F460002

General Info

Members Datasets Scaffolds Average Seq Length
530 317 488 435

Family's Representative Sequence

Representative Sequence 3300046507|Ga0495606_0045733|Ga0495606_0045733_1018_2577
Length 508
Sequence MALRHFGAAAAVAIAVGMTASPALATTEIQWWHAMTGANNDVIVKLANDFNASQSDYKVIPTYKGSYPDTMNAGIAAFRAGNAPHIMQVFEVGTATMMAATGAVKPVYKLMADAGEKFDPKNYLSAITGYYSTSKGEMLSFPFNSSSTVMWVNLDELKKVNAEIPKTWPEVFEVAKKLHDNGHPTCGFSNSAWHNVPLASKANGLDGFDTKLEFNAPLQEKHLEKLVELQKDKTYDYAGRTNQGEGRFTSGECAIYLTSSAFFGNVKAQAKFNFTAVPMPYYPDVKGAPQNSIIGGASLWVMGGKSADEYKGVAKFLTFLSDTDRQVYIHKASGYLPITKAAYEKAKAEGFYKDQPYLETPLIELTNKEPTDNSRGLRLGNMVQLRDVWAEEIEQALAGKKTAKQALEASVERGNTMLRQFEKTAVKYGEGAGGRTISGPPAPPHHAKASDFPIKAAAVRAGCAATRDCSDFLLLAGRAGRHPVLPAAGRFRPLDELRLVRELRRAVQ

