ga0075434_100004517	3300006871	Bacteria	12556
152	Ga0075434_100028928	3300006871	Bacteria	5449
153	Ga0075429_100005948	3300006880	Bacteria	10532
154	Ga0068865_100002823	3300006881	Bacteria	10334
155	Ga0068865_100130132	3300006881	Bacteria	1884
156	Ga0097620_100025410	3300006931	Bacteria	5941
157	Ga0097620_100033881	3300006931	Bacteria	5128
158	Ga0097620_100099067	3300006931	Bacteria	2970
159	Ga0075435_100015878	3300007076	Bacteria	5667
160	Ga0075435_100156176	3300007076	Bacteria	1920
161	Ga0105240_10116667	3300009093	Bacteria	3220
162	Ga0105240_10142457	3300009093	Bacteria	2864
163	Ga0105240_10161003	3300009093	Bacteria	2665
164	Ga0111539_10016039	3300009094	Bacteria	9300
165	Ga0111539_10063051	3300009094	Bacteria	4386
166	Ga0111539_10068626	3300009094	Unclassified	4186
167	Ga0111539_10157453	3300009094	Bacteria	2658
168	Ga0105245_10004051	3300009098	Bacteria	13022
169	Ga0105245_10021067	3300009098	Bacteria	5719
170	Ga0105245_10196425	3300009098	Bacteria	1935
171	Ga0105247_10005177	3300009101	Bacteria	8246
172	Ga0105247_10083594	3300009101	Unclassified	2016
173	Ga0105247_10133902	3300009101	Unclassified	1618
174	Ga0114129_10050662	3300009147	Bacteria	5832
175	Ga0114129_10125003	3300009147	Unclassified	3537
176	Ga0114129_10532356	3300009147	Unclassified	1531
177	Ga0105243_10035468	3300009148	Bacteria	3867
178	Ga0105243_10282536	3300009148	Unclassified	1496
179	Ga0105241_10043773	3300009174	Bacteria	3391
180	Ga0105242_10001177	3300009176	Bacteria	20603
181	Ga0105242_10007559	3300009176	Bacteria	8365
182	Ga0105242_10021363	3300009176	Bacteria	5080
183	Ga0105248_10000285	3300009177	Bacteria	59638
184	Ga0105248_10006094	3300009177	Bacteria	13228
185	Ga0105248_10008745	3300009177	Bacteria	11122
186	Ga0105248_10023981	3300009177	Bacteria	6782
187	Ga0105248_10039773	3300009177	Bacteria	5270
188	Ga0105248_10098148	3300009177	Bacteria	3300
189	Ga0105248_10108121	3300009177	Unclassified	3136
190	Ga0105248_10151672	3300009177	Bacteria	2615
191	Ga0105248_10375570	3300009177	Unclassified	1600
192	Ga0105248_10440702	3300009177	Unclassified	1467
193	Ga0105237_10004706	3300009545	Bacteria	15702
194	Ga0105237_10015196	3300009545	Bacteria	8020
195	Ga0105237_10112814	3300009545	Bacteria	2710
196	Ga0105238_10034675	3300009551	Bacteria	5134
197	Ga0105238_10121026	3300009551	Bacteria	2597
198	Ga0105249_10010743	3300009553	Bacteria	8043
199	Ga0105249_10166926	3300009553	Bacteria	2132
200	Ga0105239_10072471	3300010375	Unclassified	3787
201	Ga0105239_10145595	3300010375	Bacteria	2642
202	Ga0105239_10168239	3300010375	Bacteria	2451
203	Ga0105239_10285291	3300010375	Unclassified	1859
204	Ga0157371_10024155	3300013102	Bacteria	4441
205	Ga0157371_10134994	3300013102	Bacteria	1757
206	Ga0157370_10150744	3300013104	Bacteria	2164
207	Ga0157369_10009109	3300013105	Bacteria	11358
208	Ga0157369_10032477	3300013105	Bacteria	5740
209	Ga0157369_10105124	3300013105	Bacteria	3006
210	Ga0157374_10000228	3300013296	Bacteria	52018
211	Ga0157374_10001472	3300013296	Bacteria	19883
212	Ga0157378_10001696	3300013297	Bacteria	19840
213	Ga0157378_10056239	3300013297	Bacteria	3505
214	Ga0157378_10156796	3300013297	Unclassified	2126
215	Ga0163162_10008193	3300013306	Bacteria	10196
216	Ga0163162_10132581	3300013306	Bacteria	2601
217	Ga0157372_10002808	3300013307	Bacteria	18806
218	Ga0157372_10029585	3300013307	Bacteria	5983
219	Ga0157372_10183173	3300013307	Bacteria	2425
220	Ga0157372_10252457	3300013307	Bacteria	2047
221	Ga0157375_10001831	3300013308	Bacteria	18265
222	Ga0157375_10001860	3300013308	Bacteria	18170
223	Ga0157375_10116326	3300013308	Bacteria	2778
224	Ga0157375_10380352	3300013308	Bacteria	1578
225	Ga0163163_10001927	3300014325	Bacteria	17574
226	Ga0163163_10016474	3300014325	Bacteria	6872
227	Ga0163163_10017306	3300014325	Bacteria	6721
228	Ga0163163_10272161	3300014325	Bacteria	1745
229	Ga0157380_10017474	3300014326	Bacteria	5308
230	Ga0157380_10182697	3300014326	Bacteria	1844
231	Ga0157380_10222697	3300014326	Bacteria	1689
232	Ga0157377_10052557	3300014745	Bacteria	2300
233	Ga0157377_10141521	3300014745	Bacteria	1479
234	Ga0157379_10000853	3300014968	Bacteria	24703
235	Ga0157379_10022588	3300014968	Bacteria	5573
236	Ga0157379_10069359	3300014968	Bacteria	3153
237	Ga0157376_10002393	3300014969	Bacteria	12664
238	Ga0157376_10012170	3300014969	Bacteria	6376
239	Ga0157376_10023838	3300014969	Bacteria	4797
240	Ga0157376_10046995	3300014969	Bacteria	3562
241	Ga0157376_10068665	3300014969	Bacteria	3002
242	Ga0157376_10111159	3300014969	Bacteria	2412
243	Ga0163161_10139568	3300017792	Bacteria	1834
244	Ga0209564_1000518	3300025295	Bacteria	63204
245	Ga0209758_1002558	3300025297	Bacteria	18310
246	Ga0209256_1022885	3300025299	Bacteria	1880
247	Ga0209257_1000074	3300025304	Bacteria	325641
248	Ga0207697_10000888	3300025315	Bacteria	16917
249	Ga0207682_10027362	3300025893	Bacteria	2271
250	Ga0207642_10075106	3300025899	Bacteria	1622
251	Ga0207710_10010789	3300025900	Bacteria	3848
252	Ga0207688_10060702	3300025901	Bacteria	2130
253	Ga0207680_10029739	3300025903	Unclassified	3073
254	Ga0207699_10070317	3300025906	Bacteria	2137
255	Ga0207645_10012876	3300025907	Bacteria	5661
256	Ga0207643_10002278	3300025908	Bacteria	10456
257	Ga0207643_10012383	3300025908	Bacteria	4610
258	Ga0207643_10026135	3300025908	Bacteria	3231
259	Ga0207643_10055005	3300025908	Bacteria	2263
260	Ga0207654_10008746	3300025911	Bacteria	5133
261	Ga0207707_10003757	3300025912	Bacteria	13459
262	Ga0207695_10024484	3300025913	Bacteria	6791
263	Ga0207695_10036973	3300025913	Bacteria	5271
264	Ga0207671_10014198	3300025914	Bacteria	6305
265	Ga0207671_10089093	3300025914	Bacteria	2322
266	Ga0207671_10152740	3300025914	Unclassified	1784
267	Ga0207671_10183864	3300025914	Bacteria	1628
268	Ga0207693_10021970	3300025915	Bacteria	5072
269	Ga0207660_10005523	3300025917	Bacteria	8209
270	Ga0207662_10045834	3300025918	Unclassified	2585
271	Ga0207649_10009492	3300025920	Bacteria	5326
272	Ga0207652_10005591	3300025921	Bacteria	10192
273	Ga0207652_10014983	3300025921	Bacteria	6289
274	Ga0207681_10020060	3300025923	Bacteria	4232
275	Ga0207681_10057903	3300025923	Bacteria	2651
276	Ga0207681_10059648	3300025923	Bacteria	2616
277	Ga0207681_10128476	3300025923	Bacteria	1870
278	Ga0207681_10226981	3300025923	Bacteria	1448
279	Ga0207694_10023173	3300025924	Bacteria	4714
280	Ga0207694_10065126	3300025924	Bacteria	2841
281	Ga0207650_10022941	3300025925	Bacteria	4421
282	Ga0207650_10027879	3300025925	Bacteria	4045
283	Ga0207650_10047513	3300025925	Unclassified	3163
284	Ga0207659_10008362	3300025926	Bacteria	6421
285	Ga0207659_10008380	3300025926	Bacteria	6412
286	Ga0207659_10013852	3300025926	Bacteria	5183
287	Ga0207659_10023319	3300025926	Unclassified	4128
288	Ga0207659_10117033	3300025926	Bacteria	2036
289	Ga0207687_10000286	3300025927	Bacteria	34802
290	Ga0207687_10017655	3300025927	Bacteria	4701
291	Ga0207687_10105630	3300025927	Bacteria	2081
292	Ga0207700_10004068	3300025928	Bacteria	8574
293	Ga0207700_10040810	3300025928	Bacteria	3390
294	Ga0207700_10182192	3300025928	Unclassified	1759
295	Ga0207700_10210707	3300025928	Bacteria	1643
296	Ga0207664_10001404	3300025929	Bacteria	15843
297	Ga0207644_10009694	3300025931	Bacteria	6331
298	Ga0207644_10013320	3300025931	Bacteria	5480
299	Ga0207706_10019526	3300025933	Bacteria	6096
300	Ga0207686_10007996	3300025934	Bacteria	5702
301	Ga0207686_10054400	3300025934	Bacteria	2507
302	Ga0207709_10181725	3300025935	Bacteria	1486
303	Ga0207670_10084828	3300025936	Viruses	2225
304	Ga0207670_10101591	3300025936	Unclassified	2055
305	Ga0207669_10015172	3300025937	Bacteria	3879
306	Ga0207704_10001856	3300025938	Bacteria	9460
307	Ga0207691_10018142	3300025940	Bacteria	6666
308	Ga0207691_10018563	3300025940	Bacteria	6591
309	Ga0207691_10019180	3300025940	Bacteria	6475
310	Ga0207691_10036509	3300025940	Bacteria	4553
311	Ga0207691_10082382	3300025940	Unclassified	2890
312	Ga0207691_10111111	3300025940	Unclassified	2437
313	Ga0207711_10001660	3300025941	Bacteria	20530
314	Ga0207711_10004544	3300025941	Bacteria	11809
315	Ga0207711_10017715	3300025941	Bacteria	5919
316	Ga0207711_10104368	3300025941	Bacteria	2511
317	Ga0207711_10131107	3300025941	Bacteria	2248
318	Ga0207689_10041397	3300025942	Bacteria	3812
319	Ga0207689_10084484	3300025942	Bacteria	2609
320	Ga0207661_10004643	3300025944	Bacteria	9622
321	Ga0207661_10020952	3300025944	Bacteria	4895
322	Ga0207679_10006524	3300025945	Bacteria	7377
323	Ga0207679_10014236	3300025945	Bacteria	5225
324	Ga0207679_10070118	3300025945	Unclassified	2640
325	Ga0207667_10002804	3300025949	Bacteria	21585
326	Ga0207667_10005465	3300025949	Bacteria	15491
327	Ga0207667_10026240	3300025949	Bacteria	6367
328	Ga0207667_10055269	3300025949	Bacteria	4174
329	Ga0207651_10019137	3300025960	Bacteria	4094
330	Ga0207651_10033805	3300025960	Unclassified	3302
331	Ga0207651_10062365	3300025960	Unclassified	2597
332	Ga0207651_10092388	3300025960	Unclassified	2219
333	Ga0207651_10120812	3300025960	Bacteria	1986
334	Ga0207712_10099777	3300025961	Bacteria	2156
335	Ga0207640_10057130	3300025981	Unclassified	2565
336	Ga0207658_10004878	3300025986	Bacteria	9256
