F460003

General Info

Members Datasets Scaffolds Average Seq Length
530 274 1058 358

Family's Representative Sequence

Representative Sequence 3300046520|Ga0495637_0000034|Ga0495637_0000034_123835_125052
Length 405
Sequence MVALCPEPYHEMTILENSYPCPTFRNGSSLERTNSARWHKFALPRPFARLASAFLIAVAALAPVSQALAAERAKAPPLVIAEQGSFAAGGKVATAPGTFDPRKPMDPAGQTFHGDHAYAFYQIPVNARKLPIIMWHGAGQFSKTWETTADGREGFQNIFLRRGFGVYLIDQPRRGNAGRSMVEATVKPTPDEQLWFNQFRIGLWPNYFPGVQVAQDAQTRDQFFRAMTPNTGAFDMDVLSDGVSAVFDKVGPGILFTHSQGGGPGWLTAIKNDKVKAIVAFEPGSSFIFPEGEVPAPIPSAFDTVQGAAVSPARFEALTKLPILVLYGDNIPDHAIDLPAQDSWRARLEMARRWRDVVNKHGGDVTLVHLPEIGIKGNTHFIMSDLNNVQIADLVSKFLAEKKLD

Samples

Sample ID Description Type Environment
1 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
38 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
48 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
49 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
50 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
51 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
72 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
77 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
105 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
106 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
110 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
114 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
115 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
116 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
117 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
118 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
119 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
120 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
121 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
122 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
123 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
124 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
125 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
126 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
127 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
128 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
129 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
130 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
131 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
132 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
133 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
134 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
135 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
136 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
137 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
138 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
139 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
140 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
141 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
142 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
143 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
144 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
145 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
146 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
147 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
148 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
149 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
150 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
151 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
152 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
153 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
154 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
155 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
156 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
157 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
158 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
159 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
160 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
161 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
162 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
163 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
164 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
165 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
166 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
167 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
168 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
169 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
170 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
171 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
172 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
173 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
174 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
175 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
176 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
177 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
178 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
179 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
180 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
181 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
182 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
183 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
184 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
185 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
186 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
194 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
195 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
196 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
197 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
198 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
199 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
200 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
201 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