Samples

Sample ID Description Type Environment
1 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
2 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
3 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
4 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
5 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
6 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
7 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
8 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
9 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
10 2643221651 Afipia sp. Root123D2 Isolate Unclassified
11 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
12 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
13 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
14 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
15 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
16 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
17 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
18 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
19 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
20 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
21 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
22 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
23 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
24 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
25 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
26 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
27 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
28 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
29 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
30 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
31 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
32 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
33 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
34 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
35 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
36 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
37 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
38 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
39 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
40 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
41 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
42 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
43 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
44 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
45 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
46 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
47 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
48 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
49 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
50 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
51 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
52 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
53 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
54 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
55 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
56 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
57 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
58 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
59 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
60 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
61 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
62 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
63 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
66 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
67 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
68 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
69 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
70 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
71 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
72 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
73 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
74 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
75 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
80 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
81 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
82 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
83 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
84 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
85 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
86 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
87 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
88 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
89 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
90 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
91 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
92 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
93 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
100 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
129 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
131 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
191 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
192 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
193 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
194 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
199 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
200 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
201 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
202 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
203 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
204 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
205 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
206 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
207 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
208 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
209 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
210 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
213 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
214 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
215 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
216 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
217 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
218 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
219 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
220 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
221 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
222 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
223 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
224 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
225 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
226 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
227 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
228 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
229 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
230 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
231 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
232 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
233 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
234 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
235 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
236 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
237 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
238 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
239 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
240 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
241 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
242 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
243 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
244 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
245 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
246 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
247 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
248 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
249 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
250 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
251 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
252 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
253 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
254 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
255 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
256 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
257 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
258 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
259 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
260 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
261 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
262 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
263 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
264 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
265 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
266 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
267 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
268 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
269 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
270 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
285 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
286 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
287 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
288 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
289 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
290 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
291 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
292 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
293 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
294 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
295 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
298 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
299 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
300 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
301 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
302 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
303 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
304 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
305 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
306 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
307 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
308 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
309 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
310 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
311 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
312 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
313 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
314 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
315 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
316 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
317 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.6
Metatranscriptomes 0
Isolates 7.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.6
Nodule 7.36
Rhizoplane 3.96
Rhizosphere 78.3
Stem 0
Stem Tuber 0
Unclassified 3.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10039738 3300001989 Bacteria 1574
2 JGI24735J21928_10013429 3300002067 Bacteria 2575
3 JGI25153J46596_10007816 3300003215 Bacteria 5195