337	Ga0207677_10018246	3300026023	Bacteria	4207
338	Ga0207677_10043187	3300026023	Bacteria	2995
339	Ga0207703_10020269	3300026035	Bacteria	5200
340	Ga0207703_10029771	3300026035	Bacteria	4310
341	Ga0207703_10029955	3300026035	Bacteria	4297
342	Ga0207639_10054579	3300026041	Bacteria	3055
343	Ga0207678_10081600	3300026067	Bacteria	2768
344	Ga0207708_10069035	3300026075	Bacteria	2705
345	Ga0207708_10094151	3300026075	Bacteria	2312
346	Ga0207702_10001671	3300026078	Bacteria	21915
347	Ga0207702_10011147	3300026078	Bacteria	7502
348	Ga0207702_10017279	3300026078	Bacteria	5970
349	Ga0207702_10199248	3300026078	Bacteria	1855
350	Ga0207702_10301807	3300026078	Bacteria	1520
351	Ga0207641_10006343	3300026088	Bacteria	9986
352	Ga0207641_10070719	3300026088	Bacteria	2999
353	Ga0207641_10108064	3300026088	Bacteria	2462
354	Ga0207648_10028452	3300026089	Bacteria	4955
355	Ga0207676_10006045	3300026095	Bacteria	8538
356	Ga0207676_10221972	3300026095	Bacteria	1684
357	Ga0207674_10001222	3300026116	Bacteria	33473
358	Ga0207674_10261155	3300026116	Bacteria	1679
359	Ga0207675_100169618	3300026118	Bacteria	2085
360	Ga0207675_100269563	3300026118	Bacteria	1652
361	Ga0207683_10172170	3300026121	Bacteria	1961
362	Ga0207428_10002364	3300027907	Bacteria	18839
363	Ga0207428_10007520	3300027907	Bacteria	9927
364	Ga0207428_10010109	3300027907	Bacteria	8440
365	Ga0268266_10038622	3300028379	Bacteria	4064
366	Ga0268266_10274186	3300028379	Bacteria	1567
367	Ga0268265_10310211	3300028380	Bacteria	1424
368	Ga0268264_10066263	3300028381	Bacteria	3045
369	Ga0265318_10047557	3300028577	Bacteria	1618
370	Ga0307515_10029636	3300028794	Bacteria	9238
371	Ga0307515_10248791	3300028794	Bacteria	1534
372	Ga0265338_10009580	3300028800	Bacteria	11516
373	Ga0265329_10048411	3300031242	Unclassified	1356
374	Ga0265339_10005132	3300031249	Bacteria	8784
375	Ga0265313_10001713	3300031595	Bacteria	20198
376	Ga0265314_10001605	3300031711	Bacteria	24837
377	Ga0265314_10119522	3300031711	Unclassified	1661
378	Ga0307409_100322337	3300031995	Bacteria	1447
379	Ga0307416_100101981	3300032002	Bacteria	2501
380	Ga0307416_100297618	3300032002	Bacteria	1602
381	Ga0307411_10166114	3300032005	Bacteria	1659
382	Ga0307415_100019422	3300032126	Bacteria	4126
383	Ga0373923_0100364	3300035111	Bacteria	1276
384	Ga0373936_0045705	3300035113	Bacteria	1764
385	Ga0373945_0005507	3300035116	Bacteria	4054
386	Ga0373956_0087896	3300035119	Unclassified	1432
387	Ga0373943_0041276	3300035170	Bacteria	2230
388	Ga0373946_0008342	3300035171	Bacteria	3801
389	Ga0373955_0093050	3300035172	Bacteria	1721
390	Ga0373955_0097640	3300035172	Bacteria	1682
391	Ga0373924_0001265	3300035410	Bacteria	8101
392	Ga0373935_0029154	3300035692	Bacteria	3415
393	Ga0373935_0054559	3300035692	Unclassified	2545
394	Ga0373935_0175884	3300035692	Bacteria	1467
395	Ga0373933_0009449	3300035724	Bacteria	5326
396	Ga0373933_0054362	3300035724	Bacteria	2400
397	Ga0373947_0061861	3300035725	Bacteria	2276
398	Ga0373937_0018385	3300036401	Bacteria	6242
399	Ga0373937_0020668	3300036401	Bacteria	5904
400	Ga0373937_0031946	3300036401	Bacteria	4773
401	Ga0373937_0074022	3300036401	Bacteria	3142
402	Ga0373937_0123120	3300036401	Bacteria	2418
403	Ga0373937_0126448	3300036401	Unclassified	2385
404	Ga0373937_0336190	3300036401	Bacteria	1430
405	Ga0373925_0004163	3300037068	Bacteria	10972
406	Ga0395905_0008177	3300037471	Bacteria	10328
407	Ga0436365_0490060	3300039437	Bacteria	3347
408	Ga0439460_0005482	3300042461	Bacteria	3115
409	Ga0466972_0056913	3300044658	Bacteria	1879
410	Ga0466957_0015800	3300044842	Bacteria	4410
411	Ga0451576_0296805	3300045051	Unclassified	1690
412	Ga0495592_0130142	3300046454	Bacteria	1761
413	Ga0495638_0000697	3300046460	Bacteria	36411
414	Ga0495638_0002617	3300046460	Bacteria	14483
415	Ga0495582_0015711	3300046473	Unclassified	4154
416	Ga0495664_0043806	3300046477	Bacteria	2652
417	Ga0495608_0005695	3300046511	Bacteria	8895
418	Ga0495608_0013704	3300046511	Bacteria	5623
419	Ga0495610_0002855	3300046512	Bacteria	14049
420	Ga0495616_0001257	3300046513	Bacteria	17834
421	Ga0495628_0174707	3300046516	Bacteria	1628
422	Ga0495643_0087441	3300046522	Bacteria	1613
423	Ga0495648_0000066	3300046524	Bacteria	140767
424	Ga0495648_0069524	3300046524	Bacteria	2049
425	Ga0495652_0015399	3300046529	Bacteria	6849
426	Ga0495665_0071124	3300046531	Unclassified	1832
427	Ga0495586_0016787	3300046535	Bacteria	3896
428	Ga0495587_0000365	3300046536	Bacteria	32561
429	Ga0495587_0014132	3300046536	Bacteria	5013
430	Ga0495587_0016157	3300046536	Bacteria	4646
431	Ga0495645_0002852	3300046543	Bacteria	11726
432	Ga0495645_0042754	3300046543	Bacteria	3304
433	Ga0495667_0005017	3300046559	Bacteria	8945
434	Ga0495667_0016142	3300046559	Bacteria	5046
435	Ga0495668_0009939	3300046616	Bacteria	5800
436	Ga0495668_0072226	3300046616	Unclassified	1896
437	Ga0495625_0000157	3300046660	Bacteria	104679
438	Ga0495657_0013734	3300046675	Bacteria	5962
439	Ga0495599_0002674	3300046678	Bacteria	10406
440	Ga0495623_0020302	3300046679	Bacteria	4294
441	Ga0495669_0004160	3300046684	Bacteria	5949
442	Ga0495613_0001476	3300046689	Bacteria	17922
443	Ga0495613_0100870	3300046689	Bacteria	2085
444	Ga0495600_0016958	3300046809	Bacteria	4630
445	Ga0495660_0015405	3300046810	Bacteria	4417
446	Ga0495660_0054058	3300046810	Bacteria	2177
447	Ga0495581_0027365	3300047315	Unclassified	3307
448	Ga0495604_0013223	3300047317	Bacteria	6575
449	Ga0495674_0078462	3300047319	Bacteria	2837
450	Ga0495680_0189184	3300047322	Bacteria	1481
451	Ga0495675_0120542	3300047444	Bacteria	1634
452	Ga0495673_0000710	3300047469	Bacteria	32297
453	Ga0495684_0000024	3300047471	Bacteria	129369
454	Ga0495684_0184153	3300047471	Unclassified	1547
455	Ga0495602_0000797	3300048088	Bacteria	30094
456	Ga0496100_0001877	3300048903	Bacteria	10539
457	Ga0496101_0007846	3300048904	Bacteria	6942
458	Ga0496104_0036859	3300048907	Bacteria	4572
459	Ga0496104_0169207	3300048907	Unclassified	2096
460	Ga0496106_0059076	3300048909	Bacteria	2904
461	Ga0496107_0229088	3300048910	Bacteria	1382
462	Ga0496112_0001780	3300048915	Bacteria	16927
463	Ga0496114_0000363	3300048917	Bacteria	33231
464	Ga0496115_0122018	3300048918	Bacteria	2145
465	Ga0496126_0106783	3300048929	Unclassified	2443
466	Ga0501036_0014471	3300049572	Bacteria	6572
467	Ga0501036_0168413	3300049572	Unclassified	1846
468	Ga0501039_0024054	3300049575	Unclassified	4678
469	Ga0501040_0006002	3300049576	Bacteria	7863
470	Ga0501041_0035288	3300049577	Bacteria	3030
471	Ga0501042_0038233	3300049578	Bacteria	3408
472	Ga0501042_0055349	3300049578	Unclassified	2831
473	Ga0501042_0239020	3300049578	Unclassified	1310
474	Ga0501043_0060978	3300049579	Unclassified	2962
475	Ga0501048_0020357	3300049582	Bacteria	4862
476	Ga0501048_0034154	3300049582	Unclassified	3672
477	Ga0501071_0071086	3300049587	Unclassified	2536
478	Ga0501071_0079032	3300049587	Unclassified	2405
479	Ga0501072_0057332	3300049588	Bacteria	3069
480	Ga0501074_0088135	3300049590	Unclassified	2223
481	Ga0501075_0020707	3300049591	Bacteria	4786
482	Ga0501076_0009798	3300049592	Bacteria	7077
483	Ga0501076_0017316	3300049592	Bacteria	5475
484	Ga0501077_0094204	3300049593	Unclassified	1898
485	Ga0501079_0008062	3300049741	Bacteria	7979
486	Ga0501080_0011025	3300049742	Bacteria	8272
487	Ga0501081_0008839	3300049743	Bacteria	6548
488	Ga0501035_0047796	3300049822	Bacteria	3840
489	Ga0501045_0022302	3300049824	Bacteria	4532
490	nmdc:mga05p37_161765_c1	3300050507	Bacteria	2734
491	nmdc:mga05p37_472837_c1	3300050507	Unclassified	1446
492	nmdc:mga09592_2728_c2	3300050508	Bacteria	7349
493	nmdc:mga09592_79826_c1	3300050508	Unclassified	2786
494	nmdc:mga0qj67_11519_c1	3300050509	Bacteria	6627
495	nmdc:mga0qj67_75068_c1	3300050509	Bacteria	2702
496	nmdc:mga06r32_164058_c1	3300050510	Bacteria	2205
497	nmdc:mga06r32_3497_c1	3300050510	Bacteria	14018
498	nmdc:mga06r32_50691_c1	3300050510	Bacteria	3970
499	nmdc:mga06r32_87282_c1	3300050510	Bacteria	3044
500	nmdc:mga08y16_120884_c1	3300050511	Bacteria	2726
501	nmdc:mga08y16_214813_c1	3300050511	Bacteria	1992
502	nmdc:mga08y16_21699_c1	3300050511	Bacteria	6778
503	nmdc:mga08y16_253284_c1	3300050511	Bacteria	1819
504	nmdc:mga08y16_347671_c1	3300050511	Unclassified	1524
505	nmdc:mga08y16_5278_c1	3300050511	Bacteria	13507
506	nmdc:mga0n895_10495_c1	3300050512	Bacteria	8191
507	nmdc:mga0n895_37131_c1	3300050512	Bacteria	4711
508	nmdc:mga0n895_50941_c1	3300050512	Bacteria	4061
509	nmdc:mga0rr50_5831_c1	3300050513	Bacteria	7401
510	nmdc:mga0a205_1417_c3	3300050515	Bacteria	13609
511	nmdc:mga0a205_1673_c1	3300050515	Bacteria	19113
512	nmdc:mga0a205_17642_c1	3300050515	Bacteria	6700
513	Ga0495601_0000629	3300053077	Bacteria	18834
514	Ga0495619_0000474	3300053085	Bacteria	27047
515	Ga0495619_0054465	3300053085	Bacteria	2648
516	Ga0495619_0103775	3300053085	Bacteria	1937
517	Ga0500644_0000084	3300053088	Bacteria	57829
518	Ga0500564_000080	3300053138	Bacteria	24788
519	Ga0500622_0007138	3300053156	Bacteria	6375
520	Ga0500609_000164	3300053731	Bacteria	9224
521	Ga0501082_0002528	3300060353	Bacteria	16013
522	Ga0501082_0101410	3300060353	Unclassified	2490
523	Ga0530510_0039159	3300061734	Unclassified	3421