202 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
203 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
204 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
205 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
206 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
207 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
208 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
209 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
210 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
211 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
212 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
213 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
214 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
215 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
216 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
217 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
218 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
219 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
220 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
221 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
222 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
223 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
224 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
225 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
226 2511231004 Pseudomonas sp. GM102 Isolate Nodule
227 2511231006 Pseudomonas sp. GM17 Isolate Nodule
228 2511231007 Pseudomonas sp. GM18 Isolate Nodule
229 2511231008 Pseudomonas sp. GM21 Isolate Nodule
230 2511231012 Pseudomonas sp. GM33 Isolate Nodule
231 2511231014 Pseudomonas sp. GM48 Isolate Nodule
232 2511231015 Pseudomonas sp. GM49 Isolate Nodule
233 2511231018 Pseudomonas sp. GM60 Isolate Nodule
234 2511231019 Pseudomonas sp. GM67 Isolate Nodule
235 2511231020 Pseudomonas sp. GM74 Isolate Nodule
236 2511231021 Pseudomonas sp. GM78 Isolate Nodule
237 2511231022 Pseudomonas sp. GM79 Isolate Nodule
238 2511231023 Pseudomonas sp. GM80 Isolate Nodule
239 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
240 2511231031 Pseudomonas sp. GM16 Isolate Nodule
241 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
242 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
243 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
244 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
245 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
246 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
247 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
248 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
249 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
250 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
251 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
252 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
253 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
254 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
255 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
256 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
257 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
258 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
259 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
260 2636415599 Klebsiella variicola DX120E Isolate Unclassified
261 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
262 2643221733 Bosea sp. Root381 Isolate Unclassified
263 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
264 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
265 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
266 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
267 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
268 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
269 2857564685 Duganella sp. R-74599 Isolate Unclassified
270 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
271 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
272 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
273 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
274 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.38
Metatranscriptomes 0
Isolates 9.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.15
Nodule 3.96
Rhizoplane 4.15
Rhizosphere 80.75
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495637_0000034 3300046520 Bacteria 127356
2 MRS2a_Contig_18 2124908027 Bacteria 64424
3 JGI25157J39369_1002985 3300002741 Bacteria 3715
4 Ga0055533_1009165 3300003756 Bacteria 1197
5 Ga0065714_10010907 3300005288 Bacteria 3269
6 Ga0065714_10067179 3300005288 Bacteria 5805
7 Ga0065704_10135473 3300005289 Bacteria 1576
8 Ga0065712_10006342 3300005290 Bacteria 7413
9 Ga0070660_100294577 3300005339 Bacteria 1329
10 Ga0070689_100147243 3300005340 Unclassified 1897
11 Ga0070661_100145299 3300005344 Bacteria 1790
12 Ga0070675_100060032 3300005354 Bacteria 3139
13 Ga0070674_100005432 3300005356 Bacteria 7361
14 Ga0070673_100012935 3300005364 Bacteria 5750
15 Ga0070659_100003362 3300005366 Bacteria 11383
16 Ga0070667_100235699 3300005367 Bacteria 1633
17 Ga0070714_100069910 3300005435 Bacteria 3033
18 Ga0070713_100002791 3300005436 Bacteria 11409
19 Ga0070678_100042660 3300005456 Bacteria 3226
20 Ga0070662_100235542 3300005457 Bacteria 1466
21 Ga0070681_10069880 3300005458 Bacteria 3477
22 Ga0070706_100140692 3300005467 Bacteria 2253
23 Ga0070698_100022085 3300005471 Bacteria 6663
24 Ga0070679_100014537 3300005530 Bacteria 7561
25 Ga0070684_100166629 3300005535 Bacteria 2000
26 Ga0068853_100026433 3300005539 Bacteria 4873
27 Ga0070696_100033882 3300005546 Bacteria 3511
28 Ga0070664_100000254 3300005564 Bacteria 38403
29 Ga0068857_100012943 3300005577 Bacteria 7269
30 Ga0068859_100065776 3300005617 Bacteria 3659
31 Ga0068864_100023123 3300005618 Bacteria 5219
32 Ga0068866_10044471 3300005718 Bacteria 2222
33 Ga0068863_100239635 3300005841 Bacteria 1751
34 Ga0068860_100089319 3300005843 Bacteria 2933
35 Ga0068862_100293528 3300005844 Bacteria 1494
36 Ga0081540_1021332 3300005983 Bacteria 3862