4 JGI25153J46596_10007902 3300003215 Bacteria 5161
5 JGI25153J46596_10010396 3300003215 Bacteria 4212
6 JGI25153J46596_10017295 3300003215 Bacteria 2845
7 JGI25160J50197_1010795 3300003354 Bacteria 3281
8 Ga0055542_1006636 3300003762 Bacteria 2450
9 Ga0055536_1006610 3300003781 Bacteria 5353
10 Ga0055536_1006721 3300003781 Bacteria 5283
11 Ga0055531_10004770 3300003794 Bacteria 8103
12 Ga0065712_10015671 3300005290 Bacteria 2077
13 Ga0065715_10133360 3300005293 Bacteria 1974
14 Ga0070658_10035380 3300005327 Bacteria 4022
15 Ga0070658_10064977 3300005327 Bacteria 2977
16 Ga0070683_100008196 3300005329 Bacteria 8875
17 Ga0070683_100058369 3300005329 Bacteria 3585
18 Ga0070683_100066845 3300005329 Bacteria 3348
19 Ga0070670_100003522 3300005331 Bacteria 13011
20 Ga0070670_100009835 3300005331 Bacteria 8170
21 Ga0070670_100081131 3300005331 Bacteria 2787
22 Ga0068869_100001725 3300005334 Bacteria 13059
23 Ga0070666_10040404 3300005335 Bacteria 3113
24 Ga0070660_100002704 3300005339 Bacteria 12173
25 Ga0070660_100100462 3300005339 Bacteria 2291
26 Ga0070661_100001413 3300005344 Bacteria 16755
27 Ga0070661_100017823 3300005344 Bacteria 5040
28 Ga0070668_100013749 3300005347 Bacteria 6045
29 Ga0070668_100132856 3300005347 Bacteria 1999
30 Ga0070668_100133201 3300005347 Bacteria 1996
31 Ga0070669_100029674 3300005353 Bacteria 3944
32 Ga0070669_100176757 3300005353 Bacteria 1668
33 Ga0070675_100022720 3300005354 Bacteria 5011
34 Ga0070675_100060283 3300005354 Bacteria 3133
35 Ga0070671_100007541 3300005355 Bacteria 8699
36 Ga0070673_100021366 3300005364 Bacteria 4691
37 Ga0070688_100064519 3300005365 Bacteria 2324
38 Ga0070659_100018465 3300005366 Bacteria 5263
39 Ga0070709_10002152 3300005434 Bacteria 10666
40 Ga0070709_10004534 3300005434 Bacteria 7496
41 Ga0070714_100013143 3300005435 Bacteria 6629
42 Ga0070713_100000045 3300005436 Bacteria 77398
43 Ga0070713_100021807 3300005436 Bacteria 4937
44 Ga0070710_10051082 3300005437 Bacteria 2320
45 Ga0070711_100016348 3300005439 Bacteria 4711
46 Ga0070711_100030366 3300005439 Bacteria 3576
47 Ga0070663_100091220 3300005455 Bacteria 2257
48 Ga0070663_100131112 3300005455 Bacteria 1903
49 Ga0070678_100023376 3300005456 Bacteria 4118
50 Ga0070662_100070087 3300005457 Bacteria 2582
51 Ga0070662_100084286 3300005457 Bacteria 2374
52 Ga0070681_10041429 3300005458 Bacteria 4615
53 Ga0070681_10047103 3300005458 Bacteria 4309
54 Ga0068867_100027466 3300005459 Bacteria 4091
55 Ga0070706_100025322 3300005467 Bacteria 5460
56 Ga0070706_100065313 3300005467 Bacteria 3365
57 Ga0070706_100129477 3300005467 Bacteria 2355
58 Ga0070707_100072841 3300005468 Bacteria 3312
59 Ga0070698_100075213 3300005471 Bacteria 3382
60 Ga0070679_100030656 3300005530 Bacteria 5311
61 Ga0070679_100034699 3300005530 Bacteria 5001
62 Ga0068853_100103852 3300005539 Bacteria 2516
63 Ga0070672_100052703 3300005543 Bacteria 3177
64 Ga0070672_100054150 3300005543 Bacteria 3140
65 Ga0070665_100150070 3300005548 Bacteria 2333
66 Ga0068855_100051723 3300005563 Bacteria 4839
67 Ga0068855_100072739 3300005563 Bacteria 3995
68 Ga0068855_100110816 3300005563 Bacteria 3150
69 Ga0068855_100168338 3300005563 Bacteria 2482
70 Ga0070664_100003038 3300005564 Bacteria 13572
71 Ga0070664_100102378 3300005564 Bacteria 2492
72 Ga0068857_100000810 3300005577 Bacteria 23378
73 Ga0068857_100002261 3300005577 Bacteria 15660
74 Ga0068854_100069318 3300005578 Bacteria 2574
75 Ga0068856_100014288 3300005614 Bacteria 7678
76 Ga0068856_100075629 3300005614 Bacteria 3336
77 Ga0068852_100001129 3300005616 Bacteria 17663
78 Ga0068859_100000466 3300005617 Bacteria 40002
79 Ga0068859_100225633 3300005617 Bacteria 1961
80 Ga0068864_100001455 3300005618 Bacteria 19514
81 Ga0068864_100023418 3300005618 Bacteria 5185
82 Ga0068864_100042872 3300005618 Bacteria 3873
83 Ga0068864_100170161 3300005618 Bacteria 1986
84 Ga0068861_100011143 3300005719 Bacteria 6242
85 Ga0068861_100031998 3300005719 Bacteria 3869
86 Ga0068861_100045614 3300005719 Bacteria 3302
87 Ga0068851_10002809 3300005834 Bacteria 7676
88 Ga0068851_10039586 3300005834 Bacteria 2367
89 Ga0068863_100000829 3300005841 Bacteria 31008
90 Ga0068863_100028656 3300005841 Bacteria 5316
91 Ga0068858_100000624 3300005842 Bacteria 36860
92 Ga0068858_100025937 3300005842 Bacteria 5450
93 Ga0068860_100000782 3300005843 Bacteria 35765
94 Ga0068862_100007370 3300005844 Bacteria 9127
95 Ga0068862_100046933 3300005844 Bacteria 3685
96 Ga0081455_10050878 3300005937 Bacteria 3558
97 Ga0081540_1004334 3300005983 Bacteria 10871
98 Ga0081540_1018763 3300005983 Bacteria 4229
99 Ga0081540_1024850 3300005983 Bacteria 3465
100 Ga0081539_10012946 3300005985 Bacteria 6345
101 Ga0081539_10073239 3300005985 Bacteria 1828
102 Ga0070717_10190093 3300006028 Bacteria 1794
103 Ga0070716_100129097 3300006173 Bacteria 1595
104 Ga0070712_100152497 3300006175 Bacteria 1776
105 Ga0097621_100047547 3300006237 Bacteria 3478
106 Ga0097621_100104056 3300006237 Bacteria 2392
107 Ga0075370_10021464 3300006353 Bacteria 3537
108 Ga0075434_100073727 3300006871 Bacteria 3406
109 Ga0068865_100138541 3300006881 Bacteria 1832
110 Ga0097620_100000466 3300006931 Bacteria 40002
111 Ga0097620_100225639 3300006931 Bacteria 1961
112 Ga0099822_1004364 3300006943 Bacteria 18407
113 Ga0099823_1009115 3300006944 Bacteria 10076
114 Ga0105240_10001807 3300009093 Bacteria 36004
115 Ga0105240_10013166 3300009093 Bacteria 11377
116 Ga0105240_10056620 3300009093 Bacteria 4905
117 Ga0111539_10104860 3300009094 Bacteria 3317
118 Ga0105245_10122043 3300009098 Bacteria 2435
119 Ga0105245_10157120 3300009098 Bacteria 2155
120 Ga0105247_10094955 3300009101 Bacteria 1898
121 Ga0105243_10090220 3300009148 Bacteria 2522
122 Ga0105242_10040904 3300009176 Bacteria 3736
123 Ga0105242_10128297 3300009176 Bacteria 2186
124 Ga0105248_10000736 3300009177 Bacteria 36816
125 Ga0105248_10019836 3300009177 Bacteria 7446
126 Ga0105237_10030893 3300009545 Bacteria 5435
127 Ga0105237_10047164 3300009545 Bacteria 4332
128 Ga0105237_10192243 3300009545 Bacteria 2040
129 Ga0105238_10001317 3300009551 Bacteria 24891
130 Ga0105239_10218890 3300010375 Bacteria 2135
131 Ga0157371_10030019 3300013102 Bacteria 3924
132 Ga0157371_10060192 3300013102 Bacteria 2693
133 Ga0157370_10025696 3300013104 Bacteria 5827
134 Ga0157370_10079448 3300013104 Bacteria 3089
135 Ga0157369_10026262 3300013105 Bacteria 6462
136 Ga0157369_10028351 3300013105 Bacteria 6197
137 Ga0157369_10075412 3300013105 Bacteria 3617
138 Ga0157374_10059243 3300013296 Bacteria 3579
139 Ga0157378_10028724 3300013297 Bacteria 4910
140 Ga0157378_10234577 3300013297 Bacteria 1750
141 Ga0163162_10107477 3300013306 Bacteria 2886
142 Ga0163162_10114095 3300013306 Bacteria 2801
143 Ga0163162_10176752 3300013306 Bacteria 2260
144 Ga0157372_10062406 3300013307 Bacteria 4175
145 Ga0157372_10101310 3300013307 Bacteria 3287
146 Ga0157375_10004326 3300013308 Bacteria 12329
147 Ga0157375_10041140 3300013308 Bacteria 4460
148 Ga0157375_10135677 3300013308 Bacteria 2584
149 Ga0163163_10129302 3300014325 Bacteria 2565
150 Ga0163163_10171872 3300014325 Bacteria 2214
151 Ga0163163_10210410 3300014325 Bacteria 1994
152 Ga0157380_10030766 3300014326 Bacteria 4114
153 Ga0157380_10227029 3300014326 Bacteria 1674
154 Ga0157379_10000233 3300014968 Bacteria 43500
155 Ga0157379_10069172 3300014968 Bacteria 3157
156 Ga0157379_10180524 3300014968 Bacteria 1907
157 Ga0157376_10162542 3300014969 Bacteria 2026
158 Ga0163161_10070747 3300017792 Bacteria 2551
159 Ga0209677_104912 3300025253 Bacteria 3658
160 Ga0209148_1000308 3300025254 Bacteria 70131
161 Ga0209676_1000097 3300025292 Bacteria 237203
162 Ga0209564_1007252 3300025295 Bacteria 5764
163 Ga0209564_1009228 3300025295 Bacteria 4728
164 Ga0209758_1000443 3300025297 Bacteria 69228
165 Ga0209758_1000546 3300025297 Bacteria 59757
166 Ga0209758_1004610 3300025297 Bacteria 11323
167 Ga0209758_1008688 3300025297 Bacteria 6503
168 Ga0209758_1013471 3300025297 Bacteria 4453
169 Ga0209256_1002930 3300025299 Bacteria 12820
170 Ga0207426_1007996 3300025302 Bacteria 4344
171 Ga0209257_1001004 3300025304 Bacteria 38186
172 Ga0209257_1015484 3300025304 Bacteria 3170
173 Ga0207697_10000068 3300025315 Bacteria 44303
174 Ga0207656_10008744 3300025321 Bacteria 3741
175 Ga0207656_10042997 3300025321 Bacteria 1925
176 Ga0207682_10000097 3300025893 Bacteria 39655
177 Ga0207682_10000266 3300025893 Bacteria 23550
178 Ga0207642_10031724 3300025899 Bacteria 2217
179 Ga0207642_10088050 3300025899 Bacteria 1526
180 Ga0207710_10020950 3300025900 Bacteria 2799
181 Ga0207688_10105033 3300025901 Bacteria 1635
182 Ga0207680_10042685 3300025903 Bacteria 2655
183 Ga0207647_10023452 3300025904 Bacteria 4080
184 Ga0207699_10001846 3300025906 Bacteria 9967
185 Ga0207699_10091799 3300025906 Bacteria 1907
186 Ga0207645_10004546 3300025907 Bacteria 10248
187 Ga0207645_10022990 3300025907 Bacteria 4051
188 Ga0207645_10023460 3300025907 Bacteria 4010
189 Ga0207643_10010998 3300025908 Bacteria 4884
190 Ga0207643_10015498 3300025908 Bacteria 4149
191 Ga0207705_10060071 3300025909 Bacteria 2745
192 Ga0207684_10009875 3300025910 Bacteria 8418
193 Ga0207684_10060801 3300025910 Bacteria 3209
194 Ga0207684_10117214 3300025910 Bacteria 2282
195 Ga0207654_10023650 3300025911 Bacteria 3294
196 Ga0207707_10015977 3300025912 Bacteria 6546
197 Ga0207695_10000107 3300025913 Bacteria 252606
198 Ga0207695_10054785 3300025913 Bacteria 4161
199 Ga0207695_10187513 3300025913 Bacteria 1987
200 Ga0207695_10338442 3300025913 Bacteria 1393
201 Ga0207671_10006765 3300025914 Bacteria 10136
202 Ga0207671_10167552 3300025914 Bacteria 1704
203 Ga0207693_10019351 3300025915 Bacteria 5417
204 Ga0207693_10067049 3300025915 Bacteria 2810
205 Ga0207693_10236362 3300025915 Bacteria 1435
206 Ga0207663_10007451 3300025916 Bacteria 5675
207 Ga0207657_10021865 3300025919 Bacteria 6007
208 Ga0207657_10094822 3300025919 Bacteria 2484
209 Ga0207657_10104246 3300025919 Bacteria 2350
210 Ga0207652_10212846 3300025921 Bacteria 1741
211 Ga0207646_10018727 3300025922 Bacteria 6453
212 Ga0207681_10095540 3300025923 Bacteria 2132
213 Ga0207694_10003964 3300025924 Bacteria 11677
214 Ga0207694_10074789 3300025924 Bacteria 2651
215 Ga0207694_10108133 3300025924 Bacteria 2209
216 Ga0207650_10008850 3300025925 Bacteria 6879
217 Ga0207650_10026884 3300025925 Bacteria 4111
218 Ga0207650_10034291 3300025925 Bacteria 3680
219 Ga0207650_10046657 3300025925 Bacteria 3191
220 Ga0207659_10037471 3300025926 Bacteria 3367
221 Ga0207659_10043335 3300025926 Bacteria 3160
222 Ga0207659_10103169 3300025926 Bacteria 2154
223 Ga0207687_10072474 3300025927 Bacteria 2464
224 Ga0207687_10145749 3300025927 Bacteria 1801
225 Ga0207700_10000051 3300025928 Bacteria 77057
226 Ga0207700_10013199 3300025928 Bacteria 5365
227 Ga0207700_10017262 3300025928 Bacteria 4817
228 Ga0207664_10033510 3300025929 Bacteria 3947
229 Ga0207690_10026056 3300025932 Bacteria 3680
230 Ga0207706_10033238 3300025933 Bacteria 4591
231 Ga0207706_10070833 3300025933 Bacteria 3067
232 Ga0207706_10076316 3300025933 Bacteria 2947
233 Ga0207706_10118076 3300025933 Bacteria 2333
234 Ga0207706_10236260 3300025933 Bacteria 1598
235 Ga0207686_10123188 3300025934 Bacteria 1767
236 Ga0207670_10057680 3300025936 Bacteria 2634
237 Ga0207669_10018077 3300025937 Bacteria 3633
238 Ga0207704_10030438 3300025938 Bacteria 3026
239 Ga0207704_10132220 3300025938 Bacteria 1730
240 Ga0207704_10142158 3300025938 Bacteria 1680
241 Ga0207665_10080351 3300025939 Bacteria 2243
242 Ga0207665_10150052 3300025939 Bacteria 1669
243 Ga0207665_10187602 3300025939 Bacteria 1501
244 Ga0207691_10000331 3300025940 Bacteria 47246