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300014969	Ga0157376_10046995	Ga0157376_100469953	321
2	3300025923	Ga0207681_10226981	Ga0207681_102269812	332
3	3300047322	Ga0495680_0189184	Ga0495680_0189184_34_1113	334
4	3300013102	Ga0157371_10024155	Ga0157371_100241553	338
5	3300013105	Ga0157369_10009109	Ga0157369_1000910912	343
6	3300036401	Ga0373937_0018385	Ga0373937_0018385_3669_4895	344
7	3300042461	Ga0439460_0005482	Ga0439460_0005482_645_1919	345
8	3300005331	Ga0070670_100015989	Ga0070670_1000159895	346
9	3300005564	Ga0070664_100012384	Ga0070664_1000123842	346
10	3300006852	Ga0075433_10006743	Ga0075433_100067434	346
11	3300006871	Ga0075434_100004517	Ga0075434_1000045175	346
12	3300025925	Ga0207650_10022941	Ga0207650_100229412	346
13	3300025945	Ga0207679_10014236	Ga0207679_100142365	346
14	3300028577	Ga0265318_10047557	Ga0265318_100475572	346
15	3300049578	Ga0501042_0239020	Ga0501042_0239020_89_1294	346
16	3300050512	nmdc:mga0n895_10495_c1	nmdc:mga0n895_10495_c1_444_1661	346
17	3300050515	nmdc:mga0a205_1417_c3	nmdc:mga0a205_1417_c3_5961_7178	346
18	3300005335	Ga0070666_10008680	Ga0070666_100086805	347
19	3300005367	Ga0070667_100125445	Ga0070667_1001254451	347
20	3300005459	Ga0068867_100066349	Ga0068867_1000663492	347
21	3300009098	Ga0105245_10021067	Ga0105245_100210674	347
22	3300009177	Ga0105248_10000285	Ga0105248_1000028529	347
23	3300009551	Ga0105238_10034675	Ga0105238_100346753	347
24	3300035724	Ga0373933_0009449	Ga0373933_0009449_368_1624	347
25	3300049742	Ga0501080_0011025	Ga0501080_0011025_4724_5989	347
26	3300005356	Ga0070674_100168581	Ga0070674_1001685812	348
27	3300025924	Ga0207694_10023173	Ga0207694_100231733	348
28	3300025927	Ga0207687_10000286	Ga0207687_1000028625	348
29	3300025941	Ga0207711_10001660	Ga0207711_100016603	348
30	3300046535	Ga0495586_0016787	Ga0495586_0016787_534_1790	348
31	3300005334	Ga0068869_100050374	Ga0068869_1000503742	349
32	3300005577	Ga0068857_100135437	Ga0068857_1001354372	349
33	3300025908	Ga0207643_10055005	Ga0207643_100550052	349
34	3300025942	Ga0207689_10041397	Ga0207689_100413972	349
35	3300025914	Ga0207671_10152740	Ga0207671_101527402	351
36	3300031595	Ga0265313_10001713	Ga0265313_100017135	352
37	3300009545	Ga0105237_10015196	Ga0105237_100151962	353
38	3300025914	Ga0207671_10089093	Ga0207671_100890932	353
39	3300025944	Ga0207661_10004643	Ga0207661_100046436	353
40	3300050511	nmdc:mga08y16_253284_c1	nmdc:mga08y16_253284_c1_416_1654	353
41	3300005334	Ga0068869_100037743	Ga0068869_1000377431	356
42	3300005344	Ga0070661_100121505	Ga0070661_1001215052	356
43	3300005365	Ga0070688_100103819	Ga0070688_1001038192	356
44	3300005548	Ga0070665_100264075	Ga0070665_1002640752	356
45	3300006237	Ga0097621_100166573	Ga0097621_1001665731	356
46	3300009148	Ga0105243_10282536	Ga0105243_102825362	357
47	3300013308	Ga0157375_10116326	Ga0157375_101163262	357
48	3300025315	Ga0207697_10000888	Ga0207697_1000088811	357
49	3300046616	Ga0495668_0072226	Ga0495668_0072226_480_1757	357
50	3300048929	Ga0496126_0106783	Ga0496126_0106783_810_1991	357
51	3300053156	Ga0500622_0007138	Ga0500622_0007138_4647_5924	357
52	3300049572	Ga0501036_0014471	Ga0501036_0014471_1729_2994	358
53	3300049575	Ga0501039_0024054	Ga0501039_0024054_1376_2641	358
54	3300049576	Ga0501040_0006002	Ga0501040_0006002_1088_2353	358
55	3300049579	Ga0501043_0060978	Ga0501043_0060978_898_2163	358
56	3300049582	Ga0501048_0034154	Ga0501048_0034154_108_1373	358
57	3300049587	Ga0501071_0071086	Ga0501071_0071086_461_1726	358
58	3300049588	Ga0501072_0057332	Ga0501072_0057332_778_2043	358
59	3300049591	Ga0501075_0020707	Ga0501075_0020707_415_1680	358
60	3300049592	Ga0501076_0009798	Ga0501076_0009798_3833_5098	358
61	3300049593	Ga0501077_0094204	Ga0501077_0094204_619_1884	358
62	3300049741	Ga0501079_0008062	Ga0501079_0008062_2777_4042	358
63	3300049743	Ga0501081_0008839	Ga0501081_0008839_2309_3574	358
64	3300049822	Ga0501035_0047796	Ga0501035_0047796_2037_3302	358
65	3300049824	Ga0501045_0022302	Ga0501045_0022302_145_1410	358
66	3300060353	Ga0501082_0002528	Ga0501082_0002528_11288_12553	358
67	3300061734	Ga0530510_0039159	Ga0530510_0039159_1509_2774	358
68	3300006358	Ga0068871_100195587	Ga0068871_1001955871	359
69	3300035172	Ga0373955_0093050	Ga0373955_0093050_94_1353	359
70	3300046477	Ga0495664_0043806	Ga0495664_0043806_228_1487	359
71	3300046810	Ga0495660_0054058	Ga0495660_0054058_36_1268	359
72	3300005563	Ga0068855_100155604	Ga0068855_1001556042	360
73	3300009093	Ga0105240_10161003	Ga0105240_101610032	360
74	3300013104	Ga0157370_10150744	Ga0157370_101507442	360
75	3300013105	Ga0157369_10105124	Ga0157369_101051242	360
76	3300013297	Ga0157378_10156796	Ga0157378_101567962	360
77	3300013307	Ga0157372_10183173	Ga0157372_101831732	360
78	3300014325	Ga0163163_10001927	Ga0163163_1000192711	360
79	3300025913	Ga0207695_10024484	Ga0207695_100244842	360
80	3300025949	Ga0207667_10005465	Ga0207667_100054658	360
81	3300026078	Ga0207702_10199248	Ga0207702_101992482	360
82	3300025926	Ga0207659_10008380	Ga0207659_100083802	361
83	3300036401	Ga0373937_0074022	Ga0373937_0074022_849_2051	362
84	3300046511	Ga0495608_0013704	Ga0495608_0013704_4079_5281	362
85	3300046559	Ga0495667_0016142	Ga0495667_0016142_3669_4871	362
86	3300046675	Ga0495657_0013734	Ga0495657_0013734_4484_5686	362
87	3300047444	Ga0495675_0120542	Ga0495675_0120542_360_1562	362
88	3300053085	Ga0495619_0103775	Ga0495619_0103775_562_1764	362
89	3300025927	Ga0207687_10017655	Ga0207687_100176554	363
90	3300009177	Ga0105248_10375570	Ga0105248_103755702	364
91	3300009551	Ga0105238_10121026	Ga0105238_101210262	364
92	3300044842	Ga0466957_0015800	Ga0466957_0015800_1276_2487	364
93	3300005336	Ga0070680_100024178	Ga0070680_1000241783	365
94	3300009545	Ga0105237_10004706	Ga0105237_1000470614	365
95	3300009553	Ga0105249_10166926	Ga0105249_101669262	365
96	3300025914	Ga0207671_10014198	Ga0207671_100141986	365
97	3300026041	Ga0207639_10054579	Ga0207639_100545792	365
98	3300039437	Ga0436365_0490060	Ga0436365_0490060_2114_3292	365
99	3300005436	Ga0070713_100225186	Ga0070713_1002251862	366
100	3300005841	Ga0068863_100156375	Ga0068863_1001563752	366
101	3300014325	Ga0163163_10272161	Ga0163163_102721611	366
102	3300025928	Ga0207700_10210707	Ga0207700_102107072	366
103	3300025961	Ga0207712_10099777	Ga0207712_100997772	366
104	3300026118	Ga0207675_100269563	Ga0207675_1002695632	366
105	3300009177	Ga0105248_10098148	Ga0105248_100981482	367
106	3300046522	Ga0495643_0087441	Ga0495643_0087441_10_1224	367