37 Ga0075364_10063706 3300006051 Bacteria 2421
38 Ga0075432_10001931 3300006058 Bacteria 6877
39 Ga0075432_10027238 3300006058 Bacteria 1967
40 Ga0075362_10010986 3300006177 Bacteria 3555
41 Ga0097621_100348902 3300006237 Bacteria 1316
42 Ga0075370_10030198 3300006353 Bacteria 3023
43 Ga0068871_100057933 3300006358 Bacteria 3153
44 Ga0075430_100068352 3300006846 Bacteria 2981
45 Ga0075431_100052353 3300006847 Bacteria 4210
46 Ga0068865_100129056 3300006881 Bacteria 1892
47 Ga0075436_100019212 3300006914 Bacteria 4682
48 Ga0097620_100065772 3300006931 Bacteria 3659
49 Ga0099823_1000022 3300006944 Bacteria 75580
50 Ga0079104_1001171 3300006946 Bacteria 18943
51 Ga0079104_1002206 3300006946 Bacteria 10944
52 Ga0105251_10000086 3300009011 Bacteria 88725
53 Ga0105251_10005219 3300009011 Bacteria 8562
54 Ga0105251_10011675 3300009011 Bacteria 5007
55 Ga0105251_10023586 3300009011 Bacteria 3173
56 Ga0105251_10035816 3300009011 Bacteria 2446
57 Ga0105244_10000437 3300009036 Bacteria 38343
58 Ga0105244_10003540 3300009036 Bacteria 11098
59 Ga0105244_10004528 3300009036 Bacteria 9534
60 Ga0105244_10004923 3300009036 Bacteria 9036
61 Ga0105244_10008020 3300009036 Bacteria 6642
62 Ga0105244_10009564 3300009036 Bacteria 5946
63 Ga0105244_10017407 3300009036 Bacteria 4062
64 Ga0105244_10028172 3300009036 Bacteria 3017
65 Ga0105244_10037490 3300009036 Bacteria 2534
66 Ga0105244_10064859 3300009036 Bacteria 1831
67 Ga0105250_10000172 3300009092 Bacteria 56485
68 Ga0105250_10000347 3300009092 Bacteria 35622
69 Ga0105250_10011249 3300009092 Bacteria 3713
70 Ga0105250_10014663 3300009092 Bacteria 3216
71 Ga0105240_10334530 3300009093 Bacteria 1722
72 Ga0111539_10136864 3300009094 Bacteria 2868
73 Ga0105245_10138337 3300009098 Bacteria 2291
74 Ga0105247_10089607 3300009101 Bacteria 1950
75 Ga0105243_10043908 3300009148 Bacteria 3505
76 Ga0105243_10086394 3300009148 Bacteria 2573
77 Ga0105241_10156517 3300009174 Bacteria 1869
78 Ga0105248_10151576 3300009177 Bacteria 2616
79 Ga0105246_10000013 3300011119 Bacteria 67142
80 Ga0157373_10000541 3300013100 Bacteria 29567
81 Ga0157373_10001081 3300013100 Bacteria 20989
82 Ga0157371_10003279 3300013102 Bacteria 14838
83 Ga0157371_10021277 3300013102 Bacteria 4763
84 Ga0157370_10000596 3300013104 Bacteria 45119
85 Ga0157370_10015275 3300013104 Bacteria 7811
86 Ga0157370_10107782 3300013104 Bacteria 2605
87 Ga0157370_10129949 3300013104 Bacteria 2350
88 Ga0157369_10005711 3300013105 Bacteria 14453
89 Ga0163162_10004287 3300013306 Bacteria 13719
90 Ga0163162_10013542 3300013306 Bacteria 7965
91 Ga0163162_10140470 3300013306 Bacteria 2528
92 Ga0157372_10004147 3300013307 Bacteria 15519
93 Ga0157375_10074982 3300013308 Bacteria 3406
94 Ga0163163_10016387 3300014325 Bacteria 6885
95 Ga0157380_10069263 3300014326 Bacteria 2846
96 Ga0157380_10082392 3300014326 Bacteria 2633
97 Ga0157380_10143844 3300014326 Bacteria 2052
98 Ga0182008_10004178 3300014497 Bacteria 8492
99 Ga0182008_10036680 3300014497 Bacteria 2453
100 Ga0157376_10090818 3300014969 Bacteria 2644
101 Ga0182007_10002153 3300015262 Bacteria 10019
102 Ga0182005_1001766 3300015265 Bacteria 8314
103 Ga0182005_1020481 3300015265 Bacteria 1820
104 Ga0163161_10004099 3300017792 Bacteria 10197
105 Ga0163161_10010040 3300017792 Bacteria 6554
106 Ga0163161_10010625 3300017792 Bacteria 6375
107 Ga0163161_10012350 3300017792 Bacteria 5928
108 Ga0163161_10068880 3300017792 Bacteria 2586
109 Ga0163161_10093208 3300017792 Bacteria 2231
110 Ga0163161_10137430 3300017792 Bacteria 1848
111 Ga0209674_102981 3300025226 Bacteria 3288
112 Ga0209563_102497 3300025230 Bacteria 4138
113 Ga0209026_1000051 3300025250 Bacteria 250792
114 Ga0207696_1000038 3300025711 Bacteria 328221
115 Ga0207696_1000461 3300025711 Bacteria 35422
116 Ga0207696_1001046 3300025711 Bacteria 16401
117 Ga0207696_1016446 3300025711 Bacteria 2474
118 Ga0207696_1028989 3300025711 Bacteria 1693
119 Ga0207655_1000002 3300025728 Bacteria 1148694
120 Ga0207655_1000050 3300025728 Bacteria 294923
121 Ga0207655_1000538 3300025728 Bacteria 47965
122 Ga0207655_1001026 3300025728 Bacteria 28192
123 Ga0207655_1006214 3300025728 Bacteria 7953
124 Ga0207655_1006460 3300025728 Bacteria 7762
125 Ga0207655_1006869 3300025728 Bacteria 7471
126 Ga0207713_1000002 3300025735 Bacteria 1061749
127 Ga0207713_1000155 3300025735 Bacteria 102677
128 Ga0207713_1002314 3300025735 Bacteria 13998
129 Ga0207713_1057953 3300025735 Bacteria 1494
130 Ga0207682_10004698 3300025893 Bacteria 5668
131 Ga0207710_10023539 3300025900 Bacteria 2647
132 Ga0207688_10028915 3300025901 Bacteria 3049
133 Ga0207680_10106415 3300025903 Bacteria 1811
134 Ga0207643_10098703 3300025908 Bacteria 1710
135 Ga0207707_10056902 3300025912 Bacteria 3403
136 Ga0207657_10277798 3300025919 Bacteria 1330
137 Ga0207700_10002954 3300025928 Bacteria 9807
138 Ga0207664_10119431 3300025929 Bacteria 2204
139 Ga0207690_10026676 3300025932 Bacteria 3640
140 Ga0207706_10295294 3300025933 Bacteria 1412
141 Ga0207669_10005135 3300025937 Bacteria 5837
142 Ga0207691_10017500 3300025940 Bacteria 6795
143 Ga0207689_10031203 3300025942 Bacteria 4439
144 Ga0207651_10035645 3300025960 Bacteria 3238
145 Ga0207651_10085890 3300025960 Bacteria 2285
146 Ga0207658_10227279 3300025986 Bacteria 1573
147 Ga0207703_10064322 3300026035 Bacteria 3010
148 Ga0207639_10277169 3300026041 Bacteria 1473
149 Ga0207708_10077272 3300026075 Bacteria 2555
150 Ga0207648_10070831 3300026089 Bacteria 3039
151 Ga0207676_10019428 3300026095 Bacteria 4957
152 Ga0207674_10001237 3300026116 Bacteria 33330
153 Ga0207674_10056836 3300026116 Bacteria 3970
154 Ga0207675_100115106 3300026118 Bacteria 2541
155 Ga0207683_10011380 3300026121 Bacteria 7592
156 Ga0207683_10174899 3300026121 Bacteria 1945
157 Ga0209281_1000003 3300027111 Bacteria 1260089
158 Ga0209281_1000055 3300027111 Bacteria 308297
159 Ga0209389_1000103 3300027296 Bacteria 75590
160 Ga0209371_1001607 3300027312 Bacteria 14687
161 Ga0207428_10019021 3300027907 Bacteria 5858
162 Ga0207428_10093154 3300027907 Bacteria 2337