245 Ga0207691_10002783 3300025940 Bacteria 17058
246 Ga0207691_10025670 3300025940 Bacteria 5529
247 Ga0207711_10010140 3300025941 Bacteria 7824
248 Ga0207711_10016463 3300025941 Bacteria 6143
249 Ga0207689_10000310 3300025942 Bacteria 44928
250 Ga0207689_10028706 3300025942 Bacteria 4653
251 Ga0207689_10176957 3300025942 Bacteria 1759
252 Ga0207661_10005122 3300025944 Bacteria 9203
253 Ga0207661_10008755 3300025944 Bacteria 7239
254 Ga0207661_10173181 3300025944 Bacteria 1880
255 Ga0207679_10013209 3300025945 Bacteria 5410
256 Ga0207679_10071933 3300025945 Bacteria 2610
257 Ga0207679_10093421 3300025945 Bacteria 2333
258 Ga0207667_10010866 3300025949 Bacteria 10616
259 Ga0207667_10033168 3300025949 Bacteria 5555
260 Ga0207667_10157991 3300025949 Bacteria 2333
261 Ga0207667_10159374 3300025949 Bacteria 2321
262 Ga0207667_10283852 3300025949 Bacteria 1692
263 Ga0207651_10033592 3300025960 Bacteria 3310
264 Ga0207651_10064308 3300025960 Bacteria 2567
265 Ga0207668_10004867 3300025972 Bacteria 7905
266 Ga0207640_10052873 3300025981 Bacteria 2648
267 Ga0207640_10078096 3300025981 Bacteria 2252
268 Ga0207658_10000650 3300025986 Bacteria 30420
269 Ga0207658_10095301 3300025986 Bacteria 2318
270 Ga0207703_10000443 3300026035 Bacteria 43710
271 Ga0207703_10064385 3300026035 Bacteria 3009
272 Ga0207703_10086720 3300026035 Bacteria 2623
273 Ga0207703_10103230 3300026035 Bacteria 2420
274 Ga0207639_10176445 3300026041 Bacteria 1814
275 Ga0207678_10002621 3300026067 Bacteria 16388
276 Ga0207678_10050007 3300026067 Bacteria 3612
277 Ga0207708_10006748 3300026075 Bacteria 8492
278 Ga0207702_10003982 3300026078 Bacteria 13259
279 Ga0207702_10018926 3300026078 Bacteria 5697
280 Ga0207702_10186150 3300026078 Bacteria 1915
281 Ga0207641_10001097 3300026088 Bacteria 27224
282 Ga0207641_10004409 3300026088 Bacteria 12196
283 Ga0207648_10003029 3300026089 Bacteria 17753
284 Ga0207648_10003723 3300026089 Bacteria 15960
285 Ga0207648_10061587 3300026089 Bacteria 3272
286 Ga0207648_10193386 3300026089 Bacteria 1804
287 Ga0207676_10000995 3300026095 Bacteria 21861
288 Ga0207674_10000418 3300026116 Bacteria 55342
289 Ga0207674_10071635 3300026116 Bacteria 3482
290 Ga0207675_100000726 3300026118 Bacteria 32704
291 Ga0207675_100001605 3300026118 Bacteria 22659
292 Ga0207675_100022891 3300026118 Bacteria 5812
293 Ga0207675_100025019 3300026118 Bacteria 5556
294 Ga0207675_100221489 3300026118 Bacteria 1823
295 Ga0207683_10000276 3300026121 Bacteria 45906
296 Ga0207683_10058191 3300026121 Bacteria 3393
297 Ga0207698_10020906 3300026142 Bacteria 4516
298 Ga0207698_10052986 3300026142 Bacteria 3111
299 Ga0209389_1000153 3300027296 Bacteria 58606
300 Ga0209389_1000344 3300027296 Bacteria 28211
301 Ga0209589_1000032 3300027357 Bacteria 141881
302 Ga0209589_1000046 3300027357 Bacteria 118780
303 Ga0209489_100106 3300027361 Bacteria 118780
304 Ga0209489_100936 3300027361 Bacteria 58586
305 Ga0209489_102825 3300027361 Bacteria 34712
306 Ga0209700_100011 3300027363 Bacteria 362159
307 Ga0209700_100105 3300027363 Bacteria 118780
308 Ga0209971_1002480 3300027682 Bacteria 4434
309 Ga0268266_10235284 3300028379 Bacteria 1689
310 Ga0268265_10019896 3300028380 Bacteria 4675
311 Ga0268265_10173167 3300028380 Bacteria 1847
312 Ga0268265_10187123 3300028380 Bacteria 1785
313 Ga0268264_10000566 3300028381 Bacteria 45480
314 Ga0265339_10090003 3300031249 Bacteria 1610
315 Ga0307510_10066110 3300033180 Bacteria 3654
316 Ga0315911_1000013 3300033442 Bacteria 239334
317 Ga0373926_0022812 3300035083 Bacteria 2172
318 Ga0373944_0009550 3300035089 Bacteria 2633
319 Ga0373945_0005059 3300035116 Bacteria 4202
320 Ga0373953_0036137 3300035117 Bacteria 1944
321 Ga0373956_0032778 3300035119 Bacteria 2281
322 Ga0373955_0087051 3300035172 Bacteria 1775
323 Ga0373935_0010225 3300035692 Bacteria 5622
324 Ga0373927_0028242 3300035695 Bacteria 3659
325 Ga0373927_0028563 3300035695 Bacteria 3639
326 Ga0373947_0006308 3300035725 Bacteria 6892
327 Ga0373937_0015351 3300036401 Bacteria 6774
328 Ga0373937_0104963 3300036401 Bacteria 2625
329 Ga0373925_0046505 3300037068 Bacteria 3227
330 Ga0373925_0114575 3300037068 Bacteria 2087
331 Ga0395899_0003854 3300037312 Bacteria 11827
332 Ga0395900_0007892 3300037418 Bacteria 10962
333 Ga0395900_0143158 3300037418 Bacteria 2447
334 Ga0395905_0195793 3300037471 Bacteria 1895
335 Ga0395905_0486770 3300037471 Bacteria 1133
336 Ga0436364_0059646 3300037853 Bacteria 4718
337 Ga0242420_006119 3300038996 Bacteria 1892
338 Ga0436365_0097731 3300039437 Bacteria 2358
339 Ga0451577_0034575 3300042876 Bacteria 4556
340 Ga0466972_0001405 3300044658 Bacteria 11669
341 Ga0466972_0005312 3300044658 Bacteria 6449
342 Ga0466972_0034717 3300044658 Bacteria 2469
343 Ga0466966_0000209 3300044684 Bacteria 39062
344 Ga0466961_0000110 3300044693 Bacteria 54241
345 Ga0466968_0042359 3300044735 Bacteria 1925
346 Ga0466968_0095111 3300044735 Bacteria 1325
347 Ga0466970_0004728 3300044765 Bacteria 6727
348 Ga0466959_0007187 3300045049 Bacteria 7798
349 Ga0466959_0189675 3300045049 Bacteria 1435
350 Ga0451576_0000030 3300045051 Bacteria 403352
351 Ga0451576_0057362 3300045051 Bacteria 4071
352 Ga0466967_0037924 3300045976 Bacteria 4129
353 Ga0495629_0017962 3300046459 Bacteria 5070
354 Ga0495638_0008749 3300046460 Bacteria 7152
355 Ga0495580_0132900 3300046472 Bacteria 1725
356 Ga0495664_0031902 3300046477 Bacteria 3089
357 Ga0495585_0067208 3300046492 Bacteria 1961
358 Ga0495594_0052304 3300046499 Bacteria 2249
359 Ga0495606_0028489 3300046507 Bacteria 3940
360 Ga0495606_0045733 3300046507 Bacteria 2898
361 Ga0495608_0027653 3300046511 Bacteria 3858
362 Ga0495652_0015898 3300046529 Bacteria 6736
363 Ga0495640_0008874 3300046533 Bacteria 7855
364 Ga0495640_0021916 3300046533 Bacteria 4680
365 Ga0495598_0023593 3300046537 Bacteria 1659
366 Ga0495667_0046711 3300046559 Bacteria 2862
367 Ga0495634_0059320 3300046642 Bacteria 2549
368 Ga0495635_0018265 3300046663 Bacteria 4895
369 Ga0495657_0105491 3300046675 Bacteria 1790
370 Ga0495623_0017667 3300046679 Bacteria 4607
371 Ga0495646_0055703 3300046680 Bacteria 2373
372 Ga0495647_0014535 3300046681 Bacteria 2744
373 Ga0495624_0030288 3300046690 Bacteria 3526
374 Ga0495600_0003817 3300046809 Bacteria 8926
375 Ga0495581_0035160 3300047315 Bacteria 2899
376 Ga0495581_0046456 3300047315 Bacteria 2509
377 Ga0495604_0001495 3300047317 Bacteria 19268
378 Ga0495674_0021283 3300047319 Bacteria 5999
379 Ga0495676_0013624 3300047321 Bacteria 7299
380 Ga0495676_0030025 3300047321 Bacteria 4621
381 Ga0495680_0005483 3300047322 Bacteria 11927
382 Ga0495687_011481 3300047443 Bacteria 4757
383 Ga0495673_0037214 3300047469 Bacteria 2225
384 Ga0495684_0011086 3300047471 Bacteria 6968
385 Ga0495684_0042187 3300047471 Bacteria 3495
386 Ga0495602_0026445 3300048088 Bacteria 5596
387 Ga0495602_0059103 3300048088 Bacteria 3350
388 Ga0496102_0214140 3300048905 Bacteria 1816
389 Ga0496102_0298911 3300048905 Bacteria 1517
390 Ga0496103_0179003 3300048906 Bacteria 1362
391 Ga0496104_0001082 3300048907 Bacteria 23263
392 Ga0496105_0001148 3300048908 Bacteria 18448
393 Ga0496105_0122539 3300048908 Bacteria 2143
394 Ga0496106_0098985 3300048909 Bacteria 2260
395 Ga0496108_0001659 3300048911 Bacteria 17640
396 Ga0496108_0134264 3300048911 Bacteria 2128
397 Ga0496108_0290552 3300048911 Bacteria 1423
398 Ga0496109_0052621 3300048912 Bacteria 3712
399 Ga0496109_0100702 3300048912 Bacteria 2681
400 Ga0496109_0392296 3300048912 Bacteria 1312
401 Ga0496110_0008384 3300048913 Bacteria 8314
402 Ga0496111_0083719 3300048914 Bacteria 2331
403 Ga0496112_0000896 3300048915 Bacteria 21449
404 Ga0496112_0002790 3300048915 Bacteria 14183
405 Ga0496112_0145404 3300048915 Bacteria 2339
406 Ga0496113_0000418 3300048916 Bacteria 20649
407 Ga0496115_0001613 3300048918 Bacteria 16216
408 Ga0496120_0066413 3300048923 Bacteria 1995
409 Ga0496126_0014893 3300048929 Bacteria 7842
410 Ga0496126_0025590 3300048929 Bacteria 5673
411 Ga0496126_0078616 3300048929 Bacteria 2922
412 Ga0501031_0000890 3300049568 Bacteria 18010
413 Ga0501031_0022980 3300049568 Bacteria 4066
414 Ga0501032_0000372 3300049569 Bacteria 37150
415 Ga0501032_0029900 3300049569 Bacteria 3736
416 Ga0501032_0064130 3300049569 Bacteria 2459
417 Ga0501033_0000824 3300049570 Bacteria 28287
418 Ga0501033_0028686 3300049570 Bacteria 4182
419 Ga0501033_0040171 3300049570 Bacteria 3493
420 Ga0501033_0057360 3300049570 Bacteria 2878
421 Ga0501033_0148121 3300049570 Bacteria 1694
422 Ga0501033_0214414 3300049570 Bacteria 1372
423 Ga0501034_0000058 3300049571 Bacteria 198554
424 Ga0501034_0128684 3300049571 Bacteria 2516
425 Ga0501036_0000691 3300049572 Bacteria 24907
426 Ga0501037_0001344 3300049573 Bacteria 18059
427 Ga0501038_0000913 3300049574 Bacteria 26199
428 Ga0501038_0008489 3300049574 Bacteria 9444
429 Ga0501039_0051531 3300049575 Bacteria 3185
430 Ga0501039_0156239 3300049575 Bacteria 1792
431 Ga0501040_0005144 3300049576 Bacteria 8461
432 Ga0501042_0066098 3300049578 Bacteria 2584
433 Ga0501043_0000444 3300049579 Bacteria 37193
434 Ga0501043_0012190 3300049579 Bacteria 6719
435 Ga0501043_0051609 3300049579 Bacteria 3231
436 Ga0501043_0125244 3300049579 Bacteria 2014
437 Ga0501046_0029707 3300049580 Bacteria 4442
438 Ga0501047_0000022 3300049581 Bacteria 249062
439 Ga0501047_0025198 3300049581 Bacteria 5715
440 Ga0501047_0042186 3300049581 Bacteria 4409
441 Ga0501047_0045096 3300049581 Bacteria 4262
442 Ga0501048_0000041 3300049582 Bacteria 62410
443 Ga0501067_0000764 3300049583 Bacteria 17325
444 Ga0501067_0001148 3300049583 Bacteria 14356
445 Ga0501068_0000547 3300049584 Bacteria 19075
446 Ga0501068_0071266 3300049584 Bacteria 2121
447 Ga0501069_0043422 3300049585 Bacteria 2488
448 Ga0501070_0004220 3300049586 Bacteria 12353
449 Ga0501070_0112532 3300049586 Bacteria 2249
450 Ga0501070_0134828 3300049586 Bacteria 2039
451 Ga0501072_0003399 3300049588 Bacteria 11979
452 Ga0501072_0214004 3300049588 Bacteria 1536
453 Ga0501073_0000504 3300049589 Bacteria 27300
454 Ga0501074_0000028 3300049590 Bacteria 67595
455 Ga0501074_0000683 3300049590 Bacteria 21201
456 Ga0501077_0075177 3300049593 Bacteria 2139
457 Ga0501079_0002860 3300049741 Bacteria 12589
458 Ga0501079_0083613 3300049741 Bacteria 2469
459 Ga0501080_0012339 3300049742 Bacteria 7830
460 Ga0501083_0001349 3300049744 Bacteria 16655
461 Ga0501035_0001113 3300049822 Bacteria 28138
462 Ga0501035_0015011 3300049822 Bacteria 7149
463 Ga0501035_0098467 3300049822 Bacteria 2567
464 Ga0501035_0146725 3300049822 Bacteria 2048
465 Ga0501044_0000370 3300049823 Bacteria 56259
466 Ga0501044_0024557 3300049823 Bacteria 6395
467 Ga0501044_0239790 3300049823 Bacteria 1757
468 Ga0501045_0006116 3300049824 Bacteria 8336
469 Ga0501045_0014542 3300049824 Bacteria 5579
470 nmdc:mga0yw44_57675_c1 3300050492 Bacteria 2370
471 nmdc:mga0k408_32699_c1 3300050493 Bacteria 2971
472 nmdc:mga0k408_75484_c1 3300050493 Bacteria 1970
473 nmdc:mga05p37_163289_c1 3300050507 Bacteria 2719
474 nmdc:mga08y16_50025_c1 3300050511 Bacteria 4373
475 Ga0495601_0079609 3300053077 Bacteria 2101
476 Ga0500643_000049 3300053087 Bacteria 147107
477 Ga0500557_000192 3300053105 Bacteria 10407
478 Ga0500642_0000056 3300053130 Bacteria 67746
479 Ga0500559_0046016 3300053136 Bacteria 1912
480 Ga0500616_0024201 3300053153 Bacteria 3377
481 Ga0500636_0002629 3300053177 Bacteria 9982
482 Ga0500636_0014012 3300053177 Bacteria 4713
483 Ga0500601_003890 3300053737 Bacteria 1623
484 Ga0501084_0007133 3300054114 Bacteria 9204
485 Ga0501084_0055837 3300054114 Bacteria 3304
486 Ga0501082_0000101 3300060353 Bacteria 66608
487 Ga0501082_0013595 3300060353 Bacteria 6994
488 Ga0501082_0057571 3300060353 Bacteria 3348