107	3300005329	Ga0070683_100009538	Ga0070683_1000095386	368
108	3300005535	Ga0070684_100010581	Ga0070684_1000105818	368
109	3300005539	Ga0068853_100057450	Ga0068853_1000574502	368
110	3300009094	Ga0111539_10063051	Ga0111539_100630511	368
111	3300010375	Ga0105239_10145595	Ga0105239_101455952	368
112	3300013105	Ga0157369_10032477	Ga0157369_100324775	368
113	3300026078	Ga0207702_10301807	Ga0207702_103018071	368
114	3300035111	Ga0373923_0100364	Ga0373923_0100364_14_1192	368
115	3300035172	Ga0373955_0097640	Ga0373955_0097640_23_1204	368
116	3300005333	Ga0070677_10076059	Ga0070677_100760591	369
117	3300005335	Ga0070666_10022039	Ga0070666_100220392	369
118	3300005353	Ga0070669_100215190	Ga0070669_1002151902	369
119	3300005364	Ga0070673_100025688	Ga0070673_1000256883	369
120	3300005365	Ga0070688_100118437	Ga0070688_1001184372	369
121	3300005438	Ga0070701_10024516	Ga0070701_100245162	369
122	3300005615	Ga0070702_100163765	Ga0070702_1001637652	369
123	3300005840	Ga0068870_10001929	Ga0068870_100019296	369
124	3300005843	Ga0068860_100043302	Ga0068860_1000433023	369
125	3300006847	Ga0075431_100035566	Ga0075431_1000355662	369
126	3300006852	Ga0075433_10017899	Ga0075433_100178994	369
127	3300007076	Ga0075435_100156176	Ga0075435_1001561762	369
128	3300025893	Ga0207682_10027362	Ga0207682_100273622	369
129	3300025907	Ga0207645_10012876	Ga0207645_100128762	369
130	3300025908	Ga0207643_10002278	Ga0207643_100022787	369
131	3300025918	Ga0207662_10045834	Ga0207662_100458343	369
132	3300025926	Ga0207659_10013852	Ga0207659_100138522	369
133	3300025940	Ga0207691_10018142	Ga0207691_100181426	369
134	3300025960	Ga0207651_10019137	Ga0207651_100191372	369
135	3300025960	Ga0207651_10062365	Ga0207651_100623652	369
136	3300026075	Ga0207708_10094151	Ga0207708_100941512	369
137	3300026116	Ga0207674_10261155	Ga0207674_102611551	369
138	3300027907	Ga0207428_10010109	Ga0207428_100101094	369
139	3300028379	Ga0268266_10274186	Ga0268266_102741861	369
140	3300046460	Ga0495638_0002617	Ga0495638_0002617_11097_12326	369
141	3300046512	Ga0495610_0002855	Ga0495610_0002855_3859_5091	369
142	3300046513	Ga0495616_0001257	Ga0495616_0001257_14137_15366	369
143	3300046524	Ga0495648_0069524	Ga0495648_0069524_510_1739	369
144	3300046543	Ga0495645_0002852	Ga0495645_0002852_3770_5011	369
145	3300050509	nmdc:mga0qj67_75068_c1	nmdc:mga0qj67_75068_c1_1032_2225	369
146	3300050510	nmdc:mga06r32_87282_c1	nmdc:mga06r32_87282_c1_1016_2209	369
147	3300050511	nmdc:mga08y16_214813_c1	nmdc:mga08y16_214813_c1_263_1501	369
148	3300050515	nmdc:mga0a205_1673_c1	nmdc:mga0a205_1673_c1_12779_14017	369
149	3300053731	Ga0500609_000164	Ga0500609_000164_7941_9170	369
150	3300009093	Ga0105240_10116667	Ga0105240_101166672	370
151	3300009101	Ga0105247_10005177	Ga0105247_100051777	370
152	3300009545	Ga0105237_10112814	Ga0105237_101128142	370
153	3300010375	Ga0105239_10072471	Ga0105239_100724715	370
154	3300013296	Ga0157374_10000228	Ga0157374_1000022831	370
155	3300013297	Ga0157378_10056239	Ga0157378_100562392	370
156	3300014745	Ga0157377_10141521	Ga0157377_101415211	370
157	3300014968	Ga0157379_10022588	Ga0157379_100225882	370
158	3300014969	Ga0157376_10023838	Ga0157376_100238383	370
159	3300046616	Ga0495668_0009939	Ga0495668_0009939_2502_3734	370
160	3300048907	Ga0496104_0169207	Ga0496104_0169207_280_1485	370
161	3300048915	Ga0496112_0001780	Ga0496112_0001780_1364_2569	370
162	iso_pu_bacteria	2751185897	2753766223	370
163	iso_pu_bacteria	2919709256	2919710348	370
164	3300005354	Ga0070675_100010724	Ga0070675_1000107243	371
165	3300005354	Ga0070675_100130067	Ga0070675_1001300673	371
166	3300009101	Ga0105247_10083594	Ga0105247_100835942	371
167	3300009147	Ga0114129_10050662	Ga0114129_100506624	371
168	3300009148	Ga0105243_10035468	Ga0105243_100354683	371
169	3300009176	Ga0105242_10021363	Ga0105242_100213631	371
170	3300009177	Ga0105248_10006094	Ga0105248_100060945	371
171	3300013306	Ga0163162_10008193	Ga0163162_100081935	371
172	3300013308	Ga0157375_10001831	Ga0157375_100018313	371
173	3300014325	Ga0163163_10016474	Ga0163163_100164747	371
174	3300014968	Ga0157379_10000853	Ga0157379_100008539	371
175	3300025933	Ga0207706_10019526	Ga0207706_100195262	371
176	3300032002	Ga0307416_100101981	Ga0307416_1001019812	371
177	3300032005	Ga0307411_10166114	Ga0307411_101661142	371
178	3300032126	Ga0307415_100019422	Ga0307415_1000194223	371
179	3300047471	Ga0495684_0184153	Ga0495684_0184153_13_1248	371
180	3300049587	Ga0501071_0079032	Ga0501071_0079032_409_1638	371
181	3300050511	nmdc:mga08y16_120884_c1	nmdc:mga08y16_120884_c1_970_2178	371
182	3300005330	Ga0070690_100000471	Ga0070690_1000004714	372
183	3300005335	Ga0070666_10022643	Ga0070666_100226433	372
184	3300005338	Ga0068868_100005204	Ga0068868_1000052042	372
185	3300005340	Ga0070689_100130843	Ga0070689_1001308432	372
186	3300005344	Ga0070661_100016060	Ga0070661_1000160604	372
187	3300005355	Ga0070671_100050593	Ga0070671_1000505933	372
188	3300005367	Ga0070667_100004308	Ga0070667_1000043083	372
189	3300005544	Ga0070686_100008251	Ga0070686_1000082512	372
190	3300005564	Ga0070664_100012376	Ga0070664_1000123762	372
191	3300005618	Ga0068864_100004651	Ga0068864_1000046515	372
192	3300005841	Ga0068863_100041143	Ga0068863_1000411434	372
193	3300005842	Ga0068858_100143576	Ga0068858_1001435762	372
194	3300009094	Ga0111539_10068626	Ga0111539_100686262	372
195	3300009101	Ga0105247_10133902	Ga0105247_101339022	372
196	3300013308	Ga0157375_10001860	Ga0157375_1000186014	372
197	3300014325	Ga0163163_10017306	Ga0163163_100173064	372
198	3300014968	Ga0157379_10069359	Ga0157379_100693592	372
199	3300025903	Ga0207680_10029739	Ga0207680_100297393	372
200	3300025920	Ga0207649_10009492	Ga0207649_100094924	372
201	3300025941	Ga0207711_10017715	Ga0207711_100177152	372
202	3300025945	Ga0207679_10006524	Ga0207679_100065243	372
203	3300026023	Ga0207677_10018246	Ga0207677_100182464	372
204	3300026035	Ga0207703_10029771	Ga0207703_100297712	372
205	3300026095	Ga0207676_10006045	Ga0207676_100060454	372
206	3300047469	Ga0495673_0000710	Ga0495673_0000710_19530_20762	372
207	3300050511	nmdc:mga08y16_21699_c1	nmdc:mga08y16_21699_c1_1882_3120	372
208	3300053088	Ga0500644_0000084	Ga0500644_0000084_44873_46105	372
209	3300005331	Ga0070670_100074991	Ga0070670_1000749912	373
210	3300005341	Ga0070691_10035364	Ga0070691_100353643	373
211	3300005364	Ga0070673_100012899	Ga0070673_1000128993	373
212	3300005367	Ga0070667_100005961	Ga0070667_1000059615	373