163 Ga0207428_10250258 3300027907 Bacteria 1322
164 Ga0268264_10208555 3300028381 Bacteria 1792
165 Ga0268256_1001390 3300030500 Bacteria 14687
166 Ga0307509_10039803 3300031507 Bacteria 5117
167 Ga0307412_10021385 3300031911 Bacteria 3952
168 Ga0307412_10097135 3300031911 Bacteria 2075
169 Ga0307411_10000130 3300032005 Bacteria 23527
170 Ga0307510_10000573 3300033180 Bacteria 37069
171 Ga0439438_001392 3300041405 Bacteria 10658
172 Ga0439438_012595 3300041405 Bacteria 2588
173 Ga0439466_0005744 3300041411 Bacteria 4733
174 Ga0439451_000225 3300042009 Bacteria 10896
175 Ga0439451_001952 3300042009 Bacteria 4126
176 Ga0439452_000718 3300042010 Bacteria 16099
177 Ga0439452_027151 3300042010 Bacteria 1439
178 Ga0439456_006148 3300042013 Bacteria 2444
179 Ga0439463_000015 3300042016 Bacteria 36632
180 Ga0450920_000677 3300042122 Bacteria 5469
181 Ga0450903_000874 3300042138 Bacteria 5810
182 Ga0450903_002364 3300042138 Bacteria 3366
183 Ga0450907_001659 3300042146 Bacteria 4663
184 Ga0439460_0013768 3300042461 Bacteria 2120
185 Ga0450901_001518 3300042533 Bacteria 2641
186 Ga0453684_0003944 3300044712 Bacteria 32474
187 Ga0495617_000135 3300046452 Bacteria 49103
188 Ga0495617_000918 3300046452 Bacteria 13712
189 Ga0495617_001490 3300046452 Bacteria 10236
190 Ga0495617_001835 3300046452 Bacteria 9017
191 Ga0495617_001979 3300046452 Bacteria 8568
192 Ga0495617_024991 3300046452 Bacteria 2014
193 Ga0495627_000009 3300046453 Bacteria 463964
194 Ga0495627_000676 3300046453 Bacteria 26242
195 Ga0495627_007243 3300046453 Bacteria 4274
196 Ga0495603_0000025 3300046455 Bacteria 62985
197 Ga0495603_0068285 3300046455 Bacteria 2091
198 Ga0495590_0003486 3300046457 Bacteria 6423
199 Ga0495590_0003620 3300046457 Bacteria 6293
200 Ga0495591_000009 3300046458 Bacteria 331626
201 Ga0495591_000407 3300046458 Bacteria 35968
202 Ga0495591_002082 3300046458 Bacteria 11533
203 Ga0495591_002502 3300046458 Bacteria 10165
204 Ga0495638_0000549 3300046460 Bacteria 42940
205 Ga0495638_0003446 3300046460 Bacteria 12458
206 Ga0495638_0009961 3300046460 Bacteria 6627
207 Ga0495638_0062242 3300046460 Bacteria 2304
208 Ga0495653_0008695 3300046463 Bacteria 8318
209 Ga0495653_0079863 3300046463 Bacteria 2421
210 Ga0495650_0000031 3300046471 Bacteria 433811
211 Ga0495650_0000484 3300046471 Bacteria 60820
212 Ga0495650_0000510 3300046471 Bacteria 57886
213 Ga0495650_0001519 3300046471 Bacteria 22035
214 Ga0495650_0006668 3300046471 Bacteria 7155
215 Ga0495650_0006859 3300046471 Bacteria 7007
216 Ga0495650_0013185 3300046471 Bacteria 4389
217 Ga0495580_0001609 3300046472 Bacteria 19852
218 Ga0495605_0000517 3300046474 Bacteria 32881
219 Ga0495605_0001173 3300046474 Bacteria 17399
220 Ga0495605_0009216 3300046474 Bacteria 5546
221 Ga0495605_0029047 3300046474 Bacteria 2850
222 Ga0495605_0036997 3300046474 Bacteria 2458
223 Ga0495605_0040558 3300046474 Bacteria 2323
224 Ga0495605_0050625 3300046474 Bacteria 2026
225 Ga0495584_0000083 3300046491 Bacteria 66118
226 Ga0495584_0000668 3300046491 Bacteria 22834
227 Ga0495584_0000809 3300046491 Bacteria 20576
228 Ga0495584_0002102 3300046491 Bacteria 11408
229 Ga0495584_0006383 3300046491 Bacteria 6178
230 Ga0495584_0042962 3300046491 Bacteria 2282
231 Ga0495584_0053909 3300046491 Bacteria 2023
232 Ga0495585_0001045 3300046492 Bacteria 22938
233 Ga0495585_0012755 3300046492 Bacteria 4944
234 Ga0495585_0048360 3300046492 Bacteria 2365
235 Ga0495594_0006508 3300046499 Bacteria 6011
236 Ga0495596_0000034 3300046500 Bacteria 100596
237 Ga0495596_0001548 3300046500 Bacteria 13113
238 Ga0495596_0005699 3300046500 Bacteria 5845
239 Ga0495607_0000136 3300046501 Bacteria 77992
240 Ga0495607_0000584 3300046501 Bacteria 35513
241 Ga0495607_0000856 3300046501 Bacteria 28712
242 Ga0495607_0004229 3300046501 Bacteria 10647
243 Ga0495607_0041443 3300046501 Bacteria 2735
244 Ga0495583_0000093 3300046506 Bacteria 158708
245 Ga0495583_0000778 3300046506 Bacteria 39897
246 Ga0495583_0001424 3300046506 Bacteria 24362
247 Ga0495583_0001449 3300046506 Bacteria 24038
248 Ga0495583_0025985 3300046506 Bacteria 2913
249 Ga0495583_0028515 3300046506 Bacteria 2743
250 Ga0495606_0001186 3300046507 Bacteria 36728
251 Ga0495606_0001321 3300046507 Bacteria 33870
252 Ga0495606_0003164 3300046507 Bacteria 17807
253 Ga0495606_0003718 3300046507 Bacteria 15922
254 Ga0495606_0004522 3300046507 Bacteria 13841
255 Ga0495610_0000852 3300046512 Bacteria 28433
256 Ga0495610_0001087 3300046512 Bacteria 24865
257 Ga0495610_0023216 3300046512 Bacteria 3376
258 Ga0495610_0023522 3300046512 Bacteria 3347
259 Ga0495610_0027634 3300046512 Bacteria 3012
260 Ga0495616_0000798 3300046513 Bacteria 23077
261 Ga0495616_0000844 3300046513 Bacteria 22353
262 Ga0495616_0002376 3300046513 Bacteria 12532
263 Ga0495616_0029353 3300046513 Bacteria 2905
264 Ga0495620_0003956 3300046515 Bacteria 8421
265 Ga0495620_0004873 3300046515 Bacteria 7532
266 Ga0495620_0005580 3300046515 Bacteria 7011
267 Ga0495620_0015169 3300046515 Bacteria 3896
268 Ga0495630_0265039 3300046517 Bacteria 1312
269 Ga0495631_0000031 3300046518 Bacteria 85555
270 Ga0495631_0001952 3300046518 Bacteria 12097
271 Ga0495632_0000277 3300046519 Bacteria 50320
272 Ga0495632_0002075 3300046519 Bacteria 15706
273 Ga0495632_0005254 3300046519 Bacteria 8611
274 Ga0495632_0021766 3300046519 Bacteria 3448
275 Ga0495632_0026856 3300046519 Bacteria 3023
276 Ga0495632_0031599 3300046519 Bacteria 2734
277 Ga0495637_0000334 3300046520 Bacteria 36438
278 Ga0495637_0000365 3300046520 Bacteria 34448
279 Ga0495637_0000716 3300046520 Bacteria 22706
280 Ga0495637_0004083 3300046520 Bacteria 7618
281 Ga0495637_0004400 3300046520 Bacteria 7310
282 Ga0495637_0016590 3300046520 Bacteria 3441
283 Ga0495643_0000284 3300046522 Bacteria 72435
284 Ga0495643_0002899 3300046522 Bacteria 13012
285 Ga0495643_0004168 3300046522 Bacteria 10267
286 Ga0495643_0007286 3300046522 Bacteria 7149
287 Ga0495643_0026580 3300046522 Bacteria 3264
288 Ga0495643_0030453 3300046522 Bacteria 3012
289 Ga0495644_0000105 3300046523 Bacteria 39842