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_0486770 Ga0395905_0486770_13_1122 360
2 3300049570 Ga0501033_0148121 Ga0501033_0148121_573_1682 360
3 3300025949 Ga0207667_10283852 Ga0207667_102838521 366
4 iso_pu_bacteria 2885374607 2885377939 392
5 3300044735 Ga0466968_0095111 Ga0466968_0095111_91_1305 396
6 iso_pu_bacteria 2906610324 2906613753 401
7 3300050493 nmdc:mga0k408_32699_c1 nmdc:mga0k408_32699_c1_453_1766 405
8 3300025942 Ga0207689_10176957 Ga0207689_101769571 407
9 3300025972 Ga0207668_10004867 Ga0207668_100048674 407
10 3300005353 Ga0070669_100176757 Ga0070669_1001767572 408
11 3300005354 Ga0070675_100022720 Ga0070675_1000227203 408
12 3300005618 Ga0068864_100042872 Ga0068864_1000428722 408
13 3300005834 Ga0068851_10002809 Ga0068851_100028094 408
14 3300006237 Ga0097621_100047547 Ga0097621_1000475473 408
15 3300014969 Ga0157376_10162542 Ga0157376_101625422 408
16 3300025893 Ga0207682_10000097 Ga0207682_1000009737 408
17 3300025907 Ga0207645_10022990 Ga0207645_100229901 408
18 3300025908 Ga0207643_10015498 Ga0207643_100154982 408
19 3300025926 Ga0207659_10103169 Ga0207659_101031692 408
20 3300025940 Ga0207691_10000331 Ga0207691_1000033137 408
21 3300025986 Ga0207658_10095301 Ga0207658_100953011 408
22 3300026089 Ga0207648_10061587 Ga0207648_100615872 408
23 3300026121 Ga0207683_10000276 Ga0207683_100002766 408
24 3300028380 Ga0268265_10187123 Ga0268265_101871231 408
25 3300013297 Ga0157378_10028724 Ga0157378_100287242 409
26 3300014325 Ga0163163_10210410 Ga0163163_102104101 409
27 3300025910 Ga0207684_10117214 Ga0207684_101172142 409
28 3300025927 Ga0207687_10145749 Ga0207687_101457492 409
29 3300028379 Ga0268266_10235284 Ga0268266_102352842 409
30 3300049575 Ga0501039_0156239 Ga0501039_0156239_49_1362 409
31 3300049588 Ga0501072_0214004 Ga0501072_0214004_74_1387 409
32 3300009545 Ga0105237_10030893 Ga0105237_100308935 410
33 3300025939 Ga0207665_10187602 Ga0207665_101876021 411
34 3300053136 Ga0500559_0046016 Ga0500559_0046016_174_1445 411
35 3300013306 Ga0163162_10107477 Ga0163162_101074772 413
36 3300037068 Ga0373925_0114575 Ga0373925_0114575_735_2000 413
37 3300044658 Ga0466972_0001405 Ga0466972_0001405_6797_8062 413
38 3300046460 Ga0495638_0008749 Ga0495638_0008749_3303_4568 413
39 3300046477 Ga0495664_0031902 Ga0495664_0031902_37_1302 413
40 3300046559 Ga0495667_0046711 Ga0495667_0046711_885_2150 413
41 3300046675 Ga0495657_0105491 Ga0495657_0105491_59_1324 413
42 3300046679 Ga0495623_0017667 Ga0495623_0017667_2992_4257 413
43 3300046809 Ga0495600_0003817 Ga0495600_0003817_4836_6101 413
44 3300047317 Ga0495604_0001495 Ga0495604_0001495_13816_15081 413
45 3300047322 Ga0495680_0005483 Ga0495680_0005483_6820_8085 413
46 3300047443 Ga0495687_011481 Ga0495687_011481_3449_4714 413
47 3300047469 Ga0495673_0037214 Ga0495673_0037214_112_1377 413
48 3300047471 Ga0495684_0042187 Ga0495684_0042187_262_1527 413
49 3300048088 Ga0495602_0026445 Ga0495602_0026445_750_2015 413
50 3300048915 Ga0496112_0145404 Ga0496112_0145404_702_1967 413
51 3300048923 Ga0496120_0066413 Ga0496120_0066413_567_1832 413
52 3300053087 Ga0500643_000049 Ga0500643_000049_55537_56802 413
53 3300053105 Ga0500557_000192 Ga0500557_000192_2069_3334 413
54 3300053130 Ga0500642_0000056 Ga0500642_0000056_6854_8119 413
55 3300053153 Ga0500616_0024201 Ga0500616_0024201_209_1474 413
56 3300053737 Ga0500601_003890 Ga0500601_003890_330_1595 413
57 iso_pu_bacteria 2854681122 2854681327 413
58 3300005436 Ga0070713_100021807 Ga0070713_1000218071 414
59 3300005439 Ga0070711_100030366 Ga0070711_1000303661 414
60 3300006028 Ga0070717_10190093 Ga0070717_101900931 414
61 3300006175 Ga0070712_100152497 Ga0070712_1001524972 414
62 3300025915 Ga0207693_10067049 Ga0207693_100670491 414
63 3300025928 Ga0207700_10013199 Ga0207700_100131994 414
64 3300048912 Ga0496109_0392296 Ga0496109_0392296_11_1288 414
65 3300005467 Ga0070706_100065313 Ga0070706_1000653133 417
66 3300005468 Ga0070707_100072841 Ga0070707_1000728412 417
67 3300025922 Ga0207646_10018727 Ga0207646_100187278 417
68 3300048929 Ga0496126_0014893 Ga0496126_0014893_3176_4495 417
69 3300005983 Ga0081540_1024850 Ga0081540_10248501 418
70 3300006944 Ga0099823_1009115 Ga0099823_10091152 418
71 3300027296 Ga0209389_1000153 Ga0209389_10001538 418
72 3300027361 Ga0209489_100936 Ga0209489_10093659 418
73 3300027363 Ga0209700_100011 Ga0209700_10001192 418
74 3300033442 Ga0315911_1000013 Ga0315911_100001389 418
75 3300044684 Ga0466966_0000209 Ga0466966_0000209_8659_9978 418
76 3300044693 Ga0466961_0000110 Ga0466961_0000110_45147_46466 418
77 3300045049 Ga0466959_0007187 Ga0466959_0007187_5310_6629 418
78 3300048909 Ga0496106_0098985 Ga0496106_0098985_98_1441 418
79 iso_pu_bacteria 2818991461 2819687911 418
80 3300005434 Ga0070709_10002152 Ga0070709_100021522 419
81 3300006173 Ga0070716_100129097 Ga0070716_1001290971 419
82 3300025906 Ga0207699_10091799 Ga0207699_100917992 419
83 3300045049 Ga0466959_0189675 Ga0466959_0189675_91_1389 419
84 3300003215 JGI25153J46596_10007816 JGI25153J46596_100078161 420
85 3300005456 Ga0070678_100023376 Ga0070678_1000233762 420
86 3300009176 Ga0105242_10040904 Ga0105242_100409043 420
87 3300014968 Ga0157379_10069172 Ga0157379_100691722 420
88 3300025295 Ga0209564_1009228 Ga0209564_10092284 420
89 3300025297 Ga0209758_1000443 Ga0209758_100044361 420
90 3300025899 Ga0207642_10031724 Ga0207642_100317242 420
91 3300025938 Ga0207704_10132220 Ga0207704_101322202 420
92 3300026121 Ga0207683_10058191 Ga0207683_100581912 420
93 3300049570 Ga0501033_0028686 Ga0501033_0028686_2706_4037 420
94 iso_pu_bacteria 2643221603 2644027976 420
95 3300003781 Ga0055536_1006721 Ga0055536_10067213 421
96 3300005467 Ga0070706_100129477 Ga0070706_1001294771 421
97 3300005471 Ga0070698_100075213 Ga0070698_1000752131 421
98 3300025910 Ga0207684_10060801 Ga0207684_100608012 421
99 3300035692 Ga0373935_0010225 Ga0373935_0010225_2446_3756 421
100 3300035695 Ga0373927_0028563 Ga0373927_0028563_876_2186 421
101 3300037068 Ga0373925_0046505 Ga0373925_0046505_1895_3205 421
102 3300005563 Ga0068855_100110816 Ga0068855_1001108163 422
103 3300005983 Ga0081540_1004334 Ga0081540_100433410 422
104 3300009093 Ga0105240_10013166 Ga0105240_100131661 422
105 3300025913 Ga0207695_10338442 Ga0207695_103384421 422
106 3300025919 Ga0207657_10094822 Ga0207657_100948223 422
107 3300025924 Ga0207694_10074789 Ga0207694_100747892 422
108 3300025949 Ga0207667_10033168 Ga0207667_100331684 422
109 3300044658 Ga0466972_0034717 Ga0466972_0034717_458_1765 422
110 3300044735 Ga0466968_0042359 Ga0466968_0042359_558_1865 422
111 iso_pu_bacteria 2900577576 2900580149 422
112 3300003781 Ga0055536_1006610 Ga0055536_10066103 423
113 3300025292 Ga0209676_1000097 Ga0209676_100009783 423
114 3300042876 Ga0451577_0034575 Ga0451577_0034575_2949_4259 423
115 3300045051 Ga0451576_0000030 Ga0451576_0000030_207771_209081 423
116 3300009093 Ga0105240_10056620 Ga0105240_100566202 424
117 3300009545 Ga0105237_10192243 Ga0105237_101922431 424
118 3300025913 Ga0207695_10187513 Ga0207695_101875131 424
119 3300025914 Ga0207671_10167552 Ga0207671_101675521 424
120 3300026041 Ga0207639_10176445 Ga0207639_101764452 424
121 3300037312 Ga0395899_0003854 Ga0395899_0003854_5731_7041 424
122 3300037471 Ga0395905_0195793 Ga0395905_0195793_142_1452 424
123 3300046537 Ga0495598_0023593 Ga0495598_0023593_97_1407 424
124 3300044765 Ga0466970_0004728 Ga0466970_0004728_575_1897 425
125 iso_pu_bacteria 2513237096 2513660977 425
126 iso_pu_bacteria 2513237137 2513860468 425
127 iso_pu_bacteria 2513237145 2513922719 425
128 iso_pu_bacteria 2517572143 2517888724 425
129 iso_pu_bacteria 2524023228 2524538819 425
130 iso_pu_bacteria 2667528175 2671119897 425
131 iso_pu_bacteria 2728368998 2728754888 425
132 iso_pu_bacteria 2791355197 2793067543 425
133 iso_pu_bacteria 2903748898 2903756378 425
134 iso_pu_bacteria 2904699407 2904708853 425
135 iso_pu_bacteria 2906635258 2906640094 425
136 iso_pu_bacteria 2906660503 2906667488 425
137 iso_pu_bacteria 2908739725 2908747317 425
138 iso_pu_bacteria 2922425934 2922434407 425
139 iso_pu_bacteria 2935630451 2935635460 425
140 iso_pu_bacteria 2941507105 2941512243 425
141 iso_pu_bacteria 2941515067 2941519944 425
142 iso_pu_bacteria 2941523033 2941528115 425
143 iso_pu_bacteria 3005474847 3005474955 425
144 iso_pu_bacteria 8006933436 8006936377 425
145 iso_pu_bacteria 8006973647 8006976346 425
146 iso_pu_bacteria 8019555841 8019562283 425
147 iso_pu_bacteria 8019565922 8019572353 425
148 iso_pu_bacteria 8056681323 8056687499 425
149 3300005458 Ga0070681_10041429 Ga0070681_100414292 426
150 3300005530 Ga0070679_100034699 Ga0070679_1000346991 426
151 3300014325 Ga0163163_10129302 Ga0163163_101293022 426
152 3300025921 Ga0207652_10212846 Ga0207652_102128462 426
153 3300025949 Ga0207667_10159374 Ga0207667_101593742 426
154 3300027296 Ga0209389_1000344 Ga0209389_10003449 426
155 3300027357 Ga0209589_1000032 Ga0209589_1000032108 426
156 3300027361 Ga0209489_102825 Ga0209489_10282532 426
157 3300037853 Ga0436364_0059646 Ga0436364_0059646_2602_3915 426
158 3300047315 Ga0495581_0035160 Ga0495581_0035160_742_2055 426
159 3300047321 Ga0495676_0030025 Ga0495676_0030025_1008_2321 426
160 3300048907 Ga0496104_0001082 Ga0496104_0001082_6543_7856 426
161 3300048908 Ga0496105_0001148 Ga0496105_0001148_5856_7169 426
162 3300048911 Ga0496108_0001659 Ga0496108_0001659_13937_15250 426
163 3300048913 Ga0496110_0008384 Ga0496110_0008384_3192_4505 426
164 3300048915 Ga0496112_0000896 Ga0496112_0000896_4857_6170 426
165 3300048916 Ga0496113_0000418 Ga0496113_0000418_11047_12360 426
166 3300048918 Ga0496115_0001613 Ga0496115_0001613_2805_4118 426
167 iso_pu_bacteria 2513237098 2513677588 426
168 iso_pu_bacteria 2513237104 2513719800 426
169 iso_pu_bacteria 2524023210 2524467399 426
170 iso_pu_bacteria 2643221651 2644290859 426
171 iso_pu_bacteria 2885383462 2885391013 426
172 iso_pu_bacteria 2903768456 2903772359 426
173 iso_pu_bacteria 2904690495 2904690615 426
174 iso_pu_bacteria 2908756301 2908756395 426
175 iso_pu_bacteria 2932794094 2932794431 426
176 iso_pu_bacteria 2932801729 2932806713 426
177 iso_pu_bacteria 2935883170 2935888484 426
178 iso_pu_bacteria 8056689827 8056695307 426
179 3300003215 JGI25153J46596_10007902 JGI25153J46596_100079023 427
180 3300003215 JGI25153J46596_10017295 JGI25153J46596_100172953 427
181 3300005937 Ga0081455_10050878 Ga0081455_100508783 427
182 3300006353 Ga0075370_10021464 Ga0075370_100214642 427
183 3300010375 Ga0105239_10218890 Ga0105239_102188902 427
184 3300025297 Ga0209758_1004610 Ga0209758_10046105 427