213	3300005445	Ga0070708_100063418	Ga0070708_1000634181	373
214	3300005456	Ga0070678_100174754	Ga0070678_1001747542	373
215	3300005458	Ga0070681_10000717	Ga0070681_1000071717	373
216	3300005530	Ga0070679_100009336	Ga0070679_1000093364	373
217	3300005539	Ga0068853_100009391	Ga0068853_1000093912	373
218	3300005543	Ga0070672_100003460	Ga0070672_1000034603	373
219	3300005547	Ga0070693_100076326	Ga0070693_1000763262	373
220	3300005578	Ga0068854_100034770	Ga0068854_1000347702	373
221	3300005614	Ga0068856_100002183	Ga0068856_10000218321	373
222	3300005616	Ga0068852_100081677	Ga0068852_1000816772	373
223	3300005617	Ga0068859_100025410	Ga0068859_1000254103	373
224	3300005841	Ga0068863_100001928	Ga0068863_1000019289	373
225	3300005842	Ga0068858_100028455	Ga0068858_1000284553	373
226	3300006237	Ga0097621_100000409	Ga0097621_1000004096	373
227	3300006237	Ga0097621_100024846	Ga0097621_1000248463	373
228	3300006358	Ga0068871_100000126	Ga0068871_10000012620	373
229	3300006931	Ga0097620_100025410	Ga0097620_1000254103	373
230	3300014326	Ga0157380_10222697	Ga0157380_102226972	373
231	3300025912	Ga0207707_10003757	Ga0207707_100037573	373
232	3300025917	Ga0207660_10005523	Ga0207660_100055236	373
233	3300025921	Ga0207652_10014983	Ga0207652_100149834	373
234	3300025924	Ga0207694_10065126	Ga0207694_100651263	373
235	3300025925	Ga0207650_10047513	Ga0207650_100475132	373
236	3300025926	Ga0207659_10008362	Ga0207659_100083623	373
237	3300025931	Ga0207644_10009694	Ga0207644_100096942	373
238	3300025940	Ga0207691_10019180	Ga0207691_100191803	373
239	3300025941	Ga0207711_10004544	Ga0207711_100045443	373
240	3300025944	Ga0207661_10020952	Ga0207661_100209522	373
241	3300025949	Ga0207667_10055269	Ga0207667_100552695	373
242	3300025960	Ga0207651_10033805	Ga0207651_100338052	373
243	3300025981	Ga0207640_10057130	Ga0207640_100571302	373
244	3300025986	Ga0207658_10004878	Ga0207658_100048783	373
245	3300026035	Ga0207703_10020269	Ga0207703_100202693	373
246	3300026078	Ga0207702_10001671	Ga0207702_1000167123	373
247	3300026088	Ga0207641_10006343	Ga0207641_100063435	373
248	3300050511	nmdc:mga08y16_347671_c1	nmdc:mga08y16_347671_c1_69_1328	373
249	3300005290	Ga0065712_10085572	Ga0065712_100855722	374
250	3300005329	Ga0070683_100285513	Ga0070683_1002855132	374
251	3300005436	Ga0070713_100008331	Ga0070713_1000083312	374
252	3300005436	Ga0070713_100024067	Ga0070713_1000240672	374
253	3300005459	Ga0068867_100128846	Ga0068867_1001288462	374
254	3300005535	Ga0070684_100018837	Ga0070684_1000188374	374
255	3300005563	Ga0068855_100003383	Ga0068855_10000338315	374
256	3300005563	Ga0068855_100092629	Ga0068855_1000926292	374
257	3300005564	Ga0070664_100025241	Ga0070664_1000252413	374
258	3300005614	Ga0068856_100002236	Ga0068856_10000223615	374
259	3300005617	Ga0068859_100099066	Ga0068859_1000990663	374
260	3300005841	Ga0068863_100310243	Ga0068863_1003102431	374
261	3300005843	Ga0068860_100131395	Ga0068860_1001313952	374
262	3300006028	Ga0070717_10019572	Ga0070717_100195722	374
263	3300006028	Ga0070717_10082973	Ga0070717_100829732	374
264	3300006163	Ga0070715_10009732	Ga0070715_100097323	374
265	3300006237	Ga0097621_100000993	Ga0097621_1000009933	374
266	3300006358	Ga0068871_100001020	Ga0068871_10000102014	374
267	3300006847	Ga0075431_100115033	Ga0075431_1001150332	374
268	3300006931	Ga0097620_100099067	Ga0097620_1000990671	374
269	3300009093	Ga0105240_10142457	Ga0105240_101424572	374
270	3300009177	Ga0105248_10039773	Ga0105248_100397733	374
271	3300010375	Ga0105239_10168239	Ga0105239_101682392	374
272	3300013296	Ga0157374_10001472	Ga0157374_100014723	374
273	3300013297	Ga0157378_10001696	Ga0157378_100016963	374
274	3300013307	Ga0157372_10002808	Ga0157372_100028082	374
275	3300013307	Ga0157372_10252457	Ga0157372_102524571	374
276	3300014745	Ga0157377_10052557	Ga0157377_100525572	374
277	3300014969	Ga0157376_10012170	Ga0157376_100121703	374
278	3300014969	Ga0157376_10068665	Ga0157376_100686652	374
279	3300014969	Ga0157376_10111159	Ga0157376_101111591	374
280	3300025900	Ga0207710_10010789	Ga0207710_100107892	374
281	3300025906	Ga0207699_10070317	Ga0207699_100703172	374
282	3300025913	Ga0207695_10036973	Ga0207695_100369732	374
283	3300025914	Ga0207671_10183864	Ga0207671_101838642	374
284	3300025928	Ga0207700_10004068	Ga0207700_100040684	374
285	3300025928	Ga0207700_10040810	Ga0207700_100408102	374
286	3300025929	Ga0207664_10001404	Ga0207664_100014043	374
287	3300025949	Ga0207667_10026240	Ga0207667_100262404	374
288	3300026035	Ga0207703_10029955	Ga0207703_100299552	374
289	3300026078	Ga0207702_10017279	Ga0207702_100172793	374
290	3300026088	Ga0207641_10070719	Ga0207641_100707191	374
291	3300027907	Ga0207428_10002364	Ga0207428_100023645	374
292	3300028381	Ga0268264_10066263	Ga0268264_100662632	374
293	3300046684	Ga0495669_0004160	Ga0495669_0004160_3434_4732	374
294	3300048918	Ga0496115_0122018	Ga0496115_0122018_374_1609	374
295	3300050510	nmdc:mga06r32_50691_c1	nmdc:mga06r32_50691_c1_1610_2848	374
296	3300050511	nmdc:mga08y16_5278_c1	nmdc:mga08y16_5278_c1_10590_11828	374
297	3300005295	Ga0065707_10123615	Ga0065707_101236152	375
298	3300005330	Ga0070690_100019755	Ga0070690_1000197553	375
299	3300005338	Ga0068868_100048154	Ga0068868_1000481542	375
300	3300005340	Ga0070689_100015852	Ga0070689_1000158521	375
301	3300005340	Ga0070689_100046391	Ga0070689_1000463913	375
302	3300005353	Ga0070669_100005783	Ga0070669_1000057839	375
303	3300005354	Ga0070675_100036634	Ga0070675_1000366343	375
304	3300005354	Ga0070675_100037431	Ga0070675_1000374312	375
305	3300005356	Ga0070674_100275358	Ga0070674_1002753581	375
306	3300005364	Ga0070673_100175465	Ga0070673_1001754652	375
307	3300005366	Ga0070659_100077694	Ga0070659_1000776942	375
308	3300005438	Ga0070701_10052660	Ga0070701_100526602	375
309	3300005439	Ga0070711_100192606	Ga0070711_1001926061	375
310	3300005441	Ga0070700_100138354	Ga0070700_1001383542	375
311	3300005455	Ga0070663_100040140	Ga0070663_1000401404	375
312	3300005457	Ga0070662_100049179	Ga0070662_1000491793	375
313	3300005458	Ga0070681_10128123	Ga0070681_101281232	375
314	3300005459	Ga0068867_100050134	Ga0068867_1000501343	375
315	3300005459	Ga0068867_100096429	Ga0068867_1000964292	375
316	3300005518	Ga0070699_100100242	Ga0070699_1001002422	375
317	3300005543	Ga0070672_100024625	Ga0070672_1000246253	375
318	3300005543	Ga0070672_100214677	Ga0070672_1002146772	375
319	3300005543	Ga0070672_100276950	Ga0070672_1002769501	375
320	3300005544	Ga0070686_100061150	Ga0070686_1000611502	375