290 Ga0495644_0002078 3300046523 Bacteria 8073
291 Ga0495648_0000318 3300046524 Bacteria 53345
292 Ga0495648_0000636 3300046524 Bacteria 37436
293 Ga0495648_0001527 3300046524 Bacteria 22639
294 Ga0495648_0016341 3300046524 Bacteria 5353
295 Ga0495648_0021361 3300046524 Bacteria 4484
296 Ga0495648_0043334 3300046524 Bacteria 2822
297 Ga0495648_0047359 3300046524 Bacteria 2658
298 Ga0495666_0027029 3300046526 Bacteria 2824
299 Ga0495666_0046267 3300046526 Bacteria 2098
300 Ga0495642_0000024 3300046528 Bacteria 92899
301 Ga0495654_0000069 3300046530 Bacteria 120853
302 Ga0495654_0000769 3300046530 Bacteria 24760
303 Ga0495654_0002032 3300046530 Bacteria 13301
304 Ga0495654_0006688 3300046530 Bacteria 6525
305 Ga0495654_0015035 3300046530 Bacteria 4112
306 Ga0495654_0019859 3300046530 Bacteria 3508
307 Ga0495609_0000302 3300046538 Bacteria 45199
308 Ga0495609_0007079 3300046538 Bacteria 5646
309 Ga0495609_0008567 3300046538 Bacteria 4999
310 Ga0495621_0022963 3300046539 Bacteria 2072
311 Ga0495597_0000330 3300046542 Bacteria 42738
312 Ga0495597_0032009 3300046542 Bacteria 2389
313 Ga0495622_0001454 3300046557 Bacteria 11935
314 Ga0495633_0000214 3300046558 Bacteria 72530
315 Ga0495633_0016777 3300046558 Bacteria 3764
316 Ga0495656_0017060 3300046615 Bacteria 2764
317 Ga0495668_0000776 3300046616 Bacteria 37248
318 Ga0495668_0002790 3300046616 Bacteria 13912
319 Ga0495668_0120428 3300046616 Bacteria 1435
320 Ga0495634_0000347 3300046642 Bacteria 44864
321 Ga0495611_0000067 3300046648 Bacteria 72577
322 Ga0495611_0000584 3300046648 Bacteria 21088
323 Ga0495625_0000945 3300046660 Bacteria 38925
324 Ga0495625_0001743 3300046660 Bacteria 25161
325 Ga0495625_0001876 3300046660 Bacteria 23864
326 Ga0495625_0004397 3300046660 Bacteria 13361
327 Ga0495625_0005051 3300046660 Bacteria 12225
328 Ga0495625_0009591 3300046660 Bacteria 8081
329 Ga0495625_0021006 3300046660 Bacteria 5033
330 Ga0495635_0000210 3300046663 Bacteria 37002
331 Ga0495659_0000477 3300046664 Bacteria 14788
332 Ga0495659_0036533 3300046664 Bacteria 1736
333 Ga0495661_0000468 3300046665 Bacteria 42758
334 Ga0495661_0002471 3300046665 Bacteria 14223
335 Ga0495661_0006380 3300046665 Bacteria 8299
336 Ga0495661_0020507 3300046665 Bacteria 4313
337 Ga0495661_0034481 3300046665 Bacteria 3184
338 Ga0495661_0057960 3300046665 Bacteria 2310
339 Ga0495661_0104288 3300046665 Bacteria 1590
340 Ga0495646_0001737 3300046680 Bacteria 13069
341 Ga0495613_0004016 3300046689 Bacteria 11014
342 Ga0495670_0000151 3300046691 Bacteria 30854
343 Ga0495670_0003361 3300046691 Bacteria 7872
344 Ga0495670_0011350 3300046691 Bacteria 4380
345 Ga0495670_0017375 3300046691 Bacteria 3540
346 Ga0495670_0045079 3300046691 Bacteria 2201
347 Ga0495670_0068649 3300046691 Bacteria 1791
348 Ga0495671_0000061 3300046692 Bacteria 107050
349 Ga0495671_0000446 3300046692 Bacteria 32728
350 Ga0495671_0000685 3300046692 Bacteria 24518
351 Ga0495671_0000854 3300046692 Bacteria 21794
352 Ga0495671_0000995 3300046692 Bacteria 19753
353 Ga0495671_0002224 3300046692 Bacteria 12335
354 Ga0495671_0003322 3300046692 Bacteria 9937
355 Ga0495671_0006414 3300046692 Bacteria 6792
356 Ga0495671_0034067 3300046692 Bacteria 2591
357 Ga0495649_0000154 3300046694 Bacteria 60553
358 Ga0495649_0002842 3300046694 Bacteria 12022
359 Ga0495649_0006297 3300046694 Bacteria 7386
360 Ga0495649_0009553 3300046694 Bacteria 5754
361 Ga0495649_0021909 3300046694 Bacteria 3579
362 Ga0495649_0047951 3300046694 Bacteria 2322
363 Ga0495589_0006162 3300046794 Bacteria 6332
364 Ga0495589_0006736 3300046794 Bacteria 6050
365 Ga0495589_0007467 3300046794 Bacteria 5729
366 Ga0495589_0007960 3300046794 Bacteria 5546
367 Ga0495589_0022324 3300046794 Bacteria 3230
368 Ga0495660_0000016 3300046810 Bacteria 321859
369 Ga0495660_0000153 3300046810 Bacteria 74797
370 Ga0495660_0000439 3300046810 Bacteria 34751
371 Ga0495660_0000708 3300046810 Bacteria 25589
372 Ga0495660_0002469 3300046810 Bacteria 11788
373 Ga0495660_0007505 3300046810 Bacteria 6401
374 Ga0495660_0008934 3300046810 Bacteria 5852
375 Ga0495636_0000366 3300047318 Bacteria 17077
376 Ga0495672_0000372 3300047320 Bacteria 55920
377 Ga0495672_0002005 3300047320 Bacteria 19233
378 Ga0495672_0002052 3300047320 Bacteria 18929
379 Ga0495672_0003081 3300047320 Bacteria 14594
380 Ga0495672_0006011 3300047320 Bacteria 9502
381 Ga0495672_0011879 3300047320 Bacteria 6112
382 Ga0495672_0012996 3300047320 Bacteria 5766
383 Ga0495672_0072198 3300047320 Bacteria 1950
384 Ga0495680_0006234 3300047322 Bacteria 11121
385 Ga0495683_0000366 3300047323 Bacteria 37150
386 Ga0495683_0001132 3300047323 Bacteria 18365
387 Ga0495687_000334 3300047443 Bacteria 60345
388 Ga0495687_002437 3300047443 Bacteria 14957
389 Ga0495687_011065 3300047443 Bacteria 4882
390 Ga0495677_0077679 3300047445 Bacteria 1242
391 Ga0495679_008083 3300047446 Bacteria 4310
392 Ga0495679_008659 3300047446 Bacteria 4119
393 Ga0495679_026316 3300047446 Bacteria 1933
394 Ga0495673_0000214 3300047469 Bacteria 86259
395 Ga0495673_0000358 3300047469 Bacteria 56024
396 Ga0495673_0000624 3300047469 Bacteria 34803
397 Ga0495673_0000753 3300047469 Bacteria 30736
398 Ga0495673_0008059 3300047469 Bacteria 5969
399 Ga0495673_0014369 3300047469 Bacteria 4118
400 Ga0495673_0017746 3300047469 Bacteria 3604
401 Ga0495681_0000023 3300047470 Bacteria 154266
402 Ga0495681_0001164 3300047470 Bacteria 19952
403 Ga0495681_0001887 3300047470 Bacteria 15386
404 Ga0495681_0003019 3300047470 Bacteria 11832
405 Ga0495681_0007225 3300047470 Bacteria 7138
406 Ga0495681_0009939 3300047470 Bacteria 5806
407 Ga0495681_0036855 3300047470 Bacteria 2414
408 Ga0495686_0006014 3300047472 Bacteria 9429
409 Ga0495686_0006407 3300047472 Bacteria 9019
410 Ga0495593_0022063 3300047673 Bacteria 3552
411 Ga0495626_0000388 3300048091 Bacteria 45447
412 Ga0495626_0003344 3300048091 Bacteria 10340
413 Ga0495626_0018731 3300048091 Bacteria 3469
414 Ga0495626_0018981 3300048091 Bacteria 3441
415 Ga0496102_0000444 3300048905 Bacteria 47025
416 Ga0496103_0000290 3300048906 Bacteria 47006