185 3300025297 Ga0209758_1008688 Ga0209758_10086887 427
186 3300025911 Ga0207654_10023650 Ga0207654_100236503 427
187 3300025913 Ga0207695_10000107 Ga0207695_10000107112 427
188 3300025914 Ga0207671_10006765 Ga0207671_100067655 427
189 3300025927 Ga0207687_10072474 Ga0207687_100724742 427
190 3300037418 Ga0395900_0007892 Ga0395900_0007892_3438_4754 427
191 3300039437 Ga0436365_0097731 Ga0436365_0097731_751_2067 427
192 3300045976 Ga0466967_0037924 Ga0466967_0037924_308_1624 427
193 3300046507 Ga0495606_0045733 Ga0495606_0045733_1018_2577 427
194 3300053177 Ga0500636_0014012 Ga0500636_0014012_2925_4244 427
195 3300005290 Ga0065712_10015671 Ga0065712_100156712 428
196 3300005293 Ga0065715_10133360 Ga0065715_101333602 428
197 3300005327 Ga0070658_10035380 Ga0070658_100353802 428
198 3300005327 Ga0070658_10064977 Ga0070658_100649773 428
199 3300005329 Ga0070683_100008196 Ga0070683_1000081968 428
200 3300005329 Ga0070683_100058369 Ga0070683_1000583693 428
201 3300005331 Ga0070670_100003522 Ga0070670_1000035225 428
202 3300005331 Ga0070670_100009835 Ga0070670_1000098354 428
203 3300005334 Ga0068869_100001725 Ga0068869_1000017255 428
204 3300005335 Ga0070666_10040404 Ga0070666_100404042 428
205 3300005339 Ga0070660_100002704 Ga0070660_1000027043 428
206 3300005344 Ga0070661_100001413 Ga0070661_1000014135 428
207 3300005344 Ga0070661_100017823 Ga0070661_1000178232 428
208 3300005347 Ga0070668_100013749 Ga0070668_1000137493 428
209 3300005347 Ga0070668_100132856 Ga0070668_1001328562 428
210 3300005353 Ga0070669_100029674 Ga0070669_1000296742 428
211 3300005354 Ga0070675_100060283 Ga0070675_1000602831 428
212 3300005355 Ga0070671_100007541 Ga0070671_1000075413 428
213 3300005364 Ga0070673_100021366 Ga0070673_1000213661 428
214 3300005365 Ga0070688_100064519 Ga0070688_1000645192 428
215 3300005366 Ga0070659_100018465 Ga0070659_1000184653 428
216 3300005435 Ga0070714_100013143 Ga0070714_1000131432 428
217 3300005436 Ga0070713_100000045 Ga0070713_10000004549 428
218 3300005455 Ga0070663_100131112 Ga0070663_1001311122 428
219 3300005457 Ga0070662_100070087 Ga0070662_1000700872 428
220 3300005459 Ga0068867_100027466 Ga0068867_1000274665 428
221 3300005467 Ga0070706_100025322 Ga0070706_1000253223 428
222 3300005543 Ga0070672_100052703 Ga0070672_1000527031 428
223 3300005543 Ga0070672_100054150 Ga0070672_1000541502 428
224 3300005548 Ga0070665_100150070 Ga0070665_1001500702 428
225 3300005563 Ga0068855_100051723 Ga0068855_1000517233 428
226 3300005563 Ga0068855_100072739 Ga0068855_1000727392 428
227 3300005564 Ga0070664_100003038 Ga0070664_1000030382 428
228 3300005564 Ga0070664_100102378 Ga0070664_1001023782 428
229 3300005577 Ga0068857_100000810 Ga0068857_10000081013 428
230 3300005577 Ga0068857_100002261 Ga0068857_10000226113 428
231 3300005578 Ga0068854_100069318 Ga0068854_1000693182 428
232 3300005614 Ga0068856_100014288 Ga0068856_1000142884 428
233 3300005614 Ga0068856_100075629 Ga0068856_1000756292 428
234 3300005616 Ga0068852_100001129 Ga0068852_1000011294 428
235 3300005617 Ga0068859_100000466 Ga0068859_10000046614 428
236 3300005617 Ga0068859_100225633 Ga0068859_1002256332 428
237 3300005618 Ga0068864_100001455 Ga0068864_10000145514 428
238 3300005618 Ga0068864_100023418 Ga0068864_1000234183 428
239 3300005618 Ga0068864_100170161 Ga0068864_1001701612 428
240 3300005719 Ga0068861_100011143 Ga0068861_1000111432 428
241 3300005719 Ga0068861_100031998 Ga0068861_1000319982 428
242 3300005719 Ga0068861_100045614 Ga0068861_1000456142 428
243 3300005834 Ga0068851_10039586 Ga0068851_100395862 428
244 3300005841 Ga0068863_100000829 Ga0068863_10000082924 428
245 3300005841 Ga0068863_100028656 Ga0068863_1000286562 428
246 3300005842 Ga0068858_100000624 Ga0068858_10000062414 428
247 3300005842 Ga0068858_100025937 Ga0068858_1000259372 428
248 3300005843 Ga0068860_100000782 Ga0068860_10000078214 428
249 3300005844 Ga0068862_100007370 Ga0068862_1000073702 428
250 3300005844 Ga0068862_100046933 Ga0068862_1000469332 428
251 3300005985 Ga0081539_10012946 Ga0081539_100129462 428
252 3300005985 Ga0081539_10073239 Ga0081539_100732392 428
253 3300006871 Ga0075434_100073727 Ga0075434_1000737272 428
254 3300006881 Ga0068865_100138541 Ga0068865_1001385412 428
255 3300006931 Ga0097620_100000466 Ga0097620_10000046614 428
256 3300006931 Ga0097620_100225639 Ga0097620_1002256392 428
257 3300009093 Ga0105240_10001807 Ga0105240_1000180730 428
258 3300009094 Ga0111539_10104860 Ga0111539_101048603 428
259 3300009098 Ga0105245_10122043 Ga0105245_101220432 428
260 3300009101 Ga0105247_10094955 Ga0105247_100949551 428
261 3300009148 Ga0105243_10090220 Ga0105243_100902203 428
262 3300009176 Ga0105242_10128297 Ga0105242_101282972 428
263 3300009177 Ga0105248_10000736 Ga0105248_1000073614 428
264 3300009177 Ga0105248_10019836 Ga0105248_100198364 428
265 3300009551 Ga0105238_10001317 Ga0105238_1000131713 428
266 3300013102 Ga0157371_10060192 Ga0157371_100601922 428
267 3300013104 Ga0157370_10025696 Ga0157370_100256967 428
268 3300013105 Ga0157369_10026262 Ga0157369_100262623 428
269 3300013105 Ga0157369_10075412 Ga0157369_100754122 428
270 3300013297 Ga0157378_10234577 Ga0157378_102345771 428
271 3300013306 Ga0163162_10114095 Ga0163162_101140952 428
272 3300013306 Ga0163162_10176752 Ga0163162_101767522 428
273 3300013307 Ga0157372_10062406 Ga0157372_100624062 428
274 3300013307 Ga0157372_10101310 Ga0157372_101013102 428
275 3300013308 Ga0157375_10004326 Ga0157375_100043266 428
276 3300013308 Ga0157375_10041140 Ga0157375_100411402 428
277 3300013308 Ga0157375_10135677 Ga0157375_101356772 428
278 3300014325 Ga0163163_10171872 Ga0163163_101718722 428
279 3300014326 Ga0157380_10030766 Ga0157380_100307662 428
280 3300014326 Ga0157380_10227029 Ga0157380_102270292 428
281 3300014968 Ga0157379_10000233 Ga0157379_1000023314 428
282 3300014968 Ga0157379_10180524 Ga0157379_101805242 428
283 3300017792 Ga0163161_10070747 Ga0163161_100707472 428
284 3300025315 Ga0207697_10000068 Ga0207697_1000006821 428
285 3300025321 Ga0207656_10008744 Ga0207656_100087442 428
286 3300025321 Ga0207656_10042997 Ga0207656_100429972 428
287 3300025893 Ga0207682_10000266 Ga0207682_1000026619 428
288 3300025899 Ga0207642_10088050 Ga0207642_100880501 428
289 3300025901 Ga0207688_10105033 Ga0207688_101050332 428
290 3300025903 Ga0207680_10042685 Ga0207680_100426852 428
291 3300025907 Ga0207645_10004546 Ga0207645_100045464 428
292 3300025907 Ga0207645_10023460 Ga0207645_100234603 428
293 3300025908 Ga0207643_10010998 Ga0207643_100109981 428
294 3300025909 Ga0207705_10060071 Ga0207705_100600712 428
295 3300025910 Ga0207684_10009875 Ga0207684_100098757 428
296 3300025913 Ga0207695_10054785 Ga0207695_100547853 428
297 3300025915 Ga0207693_10236362 Ga0207693_102363621 428
298 3300025923 Ga0207681_10095540 Ga0207681_100955401 428
299 3300025924 Ga0207694_10003964 Ga0207694_100039642 428
300 3300025925 Ga0207650_10008850 Ga0207650_100088502 428
301 3300025925 Ga0207650_10026884 Ga0207650_100268843 428
302 3300025925 Ga0207650_10034291 Ga0207650_100342912 428
303 3300025925 Ga0207650_10046657 Ga0207650_100466572 428
304 3300025926 Ga0207659_10037471 Ga0207659_100374713 428
305 3300025926 Ga0207659_10043335 Ga0207659_100433352 428
306 3300025928 Ga0207700_10000051 Ga0207700_1000005148 428
307 3300025929 Ga0207664_10033510 Ga0207664_100335103 428
308 3300025932 Ga0207690_10026056 Ga0207690_100260563 428
309 3300025933 Ga0207706_10033238 Ga0207706_100332383 428
310 3300025933 Ga0207706_10070833 Ga0207706_100708332 428
311 3300025933 Ga0207706_10076316 Ga0207706_100763161 428
312 3300025933 Ga0207706_10236260 Ga0207706_102362601 428
313 3300025934 Ga0207686_10123188 Ga0207686_101231882 428
314 3300025936 Ga0207670_10057680 Ga0207670_100576802 428
315 3300025937 Ga0207669_10018077 Ga0207669_100180775 428
316 3300025938 Ga0207704_10030438 Ga0207704_100304381 428
317 3300025938 Ga0207704_10142158 Ga0207704_101421581 428
318 3300025940 Ga0207691_10002783 Ga0207691_1000278312 428
319 3300025940 Ga0207691_10025670 Ga0207691_100256702 428
320 3300025941 Ga0207711_10010140 Ga0207711_100101406 428
321 3300025941 Ga0207711_10016463 Ga0207711_100164632 428
322 3300025942 Ga0207689_10000310 Ga0207689_1000031034 428
323 3300025942 Ga0207689_10028706 Ga0207689_100287062 428
324 3300025944 Ga0207661_10005122 Ga0207661_100051223 428
325 3300025944 Ga0207661_10173181 Ga0207661_101731812 428
326 3300025945 Ga0207679_10013209 Ga0207679_100132092 428
327 3300025945 Ga0207679_10071933 Ga0207679_100719332 428
328 3300025945 Ga0207679_10093421 Ga0207679_100934212 428
329 3300025949 Ga0207667_10010866 Ga0207667_100108668 428
330 3300025949 Ga0207667_10157991 Ga0207667_101579912 428
331 3300025960 Ga0207651_10033592 Ga0207651_100335922 428
332 3300025960 Ga0207651_10064308 Ga0207651_100643082 428
333 3300025981 Ga0207640_10052873 Ga0207640_100528731 428
334 3300025981 Ga0207640_10078096 Ga0207640_100780961 428
335 3300025986 Ga0207658_10000650 Ga0207658_100006506 428
336 3300026035 Ga0207703_10000443 Ga0207703_1000044322 428
337 3300026035 Ga0207703_10064385 Ga0207703_100643852 428
338 3300026035 Ga0207703_10086720 Ga0207703_100867202 428
339 3300026035 Ga0207703_10103230 Ga0207703_101032302 428
340 3300026067 Ga0207678_10002621 Ga0207678_100026212 428
341 3300026067 Ga0207678_10050007 Ga0207678_100500073 428
342 3300026075 Ga0207708_10006748 Ga0207708_100067486 428
343 3300026078 Ga0207702_10003982 Ga0207702_100039829 428
344 3300026078 Ga0207702_10018926 Ga0207702_100189262 428
345 3300026088 Ga0207641_10001097 Ga0207641_100010978 428
346 3300026088 Ga0207641_10004409 Ga0207641_100044093 428
347 3300026089 Ga0207648_10003029 Ga0207648_100030292 428
348 3300026089 Ga0207648_10003723 Ga0207648_100037232 428
349 3300026089 Ga0207648_10193386 Ga0207648_101933862 428
350 3300026095 Ga0207676_10000995 Ga0207676_1000099514 428
351 3300026116 Ga0207674_10000418 Ga0207674_1000041831 428
352 3300026116 Ga0207674_10071635 Ga0207674_100716352 428
353 3300026118 Ga0207675_100000726 Ga0207675_1000007265 428
354 3300026118 Ga0207675_100001605 Ga0207675_1000016057 428
355 3300026118 Ga0207675_100022891 Ga0207675_1000228914 428
356 3300026118 Ga0207675_100025019 Ga0207675_1000250195 428
357 3300026118 Ga0207675_100221489 Ga0207675_1002214891 428
358 3300026142 Ga0207698_10020906 Ga0207698_100209064 428
359 3300026142 Ga0207698_10052986 Ga0207698_100529862 428
360 3300027682 Ga0209971_1002480 Ga0209971_10024802 428
361 3300028380 Ga0268265_10019896 Ga0268265_100198962 428
362 3300028380 Ga0268265_10173167 Ga0268265_101731672 428
363 3300028381 Ga0268264_10000566 Ga0268264_1000056614 428