321	3300005544	Ga0070686_100061954	Ga0070686_1000619543	375
322	3300005548	Ga0070665_100028208	Ga0070665_1000282085	375
323	3300005617	Ga0068859_100033881	Ga0068859_1000338814	375
324	3300005718	Ga0068866_10020880	Ga0068866_100208801	375
325	3300005841	Ga0068863_100134376	Ga0068863_1001343762	375
326	3300005842	Ga0068858_100034959	Ga0068858_1000349592	375
327	3300005842	Ga0068858_100067137	Ga0068858_1000671373	375
328	3300006237	Ga0097621_100002957	Ga0097621_1000029572	375
329	3300006237	Ga0097621_100015161	Ga0097621_1000151614	375
330	3300006237	Ga0097621_100157292	Ga0097621_1001572921	375
331	3300006237	Ga0097621_100242479	Ga0097621_1002424792	375
332	3300006358	Ga0068871_100002455	Ga0068871_1000024555	375
333	3300006358	Ga0068871_100002702	Ga0068871_1000027023	375
334	3300006358	Ga0068871_100006820	Ga0068871_1000068202	375
335	3300006358	Ga0068871_100010197	Ga0068871_1000101973	375
336	3300006358	Ga0068871_100043931	Ga0068871_1000439312	375
337	3300006358	Ga0068871_100099891	Ga0068871_1000998912	375
338	3300006844	Ga0075428_100011465	Ga0075428_1000114654	375
339	3300006846	Ga0075430_100009276	Ga0075430_1000092767	375
340	3300006847	Ga0075431_100004514	Ga0075431_1000045148	375
341	3300006881	Ga0068865_100002823	Ga0068865_1000028233	375
342	3300006881	Ga0068865_100130132	Ga0068865_1001301322	375
343	3300006931	Ga0097620_100033881	Ga0097620_1000338814	375
344	3300009094	Ga0111539_10016039	Ga0111539_100160396	375
345	3300009098	Ga0105245_10004051	Ga0105245_100040515	375
346	3300009098	Ga0105245_10196425	Ga0105245_101964252	375
347	3300009147	Ga0114129_10532356	Ga0114129_105323562	375
348	3300009176	Ga0105242_10001177	Ga0105242_100011775	375
349	3300009176	Ga0105242_10007559	Ga0105242_100075594	375
350	3300009177	Ga0105248_10008745	Ga0105248_100087455	375
351	3300009177	Ga0105248_10023981	Ga0105248_100239815	375
352	3300009177	Ga0105248_10440702	Ga0105248_104407022	375
353	3300009553	Ga0105249_10010743	Ga0105249_100107431	375
354	3300013306	Ga0163162_10132581	Ga0163162_101325812	375
355	3300013308	Ga0157375_10380352	Ga0157375_103803522	375
356	3300014326	Ga0157380_10017474	Ga0157380_100174742	375
357	3300014326	Ga0157380_10182697	Ga0157380_101826972	375
358	3300014969	Ga0157376_10002393	Ga0157376_100023935	375
359	3300017792	Ga0163161_10139568	Ga0163161_101395682	375
360	3300025299	Ga0209256_1022885	Ga0209256_10228852	375
361	3300025899	Ga0207642_10075106	Ga0207642_100751062	375
362	3300025901	Ga0207688_10060702	Ga0207688_100607022	375
363	3300025908	Ga0207643_10012383	Ga0207643_100123833	375
364	3300025908	Ga0207643_10026135	Ga0207643_100261353	375
365	3300025915	Ga0207693_10021970	Ga0207693_100219702	375
366	3300025923	Ga0207681_10020060	Ga0207681_100200603	375
367	3300025923	Ga0207681_10059648	Ga0207681_100596483	375
368	3300025923	Ga0207681_10128476	Ga0207681_101284762	375
369	3300025925	Ga0207650_10027879	Ga0207650_100278793	375
370	3300025926	Ga0207659_10117033	Ga0207659_101170332	375
371	3300025927	Ga0207687_10105630	Ga0207687_101056302	375
372	3300025928	Ga0207700_10182192	Ga0207700_101821921	375
373	3300025931	Ga0207644_10013320	Ga0207644_100133203	375
374	3300025934	Ga0207686_10007996	Ga0207686_100079962	375
375	3300025934	Ga0207686_10054400	Ga0207686_100544002	375
376	3300025935	Ga0207709_10181725	Ga0207709_101817251	375
377	3300025936	Ga0207670_10101591	Ga0207670_101015912	375
378	3300025937	Ga0207669_10015172	Ga0207669_100151723	375
379	3300025938	Ga0207704_10001856	Ga0207704_100018565	375
380	3300025940	Ga0207691_10018563	Ga0207691_100185633	375
381	3300025940	Ga0207691_10036509	Ga0207691_100365092	375
382	3300025940	Ga0207691_10111111	Ga0207691_101111112	375
383	3300025941	Ga0207711_10104368	Ga0207711_101043682	375
384	3300025941	Ga0207711_10131107	Ga0207711_101311072	375
385	3300025942	Ga0207689_10084484	Ga0207689_100844842	375
386	3300025945	Ga0207679_10070118	Ga0207679_100701182	375
387	3300025960	Ga0207651_10092388	Ga0207651_100923882	375
388	3300026023	Ga0207677_10043187	Ga0207677_100431873	375
389	3300026067	Ga0207678_10081600	Ga0207678_100816002	375
390	3300026075	Ga0207708_10069035	Ga0207708_100690352	375
391	3300026088	Ga0207641_10108064	Ga0207641_101080642	375
392	3300026089	Ga0207648_10028452	Ga0207648_100284523	375
393	3300026118	Ga0207675_100169618	Ga0207675_1001696182	375
394	3300026121	Ga0207683_10172170	Ga0207683_101721702	375
395	3300027907	Ga0207428_10007520	Ga0207428_100075206	375
396	3300028379	Ga0268266_10038622	Ga0268266_100386222	375
397	3300028380	Ga0268265_10310211	Ga0268265_103102112	375
398	3300028800	Ga0265338_10009580	Ga0265338_100095804	375
399	3300031242	Ga0265329_10048411	Ga0265329_100484111	375
400	3300031249	Ga0265339_10005132	Ga0265339_100051324	375
401	3300032002	Ga0307416_100297618	Ga0307416_1002976181	375
402	3300035113	Ga0373936_0045705	Ga0373936_0045705_418_1680	375
403	3300035116	Ga0373945_0005507	Ga0373945_0005507_2712_3938	375
404	3300035119	Ga0373956_0087896	Ga0373956_0087896_67_1305	375
405	3300035170	Ga0373943_0041276	Ga0373943_0041276_890_2116	375
406	3300035171	Ga0373946_0008342	Ga0373946_0008342_2265_3491	375
407	3300035410	Ga0373924_0001265	Ga0373924_0001265_2773_3999	375
408	3300035692	Ga0373935_0029154	Ga0373935_0029154_1325_2551	375
409	3300035692	Ga0373935_0054559	Ga0373935_0054559_33_1295	375
410	3300035692	Ga0373935_0175884	Ga0373935_0175884_113_1336	375
411	3300035724	Ga0373933_0054362	Ga0373933_0054362_586_1809	375
412	3300035725	Ga0373947_0061861	Ga0373947_0061861_934_2160	375
413	3300036401	Ga0373937_0020668	Ga0373937_0020668_2866_4128	375
414	3300036401	Ga0373937_0031946	Ga0373937_0031946_2063_3289	375
415	3300036401	Ga0373937_0126448	Ga0373937_0126448_147_1433	375
416	3300036401	Ga0373937_0336190	Ga0373937_0336190_148_1371	375
417	3300037068	Ga0373925_0004163	Ga0373925_0004163_1155_2381	375
418	3300046473	Ga0495582_0015711	Ga0495582_0015711_1562_2824	375
419	3300046531	Ga0495665_0071124	Ga0495665_0071124_133_1395	375
420	3300046689	Ga0495613_0100870	Ga0495613_0100870_110_1348	375
421	3300047315	Ga0495581_0027365	Ga0495581_0027365_2032_3294	375
422	3300048903	Ga0496100_0001877	Ga0496100_0001877_4387_5607	375
423	3300048904	Ga0496101_0007846	Ga0496101_0007846_3711_4931	375
424	3300048907	Ga0496104_0036859	Ga0496104_0036859_1238_2458	375
425	3300048909	Ga0496106_0059076	Ga0496106_0059076_717_1937	375
426	3300048910	Ga0496107_0229088	Ga0496107_0229088_55_1275	375
427	3300048917	Ga0496114_0000363	Ga0496114_0000363_22102_23322	375