417 Ga0496110_0010902 3300048913 Bacteria 7411
418 Ga0496110_0093754 3300048913 Bacteria 2688
419 Ga0496110_0122656 3300048913 Bacteria 2342
420 Ga0496111_0144724 3300048914 Bacteria 1762
421 Ga0496112_0004744 3300048915 Bacteria 11586
422 Ga0496115_0310810 3300048918 Bacteria 1290
423 Ga0496116_0000394 3300048919 Bacteria 63846
424 Ga0496116_0015807 3300048919 Bacteria 5944
425 Ga0496117_0001290 3300048920 Bacteria 36931
426 Ga0496117_0002386 3300048920 Bacteria 23895
427 Ga0496117_0008509 3300048920 Bacteria 9730
428 Ga0496118_0000345 3300048921 Bacteria 78809
429 Ga0496118_0000491 3300048921 Bacteria 65587
430 Ga0496118_0005120 3300048921 Bacteria 15061
431 Ga0496119_0001519 3300048922 Bacteria 27732
432 Ga0496120_0001414 3300048923 Bacteria 28977
433 Ga0496121_0045565 3300048924 Bacteria 3766
434 Ga0496121_0100989 3300048924 Bacteria 2226
435 Ga0496122_0000810 3300048925 Bacteria 59986
436 Ga0496123_0001426 3300048926 Bacteria 33426
437 Ga0496124_0000445 3300048927 Bacteria 72989
438 Ga0496124_0000586 3300048927 Bacteria 61341
439 Ga0496124_0005976 3300048927 Bacteria 13440
440 Ga0496124_0023815 3300048927 Bacteria 5580
441 Ga0496124_0055745 3300048927 Bacteria 3338
442 Ga0496125_0006650 3300048928 Bacteria 12443
443 Ga0496125_0123316 3300048928 Bacteria 1842
444 Ga0496125_0135593 3300048928 Bacteria 1723
445 Ga0496126_0074836 3300048929 Bacteria 3007
446 Ga0496126_0125519 3300048929 Bacteria 2221
447 Ga0496126_0163896 3300048929 Bacteria 1898
448 Ga0495678_000008 3300049459 Bacteria 445926
449 Ga0495678_000091 3300049459 Bacteria 114504
450 Ga0495678_000796 3300049459 Bacteria 28272
451 Ga0495678_005908 3300049459 Bacteria 6624
452 Ga0495678_036314 3300049459 Bacteria 2011
453 Ga0495682_0000001 3300049460 Bacteria 1559116
454 Ga0495682_0000232 3300049460 Bacteria 43870
455 Ga0495682_0004381 3300049460 Bacteria 6054
456 Ga0495682_0004996 3300049460 Bacteria 5575
457 Ga0495682_0005227 3300049460 Bacteria 5422
458 Ga0495682_0021218 3300049460 Bacteria 2435
459 Ga0495682_0022624 3300049460 Bacteria 2350
460 nmdc:mga00v17_36924_c2 3300050491 Bacteria 2222
461 nmdc:mga06r32_137996_c1 3300050510 Bacteria 2413
462 nmdc:mga08y16_182149_c1 3300050511 Bacteria 2181
463 nmdc:mga08x19_62699_c1 3300050514 Bacteria 2411
464 Ga0500610_0001871 3300053079 Bacteria 7461
465 Ga0500583_0014009 3300053092 Bacteria 3125
466 Ga0500583_0101205 3300053092 Bacteria 1411
467 Ga0500651_0001730 3300053093 Bacteria 11188
468 Ga0500569_001156 3300053109 Bacteria 4869
469 Ga0500594_0000334 3300053118 Bacteria 10548
470 Ga0500617_021460 3300053124 Bacteria 2841
471 Ga0500618_000116 3300053125 Bacteria 64971
472 Ga0500621_000002 3300053126 Bacteria 849473
473 Ga0500658_0013484 3300053134 Bacteria 3020
474 Ga0500659_0004513 3300053135 Bacteria 7941
475 Ga0500588_0039879 3300053146 Bacteria 1408
476 Ga0500616_0000075 3300053153 Bacteria 221455
477 Ga0500634_0000115 3300053161 Bacteria 30142
478 Ga0500645_001044 3300053730 Bacteria 15423
479 2511134559 2510917022 Bacteria 6504556
480 2511199531 2510917030 Bacteria 7460662
481 2511257801 2511231004 Bacteria 6669789
482 2511268715 2511231006 Bacteria 6794709
483 2511274084 2511231007 Bacteria 6306603
484 2511278987 2511231008 Bacteria 6624100
485 2511304300 2511231012 Bacteria 6738011
486 2511315630 2511231014 Bacteria 6462302
487 2511321399 2511231015 Bacteria 6598026
488 2511337437 2511231018 Bacteria 6436256
489 2511343740 2511231019 Bacteria 6520662
490 2511350792 2511231020 Bacteria 6115223
491 2511353916 2511231021 Bacteria 7302637
492 2511365653 2511231022 Bacteria 6719296
493 2511371655 2511231023 Bacteria 6808468
494 2511381265 2511231025 Bacteria 5324661
495 2511413029 2511231031 Bacteria 6558529
496 2511825117 2511231156 Bacteria 6845832
497 2585397345 2582581866 Bacteria 6859583
498 2585557967 2585427530 Bacteria 7383882
499 2585562460 2585427531 Bacteria 6992870
500 2585906374 2585427609 Bacteria 6667127
501 2587981796 2585428125 Bacteria 6662905
502 2599409390 2599185169 Bacteria 5441380
503 2601643719 2600255287 Bacteria 5210468
504 2601663543 2600255291 Bacteria 5217298
505 2601696576 2600255298 Bacteria 5215185
506 2601701175 2600255299 Bacteria 5218662
507 2601721600 2600255303 Bacteria 5219315
508 2601739934 2600255307 Bacteria 5439064
509 2601750423 2600255309 Bacteria 5431045
510 2602017676 2600255392 Bacteria 5437392
511 2603660929 2602042052 Bacteria 5215873
512 2603666203 2602042053 Bacteria 5214361
513 2603877016 2602042111 Bacteria 5212080
514 2606070636 2603880184 Bacteria 5217896
515 2637225286 2636415599 Bacteria 5718434
516 2643999125 2643221598 Bacteria 4578346
517 2644731554 2643221733 Bacteria 5690728
518 2676406535 2675903046 Bacteria 5451247
519 2739256935 2738543015 Bacteria 6750701
520 2743737133 2740892503 Bacteria 6855563
521 2807176776 2806310673 Bacteria 4801221
522 2842167806 2842163707 Bacteria 6916235
523 2842835987 2842832357 Bacteria 5959113
524 2857567791 2857564685 Bacteria 6290584
525 2919461246 2919456309 Bacteria 6586567
526 2923156166 2923153595 Bacteria 6870622
527 2939573342 2939573065 Bacteria 4926053
528 2939639879 2939636861 Bacteria 6297853
529 2945962901 2945961074 Bacteria 7342064
530 Ga0495637_0000034
531 MRS2a_Contig_18
532 JGI25157J39369_1002985
533 Ga0055533_1009165
534 Ga0065714_10010907
535 Ga0065714_10067179
536 Ga0065704_10135473
537 Ga0065712_10006342
538 Ga0070660_100294577
539 Ga0070689_100147243
540 Ga0070661_100145299
541 Ga0070675_100060032
542 Ga0070674_100005432
543 Ga0070673_100012935
544 Ga0070659_100003362
545 Ga0070667_100235699
546 Ga0070714_100069910
547 Ga0070713_100002791
548 Ga0070678_100042660
549 Ga0070662_100235542
550 Ga0070681_10069880
551 Ga0070706_100140692
552 Ga0070698_100022085
553 Ga0070679_100014537
554 Ga0070684_100166629
555 Ga0068853_100026433
556 Ga0070696_100033882
557 Ga0070664_100000254
558 Ga0068857_100012943
559 Ga0068859_100065776
560 Ga0068864_100023123
561 Ga0068866_10044471
562 Ga0068863_100239635
563 Ga0068860_100089319
564 Ga0068862_100293528
565 Ga0081540_1021332
566 Ga0075364_10063706