364 3300035172 Ga0373955_0087051 Ga0373955_0087051_343_1665 428
365 3300036401 Ga0373937_0015351 Ga0373937_0015351_1012_2334 428
366 3300038996 Ga0242420_006119 Ga0242420_006119_200_1525 428
367 3300045051 Ga0451576_0057362 Ga0451576_0057362_743_2065 428
368 3300048905 Ga0496102_0298911 Ga0496102_0298911_120_1445 428
369 3300048906 Ga0496103_0179003 Ga0496103_0179003_22_1344 428
370 3300048911 Ga0496108_0134264 Ga0496108_0134264_138_1463 428
371 3300048911 Ga0496108_0290552 Ga0496108_0290552_31_1353 428
372 3300048912 Ga0496109_0052621 Ga0496109_0052621_2056_3381 428
373 3300048912 Ga0496109_0100702 Ga0496109_0100702_1165_2490 428
374 3300048915 Ga0496112_0002790 Ga0496112_0002790_10417_11742 428
375 3300050507 nmdc:mga05p37_163289_c1 nmdc:mga05p37_163289_c1_898_2220 428
376 3300050511 nmdc:mga08y16_50025_c1 nmdc:mga08y16_50025_c1_656_1981 428
377 3300060353 Ga0501082_0000101 Ga0501082_0000101_2801_4114 428
378 3300005339 Ga0070660_100100462 Ga0070660_1001004621 429
379 3300006943 Ga0099822_1004364 Ga0099822_100436418 429
380 3300013102 Ga0157371_10030019 Ga0157371_100300193 429
381 3300013104 Ga0157370_10079448 Ga0157370_100794481 429
382 3300025919 Ga0207657_10021865 Ga0207657_100218654 429
383 3300025924 Ga0207694_10108133 Ga0207694_101081332 429
384 3300026078 Ga0207702_10186150 Ga0207702_101861501 429
385 3300027357 Ga0209589_1000046 Ga0209589_100004637 429
386 3300027361 Ga0209489_100106 Ga0209489_10010637 429
387 3300027363 Ga0209700_100105 Ga0209700_10010537 429
388 3300031249 Ga0265339_10090003 Ga0265339_100900031 429
389 3300046681 Ga0495647_0014535 Ga0495647_0014535_1206_2528 429
390 3300049568 Ga0501031_0000890 Ga0501031_0000890_4929_6272 429
391 3300049568 Ga0501031_0022980 Ga0501031_0022980_1330_2649 429
392 3300049569 Ga0501032_0000372 Ga0501032_0000372_12177_13520 429
393 3300049569 Ga0501032_0029900 Ga0501032_0029900_985_2304 429
394 3300049569 Ga0501032_0064130 Ga0501032_0064130_568_1887 429
395 3300049570 Ga0501033_0000824 Ga0501033_0000824_18447_19790 429
396 3300049570 Ga0501033_0040171 Ga0501033_0040171_2104_3426 429
397 3300049570 Ga0501033_0057360 Ga0501033_0057360_238_1554 429
398 3300049570 Ga0501033_0214414 Ga0501033_0214414_40_1359 429
399 3300049571 Ga0501034_0000058 Ga0501034_0000058_148098_149441 429
400 3300049571 Ga0501034_0128684 Ga0501034_0128684_850_2169 429
401 3300049572 Ga0501036_0000691 Ga0501036_0000691_19964_21307 429
402 3300049573 Ga0501037_0001344 Ga0501037_0001344_4944_6287 429
403 3300049574 Ga0501038_0000913 Ga0501038_0000913_13617_14960 429
404 3300049574 Ga0501038_0008489 Ga0501038_0008489_3646_4965 429
405 3300049575 Ga0501039_0051531 Ga0501039_0051531_439_1770 429
406 3300049576 Ga0501040_0005144 Ga0501040_0005144_2586_3905 429
407 3300049578 Ga0501042_0066098 Ga0501042_0066098_895_2214 429
408 3300049579 Ga0501043_0000444 Ga0501043_0000444_12185_13528 429
409 3300049579 Ga0501043_0012190 Ga0501043_0012190_3045_4364 429
410 3300049579 Ga0501043_0051609 Ga0501043_0051609_287_1618 429
411 3300049579 Ga0501043_0125244 Ga0501043_0125244_123_1442 429
412 3300049580 Ga0501046_0029707 Ga0501046_0029707_567_1886 429
413 3300049581 Ga0501047_0000022 Ga0501047_0000022_55505_56848 429
414 3300049581 Ga0501047_0025198 Ga0501047_0025198_139_1461 429
415 3300049581 Ga0501047_0042186 Ga0501047_0042186_1170_2489 429
416 3300049581 Ga0501047_0045096 Ga0501047_0045096_1735_3054 429
417 3300049582 Ga0501048_0000041 Ga0501048_0000041_36503_37846 429
418 3300049583 Ga0501067_0000764 Ga0501067_0000764_4264_5607 429
419 3300049583 Ga0501067_0001148 Ga0501067_0001148_6922_8241 429
420 3300049584 Ga0501068_0000547 Ga0501068_0000547_7130_8473 429
421 3300049584 Ga0501068_0071266 Ga0501068_0071266_34_1353 429
422 3300049585 Ga0501069_0043422 Ga0501069_0043422_790_2109 429
423 3300049586 Ga0501070_0004220 Ga0501070_0004220_8735_10078 429
424 3300049586 Ga0501070_0112532 Ga0501070_0112532_573_1892 429
425 3300049586 Ga0501070_0134828 Ga0501070_0134828_93_1424 429
426 3300049588 Ga0501072_0003399 Ga0501072_0003399_7000_8343 429
427 3300049589 Ga0501073_0000504 Ga0501073_0000504_15459_16802 429
428 3300049590 Ga0501074_0000028 Ga0501074_0000028_17139_18482 429
429 3300049590 Ga0501074_0000683 Ga0501074_0000683_13245_14564 429
430 3300049593 Ga0501077_0075177 Ga0501077_0075177_652_1971 429
431 3300049741 Ga0501079_0002860 Ga0501079_0002860_6303_7646 429
432 3300049741 Ga0501079_0083613 Ga0501079_0083613_284_1603 429
433 3300049742 Ga0501080_0012339 Ga0501080_0012339_5752_7095 429
434 3300049744 Ga0501083_0001349 Ga0501083_0001349_7358_8701 429
435 3300049822 Ga0501035_0001113 Ga0501035_0001113_2814_4157 429
436 3300049822 Ga0501035_0015011 Ga0501035_0015011_5751_7073 429
437 3300049822 Ga0501035_0098467 Ga0501035_0098467_648_1967 429
438 3300049822 Ga0501035_0146725 Ga0501035_0146725_573_1892 429
439 3300049823 Ga0501044_0000370 Ga0501044_0000370_31251_32594 429
440 3300049823 Ga0501044_0024557 Ga0501044_0024557_1298_2620 429
441 3300049823 Ga0501044_0239790 Ga0501044_0239790_222_1541 429
442 3300049824 Ga0501045_0006116 Ga0501045_0006116_4953_6272 429
443 3300049824 Ga0501045_0014542 Ga0501045_0014542_938_2281 429
444 3300054114 Ga0501084_0007133 Ga0501084_0007133_4046_5389 429
445 3300054114 Ga0501084_0055837 Ga0501084_0055837_448_1767 429
446 3300060353 Ga0501082_0013595 Ga0501082_0013595_4854_6197 429
447 3300060353 Ga0501082_0057571 Ga0501082_0057571_452_1771 429
448 3300001989 JGI24739J22299_10039738 JGI24739J22299_100397382 430
449 3300002067 JGI24735J21928_10013429 JGI24735J21928_100134292 430
450 3300003215 JGI25153J46596_10010396 JGI25153J46596_100103962 430
451 3300003354 JGI25160J50197_1010795 JGI25160J50197_10107951 430
452 3300003762 Ga0055542_1006636 Ga0055542_10066362 430
453 3300003794 Ga0055531_10004770 Ga0055531_100047704 430
454 3300005329 Ga0070683_100066845 Ga0070683_1000668454 430
455 3300005331 Ga0070670_100081131 Ga0070670_1000811313 430
456 3300005347 Ga0070668_100133201 Ga0070668_1001332012 430
457 3300005434 Ga0070709_10004534 Ga0070709_100045349 430
458 3300005437 Ga0070710_10051082 Ga0070710_100510821 430
459 3300005439 Ga0070711_100016348 Ga0070711_1000163483 430
460 3300005455 Ga0070663_100091220 Ga0070663_1000912201 430
461 3300005457 Ga0070662_100084286 Ga0070662_1000842862 430
462 3300005458 Ga0070681_10047103 Ga0070681_100471033 430
463 3300005530 Ga0070679_100030656 Ga0070679_1000306564 430
464 3300005539 Ga0068853_100103852 Ga0068853_1001038522 430
465 3300005563 Ga0068855_100168338 Ga0068855_1001683382 430
466 3300005983 Ga0081540_1018763 Ga0081540_10187634 430
467 3300006237 Ga0097621_100104056 Ga0097621_1001040562 430
468 3300009098 Ga0105245_10157120 Ga0105245_101571202 430
469 3300009545 Ga0105237_10047164 Ga0105237_100471642 430
470 3300013105 Ga0157369_10028351 Ga0157369_100283513 430
471 3300013296 Ga0157374_10059243 Ga0157374_100592432 430
472 3300025253 Ga0209677_104912 Ga0209677_1049124 430
473 3300025254 Ga0209148_1000308 Ga0209148_100030861 430
474 3300025295 Ga0209564_1007252 Ga0209564_10072522 430
475 3300025297 Ga0209758_1000546 Ga0209758_100054653 430
476 3300025297 Ga0209758_1013471 Ga0209758_10134712 430
477 3300025299 Ga0209256_1002930 Ga0209256_10029302 430
478 3300025302 Ga0207426_1007996 Ga0207426_10079962 430
479 3300025304 Ga0209257_1001004 Ga0209257_10010042 430
480 3300025304 Ga0209257_1015484 Ga0209257_10154843 430
481 3300025900 Ga0207710_10020950 Ga0207710_100209502 430
482 3300025904 Ga0207647_10023452 Ga0207647_100234522 430
483 3300025906 Ga0207699_10001846 Ga0207699_100018468 430
484 3300025912 Ga0207707_10015977 Ga0207707_100159776 430
485 3300025915 Ga0207693_10019351 Ga0207693_100193512 430
486 3300025916 Ga0207663_10007451 Ga0207663_100074514 430
487 3300025919 Ga0207657_10104246 Ga0207657_101042462 430
488 3300025928 Ga0207700_10017262 Ga0207700_100172623 430
489 3300025933 Ga0207706_10118076 Ga0207706_101180762 430
490 3300025939 Ga0207665_10080351 Ga0207665_100803512 430
491 3300025939 Ga0207665_10150052 Ga0207665_101500521 430
492 3300025944 Ga0207661_10008755 Ga0207661_100087553 430
493 3300033180 Ga0307510_10066110 Ga0307510_100661102 430
494 3300035083 Ga0373926_0022812 Ga0373926_0022812_242_1561 430
495 3300035089 Ga0373944_0009550 Ga0373944_0009550_640_1959 430
496 3300035116 Ga0373945_0005059 Ga0373945_0005059_2094_3413 430
497 3300035117 Ga0373953_0036137 Ga0373953_0036137_526_1845 430
498 3300035119 Ga0373956_0032778 Ga0373956_0032778_612_1931 430
499 3300035695 Ga0373927_0028242 Ga0373927_0028242_521_1840 430
500 3300035725 Ga0373947_0006308 Ga0373947_0006308_3063_4382 430
501 3300036401 Ga0373937_0104963 Ga0373937_0104963_395_1714 430
502 3300037418 Ga0395900_0143158 Ga0395900_0143158_224_1540 430
503 3300044658 Ga0466972_0005312 Ga0466972_0005312_2952_4268 430
504 3300046459 Ga0495629_0017962 Ga0495629_0017962_707_2023 430
505 3300046472 Ga0495580_0132900 Ga0495580_0132900_48_1367 430
506 3300046492 Ga0495585_0067208 Ga0495585_0067208_143_1459 430
507 3300046499 Ga0495594_0052304 Ga0495594_0052304_898_2217 430
508 3300046507 Ga0495606_0028489 Ga0495606_0028489_761_2077 430
509 3300046511 Ga0495608_0027653 Ga0495608_0027653_678_1994 430
510 3300046529 Ga0495652_0015898 Ga0495652_0015898_1391_2707 430
511 3300046533 Ga0495640_0008874 Ga0495640_0008874_3011_4327 430
512 3300046533 Ga0495640_0021916 Ga0495640_0021916_613_1932 430
513 3300046642 Ga0495634_0059320 Ga0495634_0059320_1189_2508 430
514 3300046663 Ga0495635_0018265 Ga0495635_0018265_2739_4055 430
515 3300046680 Ga0495646_0055703 Ga0495646_0055703_292_1611 430
516 3300046690 Ga0495624_0030288 Ga0495624_0030288_360_1679 430
517 3300047315 Ga0495581_0046456 Ga0495581_0046456_218_1537 430
518 3300047319 Ga0495674_0021283 Ga0495674_0021283_4068_5387 430
519 3300047321 Ga0495676_0013624 Ga0495676_0013624_1231_2547 430
520 3300047471 Ga0495684_0011086 Ga0495684_0011086_1617_2936 430
521 3300048088 Ga0495602_0059103 Ga0495602_0059103_1463_2779 430
522 3300048905 Ga0496102_0214140 Ga0496102_0214140_42_1358 430
523 3300048908 Ga0496105_0122539 Ga0496105_0122539_59_1375 430
524 3300048914 Ga0496111_0083719 Ga0496111_0083719_898_2214 430
525 3300048929 Ga0496126_0025590 Ga0496126_0025590_2098_3417 430
526 3300048929 Ga0496126_0078616 Ga0496126_0078616_838_2154 430
527 3300050492 nmdc:mga0yw44_57675_c1 nmdc:mga0yw44_57675_c1_722_2038 430
528 3300050493 nmdc:mga0k408_75484_c1 nmdc:mga0k408_75484_c1_327_1643 430
529 3300053077 Ga0495601_0079609 Ga0495601_0079609_378_1697 430
530 3300053177 Ga0500636_0002629 Ga0500636_0002629_6178_7494 430