428	3300049572	Ga0501036_0168413	Ga0501036_0168413_212_1450	375
429	3300049577	Ga0501041_0035288	Ga0501041_0035288_443_1702	375
430	3300049578	Ga0501042_0038233	Ga0501042_0038233_1267_2526	375
431	3300049578	Ga0501042_0055349	Ga0501042_0055349_1184_2410	375
432	3300049582	Ga0501048_0020357	Ga0501048_0020357_3167_4426	375
433	3300049590	Ga0501074_0088135	Ga0501074_0088135_582_1841	375
434	3300049592	Ga0501076_0017316	Ga0501076_0017316_2285_3544	375
435	3300050507	nmdc:mga05p37_161765_c1	nmdc:mga05p37_161765_c1_1102_2343	375
436	3300050507	nmdc:mga05p37_472837_c1	nmdc:mga05p37_472837_c1_100_1416	375
437	3300050508	nmdc:mga09592_2728_c2	nmdc:mga09592_2728_c2_37_1275	375
438	3300050509	nmdc:mga0qj67_11519_c1	nmdc:mga0qj67_11519_c1_10_1248	375
439	3300050510	nmdc:mga06r32_164058_c1	nmdc:mga06r32_164058_c1_523_1758	375
440	3300050510	nmdc:mga06r32_3497_c1	nmdc:mga06r32_3497_c1_3313_4551	375
441	3300053085	Ga0495619_0054465	Ga0495619_0054465_1166_2404	375
442	3300060353	Ga0501082_0101410	Ga0501082_0101410_825_2084	375
443	3300005355	Ga0070671_100030341	Ga0070671_1000303413	376
444	3300005364	Ga0070673_100237629	Ga0070673_1002376292	376
445	3300005365	Ga0070688_100165579	Ga0070688_1001655791	376
446	3300005842	Ga0068858_100007179	Ga0068858_1000071799	376
447	3300006844	Ga0075428_100008696	Ga0075428_1000086967	376
448	3300006844	Ga0075428_100037614	Ga0075428_1000376147	376
449	3300009094	Ga0111539_10157453	Ga0111539_101574533	376
450	3300009177	Ga0105248_10108121	Ga0105248_101081214	376
451	3300025923	Ga0207681_10057903	Ga0207681_100579032	376
452	3300025926	Ga0207659_10023319	Ga0207659_100233192	376
453	3300025940	Ga0207691_10082382	Ga0207691_100823822	376
454	3300025960	Ga0207651_10120812	Ga0207651_101208122	376
455	3300026095	Ga0207676_10221972	Ga0207676_102219722	376
456	3300046511	Ga0495608_0005695	Ga0495608_0005695_6275_7510	376
457	3300046516	Ga0495628_0174707	Ga0495628_0174707_63_1298	376
458	3300046536	Ga0495587_0014132	Ga0495587_0014132_127_1362	376
459	3300046559	Ga0495667_0005017	Ga0495667_0005017_6872_8107	376
460	3300046689	Ga0495613_0001476	Ga0495613_0001476_3975_5210	376
461	3300046809	Ga0495600_0016958	Ga0495600_0016958_2112_3347	376
462	3300047317	Ga0495604_0013223	Ga0495604_0013223_1797_3032	376
463	3300047319	Ga0495674_0078462	Ga0495674_0078462_1351_2586	376
464	3300047471	Ga0495684_0000024	Ga0495684_0000024_36477_37712	376
465	3300053077	Ga0495601_0000629	Ga0495601_0000629_7918_9153	376
466	3300053085	Ga0495619_0000474	Ga0495619_0000474_17403_18638	376
467	iso_pu_bacteria	2643221552	2643779158	376
468	iso_pu_bacteria	2643221583	2643923803	376
469	iso_pu_bacteria	2643221584	2643927558	376
470	3300005329	Ga0070683_100018579	Ga0070683_1000185792	377
471	3300005340	Ga0070689_100037127	Ga0070689_1000371272	377
472	3300005341	Ga0070691_10000546	Ga0070691_100005465	377
473	3300005530	Ga0070679_100009314	Ga0070679_1000093145	377
474	3300005577	Ga0068857_100003164	Ga0068857_10000316410	377
475	3300005614	Ga0068856_100027729	Ga0068856_1000277292	377
476	3300005985	Ga0081539_10000016	Ga0081539_10000016283	377
477	3300006237	Ga0097621_100168946	Ga0097621_1001689462	377
478	3300006852	Ga0075433_10042253	Ga0075433_100422533	377
479	3300006871	Ga0075434_100028928	Ga0075434_1000289283	377
480	3300006880	Ga0075429_100005948	Ga0075429_1000059484	377
481	3300007076	Ga0075435_100015878	Ga0075435_1000158783	377
482	3300009147	Ga0114129_10125003	Ga0114129_101250032	377
483	3300009174	Ga0105241_10043773	Ga0105241_100437732	377
484	3300009177	Ga0105248_10151672	Ga0105248_101516721	377
485	3300010375	Ga0105239_10285291	Ga0105239_102852912	377
486	3300013102	Ga0157371_10134994	Ga0157371_101349942	377
487	3300013307	Ga0157372_10029585	Ga0157372_100295855	377
488	3300025911	Ga0207654_10008746	Ga0207654_100087463	377
489	3300025921	Ga0207652_10005591	Ga0207652_100055915	377
490	3300025936	Ga0207670_10084828	Ga0207670_100848282	377
491	3300025949	Ga0207667_10002804	Ga0207667_100028042	377
492	3300026078	Ga0207702_10011147	Ga0207702_100111472	377
493	3300026116	Ga0207674_10001222	Ga0207674_1000122229	377
494	3300031711	Ga0265314_10001605	Ga0265314_100016056	377
495	3300031711	Ga0265314_10119522	Ga0265314_101195222	377
496	3300031995	Ga0307409_100322337	Ga0307409_1003223371	377
497	3300036401	Ga0373937_0123120	Ga0373937_0123120_637_1878	377
498	3300044658	Ga0466972_0056913	Ga0466972_0056913_511_1761	377
499	3300045051	Ga0451576_0296805	Ga0451576_0296805_242_1474	377
500	3300046454	Ga0495592_0130142	Ga0495592_0130142_31_1287	377
501	3300046529	Ga0495652_0015399	Ga0495652_0015399_2359_3615	377
502	3300046536	Ga0495587_0000365	Ga0495587_0000365_15281_16537	377
503	3300046536	Ga0495587_0016157	Ga0495587_0016157_2066_3322	377
504	3300046543	Ga0495645_0042754	Ga0495645_0042754_1211_2467	377
505	3300046678	Ga0495599_0002674	Ga0495599_0002674_3944_5200	377
506	3300046679	Ga0495623_0020302	Ga0495623_0020302_2871_4127	377
507	3300048088	Ga0495602_0000797	Ga0495602_0000797_26656_27912	377
508	3300050508	nmdc:mga09592_79826_c1	nmdc:mga09592_79826_c1_220_1455	377
509	3300050512	nmdc:mga0n895_37131_c1	nmdc:mga0n895_37131_c1_2904_4142	377
510	3300050512	nmdc:mga0n895_50941_c1	nmdc:mga0n895_50941_c1_1067_2302	377
511	3300050513	nmdc:mga0rr50_5831_c1	nmdc:mga0rr50_5831_c1_2361_3599	377
512	3300050515	nmdc:mga0a205_17642_c1	nmdc:mga0a205_17642_c1_20_1258	377
513	3300028794	Ga0307515_10029636	Ga0307515_100296365	378
514	3300028794	Ga0307515_10248791	Ga0307515_102487911	378
515	3300046524	Ga0495648_0000066	Ga0495648_0000066_79893_81125	378
516	3300046660	Ga0495625_0000157	Ga0495625_0000157_89987_91219	378
517	3300053138	Ga0500564_000080	Ga0500564_000080_11728_12960	378
518	iso_pu_bacteria	2582581279	2585148021	378
519	3300046460	Ga0495638_0000697	Ga0495638_0000697_3027_4265	379
520	3300037471	Ga0395905_0008177	Ga0395905_0008177_6382_7596	380
521	iso_pu_bacteria	2818991435	2819535750	380
522	iso_pu_bacteria	2818991454	2819645064	380
523	3300003323	rootH1_10000304	rootH1_1000030426	383
524	3300003316	rootH1_10125896	rootH1_101258961	384
525	3300003771	Ga0055526_1030704	Ga0055526_10307042	384
526	3300003794	Ga0055531_10001113	Ga0055531_100011136	384
527	3300005262	Ga0065165_1002205	Ga0065165_100220511	384
528	3300025295	Ga0209564_1000518	Ga0209564_100051812	384
529	3300025297	Ga0209758_1002558	Ga0209758_10025583	384
530	3300025304	Ga0209257_1000074	Ga0209257_1000074243	384
531	3300046810	Ga0495660_0015405	Ga0495660_0015405_74_1282	384