567 Ga0075432_10001931
568 Ga0075432_10027238
569 Ga0075362_10010986
570 Ga0097621_100348902
571 Ga0075370_10030198
572 Ga0068871_100057933
573 Ga0075430_100068352
574 Ga0075431_100052353
575 Ga0068865_100129056
576 Ga0075436_100019212
577 Ga0097620_100065772
578 Ga0099823_1000022
579 Ga0079104_1001171
580 Ga0079104_1002206
581 Ga0105251_10000086
582 Ga0105251_10005219
583 Ga0105251_10011675
584 Ga0105251_10023586
585 Ga0105251_10035816
586 Ga0105244_10000437
587 Ga0105244_10003540
588 Ga0105244_10004528
589 Ga0105244_10004923
590 Ga0105244_10008020
591 Ga0105244_10009564
592 Ga0105244_10017407
593 Ga0105244_10028172
594 Ga0105244_10037490
595 Ga0105244_10064859
596 Ga0105250_10000172
597 Ga0105250_10000347
598 Ga0105250_10011249
599 Ga0105250_10014663
600 Ga0105240_10334530
601 Ga0111539_10136864
602 Ga0105245_10138337
603 Ga0105247_10089607
604 Ga0105243_10043908
605 Ga0105243_10086394
606 Ga0105241_10156517
607 Ga0105248_10151576
608 Ga0105246_10000013
609 Ga0157373_10000541
610 Ga0157373_10001081
611 Ga0157371_10003279
612 Ga0157371_10021277
613 Ga0157370_10000596
614 Ga0157370_10015275
615 Ga0157370_10107782
616 Ga0157370_10129949
617 Ga0157369_10005711
618 Ga0163162_10004287
619 Ga0163162_10013542
620 Ga0163162_10140470
621 Ga0157372_10004147
622 Ga0157375_10074982
623 Ga0163163_10016387
624 Ga0157380_10069263
625 Ga0157380_10082392
626 Ga0157380_10143844
627 Ga0182008_10004178
628 Ga0182008_10036680
629 Ga0157376_10090818
630 Ga0182007_10002153
631 Ga0182005_1001766
632 Ga0182005_1020481
633 Ga0163161_10004099
634 Ga0163161_10010040
635 Ga0163161_10010625
636 Ga0163161_10012350
637 Ga0163161_10068880
638 Ga0163161_10093208
639 Ga0163161_10137430
640 Ga0209674_102981
641 Ga0209563_102497
642 Ga0209026_1000051
643 Ga0207696_1000038
644 Ga0207696_1000461
645 Ga0207696_1001046
646 Ga0207696_1016446
647 Ga0207696_1028989
648 Ga0207655_1000002
649 Ga0207655_1000050
650 Ga0207655_1000538
651 Ga0207655_1001026
652 Ga0207655_1006214
653 Ga0207655_1006460
654 Ga0207655_1006869
655 Ga0207713_1000002
656 Ga0207713_1000155
657 Ga0207713_1002314
658 Ga0207713_1057953
659 Ga0207682_10004698
660 Ga0207710_10023539
661 Ga0207688_10028915
662 Ga0207680_10106415
663 Ga0207643_10098703
664 Ga0207707_10056902
665 Ga0207657_10277798
666 Ga0207700_10002954
667 Ga0207664_10119431
668 Ga0207690_10026676
669 Ga0207706_10295294
670 Ga0207669_10005135
671 Ga0207691_10017500
672 Ga0207689_10031203
673 Ga0207651_10035645
674 Ga0207651_10085890
675 Ga0207658_10227279
676 Ga0207703_10064322
677 Ga0207639_10277169
678 Ga0207708_10077272
679 Ga0207648_10070831
680 Ga0207676_10019428
681 Ga0207674_10001237
682 Ga0207674_10056836
683 Ga0207675_100115106
684 Ga0207683_10011380
685 Ga0207683_10174899
686 Ga0209281_1000003
687 Ga0209281_1000055
688 Ga0209389_1000103
689 Ga0209371_1001607
690 Ga0207428_10019021
691 Ga0207428_10093154
692 Ga0207428_10250258
693 Ga0268264_10208555
694 Ga0268256_1001390
695 Ga0307509_10039803
696 Ga0307412_10021385
697 Ga0307412_10097135
698 Ga0307411_10000130
699 Ga0307510_10000573
700 Ga0439438_001392
701 Ga0439438_012595
702 Ga0439466_0005744
703 Ga0439451_000225
704 Ga0439451_001952
705 Ga0439452_000718
706 Ga0439452_027151
707 Ga0439456_006148
708 Ga0439463_000015
709 Ga0450920_000677
710 Ga0450903_000874
711 Ga0450903_002364
712 Ga0450907_001659
713 Ga0439460_0013768
714 Ga0450901_001518
715 Ga0453684_0003944
716 Ga0495617_000135
717 Ga0495617_000918
718 Ga0495617_001490
719 Ga0495617_001835
720 Ga0495617_001979
721 Ga0495617_024991
722 Ga0495627_000009
723 Ga0495627_000676
724 Ga0495627_007243
725 Ga0495603_0000025
726 Ga0495603_0068285
727 Ga0495590_0003486
728 Ga0495590_0003620
729 Ga0495591_000009
730 Ga0495591_000407
731 Ga0495591_002082
732 Ga0495591_002502
733 Ga0495638_0000549
734 Ga0495638_0003446
735 Ga0495638_0009961
736 Ga0495638_0062242
737 Ga0495653_0008695
738 Ga0495653_0079863
739 Ga0495650_0000031
740 Ga0495650_0000484
741 Ga0495650_0000510
742 Ga0495650_0001519
743 Ga0495650_0006668
744 Ga0495650_0006859
745 Ga0495650_0013185
746 Ga0495580_0001609
747 Ga0495605_0000517
748 Ga0495605_0001173
749 Ga0495605_0009216
750 Ga0495605_0029047
751 Ga0495605_0036997
752 Ga0495605_0040558
753 Ga0495605_0050625
754 Ga0495584_0000083
755 Ga0495584_0000668
756 Ga0495584_0000809
757 Ga0495584_0002102
758 Ga0495584_0006383
759 Ga0495584_0042962
760 Ga0495584_0053909
761 Ga0495585_0001045
762 Ga0495585_0012755
763 Ga0495585_0048360
764 Ga0495594_0006508
765 Ga0495596_0000034
766 Ga0495596_0001548
767 Ga0495596_0005699
768 Ga0495607_0000136
769 Ga0495607_0000584
770 Ga0495607_0000856
771 Ga0495607_0004229
772 Ga0495607_0041443
773 Ga0495583_0000093
774 Ga0495583_0000778
775 Ga0495583_0001424
776 Ga0495583_0001449
777 Ga0495583_0025985
778 Ga0495583_0028515
779 Ga0495606_0001186
780 Ga0495606_0001321
781 Ga0495606_0003164
782 Ga0495606_0003718
783 Ga0495606_0004522
784 Ga0495610_0000852
785 Ga0495610_0001087
786 Ga0495610_0023216
787 Ga0495610_0023522
788 Ga0495610_0027634
789 Ga0495616_0000798
790 Ga0495616_0000844
791 Ga0495616_0002376
792 Ga0495616_0029353
793 Ga0495620_0003956
794 Ga0495620_0004873
795 Ga0495620_0005580
796 Ga0495620_0015169
797 Ga0495630_0265039
798 Ga0495631_0000031
799 Ga0495631_0001952
800 Ga0495632_0000277
801 Ga0495632_0002075
802 Ga0495632_0005254
803 Ga0495632_0021766
804 Ga0495632_0026856
805 Ga0495632_0031599
806 Ga0495637_0000334
807 Ga0495637_0000365
808 Ga0495637_0000716
809 Ga0495637_0004083
810 Ga0495637_0004400
811 Ga0495637_0016590
812 Ga0495643_0000284
813 Ga0495643_0002899
814 Ga0495643_0004168
815 Ga0495643_0007286
816 Ga0495643_0026580
817 Ga0495643_0030453
818 Ga0495644_0000105
819 Ga0495644_0002078
820 Ga0495648_0000318
821 Ga0495648_0000636
822 Ga0495648_0001527
823 Ga0495648_0016341
824 Ga0495648_0021361
825 Ga0495648_0043334
826 Ga0495648_0047359
827 Ga0495666_0027029
828 Ga0495666_0046267
829 Ga0495642_0000024
830 Ga0495654_0000069
831 Ga0495654_0000769
832 Ga0495654_0002032
833 Ga0495654_0006688
834 Ga0495654_0015035
835 Ga0495654_0019859
836 Ga0495609_0000302
837 Ga0495609_0007079
838 Ga0495609_0008567
839 Ga0495621_0022963
840 Ga0495597_0000330
841 Ga0495597_0032009
842 Ga0495622_0001454
843 Ga0495633_0000214
844 Ga0495633_0016777
845 Ga0495656_0017060
846 Ga0495668_0000776
847 Ga0495668_0002790
848 Ga0495668_0120428
849 Ga0495634_0000347
850 Ga0495611_0000067
851 Ga0495611_0000584
852 Ga0495625_0000945
853 Ga0495625_0001743
854 Ga0495625_0001876
855 Ga0495625_0004397
856 Ga0495625_0005051
857 Ga0495625_0009591
858 Ga0495625_0021006
859 Ga0495635_0000210
860 Ga0495659_0000477
861 Ga0495659_0036533
862 Ga0495661_0000468
863 Ga0495661_0002471
864 Ga0495661_0006380
865 Ga0495661_0020507
866 Ga0495661_0034481
867 Ga0495661_0057960
868 Ga0495661_0104288
869 Ga0495646_0001737
870 Ga0495613_0004016
871 Ga0495670_0000151
872 Ga0495670_0003361
873 Ga0495670_0011350
874 Ga0495670_0017375
875 Ga0495670_0045079
876 Ga0495670_0068649
877 Ga0495671_0000061
878 Ga0495671_0000446
879 Ga0495671_0000685
880 Ga0495671_0000854
881 Ga0495671_0000995
882 Ga0495671_0002224
883 Ga0495671_0003322
884 Ga0495671_0006414
885 Ga0495671_0034067
886 Ga0495649_0000154
887 Ga0495649_0002842
888 Ga0495649_0006297
889 Ga0495649_0009553
890 Ga0495649_0021909
891 Ga0495649_0047951
892 Ga0495589_0006162
893 Ga0495589_0006736
894 Ga0495589_0007467
895 Ga0495589_0007960
896 Ga0495589_0022324
897 Ga0495660_0000016
898 Ga0495660_0000153
899 Ga0495660_0000439
900 Ga0495660_0000708
901 Ga0495660_0002469
902 Ga0495660_0007505
903 Ga0495660_0008934
904 Ga0495636_0000366
905 Ga0495672_0000372
906 Ga0495672_0002005
907 Ga0495672_0002052
908 Ga0495672_0003081
909 Ga0495672_0006011
910 Ga0495672_0011879
911 Ga0495672_0012996
912 Ga0495672_0072198
913 Ga0495680_0006234
914 Ga0495683_0000366
915 Ga0495683_0001132
916 Ga0495687_000334
917 Ga0495687_002437
918 Ga0495687_011065
919 Ga0495677_0077679
920 Ga0495679_008083
921 Ga0495679_008659
922 Ga0495679_026316
923 Ga0495673_0000214
924 Ga0495673_0000358
925 Ga0495673_0000624
926 Ga0495673_0000753
927 Ga0495673_0008059
928 Ga0495673_0014369
929 Ga0495673_0017746
930 Ga0495681_0000023
931 Ga0495681_0001164
932 Ga0495681_0001887
933 Ga0495681_0003019
934 Ga0495681_0007225
935 Ga0495681_0009939
936 Ga0495681_0036855
937 Ga0495686_0006014
938 Ga0495686_0006407
939 Ga0495593_0022063
940 Ga0495626_0000388
941 Ga0495626_0003344
942 Ga0495626_0018731
943 Ga0495626_0018981
944 Ga0496102_0000444
945 Ga0496103_0000290
946 Ga0496110_0010902
947 Ga0496110_0093754
948 Ga0496110_0122656
949 Ga0496111_0144724
950 Ga0496112_0004744
951 Ga0496115_0310810
952 Ga0496116_0000394
953 Ga0496116_0015807
954 Ga0496117_0001290
955 Ga0496117_0002386
956 Ga0496117_0008509
957 Ga0496118_0000345
958 Ga0496118_0000491
959 Ga0496118_0005120
960 Ga0496119_0001519
961 Ga0496120_0001414
962 Ga0496121_0045565
963 Ga0496121_0100989
964 Ga0496122_0000810
965 Ga0496123_0001426
966 Ga0496124_0000445
967 Ga0496124_0000586
968 Ga0496124_0005976
969 Ga0496124_0023815
970 Ga0496124_0055745
971 Ga0496125_0006650
972 Ga0496125_0123316
973 Ga0496125_0135593
974 Ga0496126_0074836
975 Ga0496126_0125519
976 Ga0496126_0163896
977 Ga0495678_000008
978 Ga0495678_000091
979 Ga0495678_000796
980 Ga0495678_005908
981 Ga0495678_036314
982 Ga0495682_0000001
983 Ga0495682_0000232
984 Ga0495682_0004381
985 Ga0495682_0004996
986 Ga0495682_0005227
987 Ga0495682_0021218
988 Ga0495682_0022624
989 nmdc:mga00v17_36924_c2
990 nmdc:mga06r32_137996_c1
991 nmdc:mga08y16_182149_c1
992 nmdc:mga08x19_62699_c1
993 Ga0500610_0001871
994 Ga0500583_0014009
995 Ga0500583_0101205
996 Ga0500651_0001730
997 Ga0500569_001156
998 Ga0500594_0000334
999 Ga0500617_021460
1000 Ga0500618_000116
1001 Ga0500621_000002
1002 Ga0500658_0013484
1003 Ga0500659_0004513
1004 Ga0500588_0039879
1005 Ga0500616_0000075
1006 Ga0500634_0000115
1007 Ga0500645_001044
1008 2511134559
1009 2511199531
1010 2511257801
1011 2511268715
1012 2511274084
1013 2511278987
1014 2511304300
1015 2511315630
1016 2511321399
1017 2511337437
1018 2511343740
1019 2511350792
1020 2511353916
1021 2511365653
1022 2511371655
1023 2511381265
1024 2511413029
1025 2511825117
1026 2585397345
1027 2585557967
1028 2585562460
1029 2585906374
1030 2587981796
1031 2599409390
1032 2601643719
1033 2601663543
1034 2601696576
1035 2601701175
1036 2601721600
1037 2601739934
1038 2601750423
1039 2602017676
1040 2603660929
1041 2603666203
1042 2603877016
1043 2606070636
1044 2637225286
1045 2643999125
1046 2644731554
1047 2676406535
1048 2739256935
1049 2743737133
1050 2807176776
1051 2842167806
1052 2842835987
1053 2857567791
1054 2919461246
1055 2923156166
1056 2939573342
1057 2939639879
1058 2945962901

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4q34-assembly1.cif.gz_A-2 crystal structure of a putative esterase (bdi_1566) from parabacteroides distasonis atcc 8503 at 1.60 a resolution 0.7825 34 363
4q34-assembly1.cif.gz_A-2 crystal structure of a putative esterase (bdi_1566) from parabacteroides distasonis atcc 8503 at 1.60 a resolution 0.7805 34 363
8goy-assembly1.cif.gz_B sule p44r 0.7386 36 363
8j7j-assembly1.cif.gz_B crystal structure of sule mutant 0.7378 36 363
8gol-assembly2.cif.gz_D-2 crystal structure of sule 0.7355 36 363
ID Description Score Start End Superfamily
4q34A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7804 34 363 3.40.50.1820
4q34A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7781 34 363 3.40.50.1820
af_Q54CZ7_58_483_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.7196 191 238 3.80.10.10
af_Q9N366_39_241_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7084 76 358 3.40.50.1820
af_A0A1D6PID0_113_313_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.678 39 237 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A1I2SIP9-F1-model_v4 Uncharacterized protein 0.9601 256 363
AF-A0A645F360-F1-model_v4 Alpha/beta hydrolase 0.9589 272 363
AF-K1T2T6-F1-model_v4 Dienelactone hydrolase domain-containing protein 0.9583 227 362
AF-A0A660NMW4-F1-model_v4 Alpha/beta hydrolase 0.952 212 363 GO:0016787
AF-A0A4Q6CMV8-F1-model_v4 Alpha/beta hydrolase 0.9518 267 363

Map