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

44

380

0.88 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3o7q-assembly1.cif.gz_A	crystal structure of a major facilitator superfamily (mfs) transporter, fucp, in the outward conformation	0.8259	13	369
6zgr-assembly2.cif.gz_B	crystal structure of a mfs transporter with bound 1-hydroxynaphthalene-2-carboxylic acid at 2.67 angstroem resolution	0.8189	13	371
3wdo-assembly1.cif.gz_A	structure of e. coli yajr transporter	0.8054	12	368
6zgr-assembly2.cif.gz_B	crystal structure of a mfs transporter with bound 1-hydroxynaphthalene-2-carboxylic acid at 2.67 angstroem resolution	0.8024	13	371
6e9o-assembly1.cif.gz_B	e. coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form	0.7996	13	370

ID	Description	Score	Start	End	Superfamily
af_A0A1D6LG74_1_148_1.20.1250.20	Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains	0.9206	49	183	1.20.1250.20
af_Q8R090_126_283_1.20.1250.20	Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains	0.8969	43	185	1.20.1250.20
af_Q8TF71_333_507_1.20.1250.20	Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains	0.895	48	179	1.20.1250.20
af_P17583_194_375_1.20.1250.20	Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains	0.8915	193	368	1.20.1250.20
af_G5ECR3_30_224_1.20.1250.20	Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains	0.8679	13	192	1.20.1250.20

ID	Description	Score	Start	End	GO Terms
AF-J0IX32-F1-model_v4	Putative glucose/galactose transporter	0.8981	28	371	GO:0005354 GO:0005886 GO:0055056 GO:1904659
AF-A0A5C7WIJ9-F1-model_v4	Sugar MFS transporter	0.8892	13	372	GO:0005354 GO:0005886 GO:0055056 GO:1904659
AF-A0A1I2QT11-F1-model_v4	Predicted arabinose efflux permease, MFS family	0.8737	14	372	GO:0005886 GO:0022857
AF-A0A1G6B8V3-F1-model_v4	Fucose permease	0.8638	13	367	GO:0016020 GO:0022857
AF-I9YG61-F1-model_v4	deleted	0.8622	12	371

Feature Viewer

pLDDT	pTM	Quality
83.65	0.81	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F460197

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF07690

MFS_1

Major Facilitator Superfamily

44

380

0.88

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map