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

45

360

0.85

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

36

327

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4aq4-assembly1.cif.gz_A substrate bound sn-glycerol-3-phosphate binding periplasmic protein ugpb from escherichia coli 0.9652 26 427
4aq4-assembly1.cif.gz_A substrate bound sn-glycerol-3-phosphate binding periplasmic protein ugpb from escherichia coli 0.9268 26 427
6x84-assembly2.cif.gz_B sn-glycerol-3-phosphate binding periplasmic protein ugpb from escherichia coli - w169s, w172s 0.902 25 428
6x84-assembly2.cif.gz_B sn-glycerol-3-phosphate binding periplasmic protein ugpb from escherichia coli - w169s, w172s 0.8796 25 428
7c0u-assembly2.cif.gz_B crystal structure of a dinucleotide-binding protein (s127a) of abc transporter endogenously bound to uridylyl-3'-5'-phospho-guanosine 0.8613 27 422
ID Description Score Start End Superfamily
af_P0AG80_145_437_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9649 147 427 3.40.190.10
4aq4A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9564 26 374 3.40.190.10
4aq4A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9288 26 374 3.40.190.10
af_P0AG80_145_437_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9231 147 427 3.40.190.10
4aq4A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8948 147 427 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A1G3RQS8-F1-model_v4 sn-glycerol-3-phosphate ABC transporter substrate-binding protein 0.9721 35 429 GO:0030313
GO:0055085
AF-A0A0E1UNP6-F1-model_v4 deleted 0.9691 21 416
AF-A0A0R3CB30-F1-model_v4 sn-glycerol-3-phosphate-binding periplasmic protein UgpB 0.9662 20 428 GO:0042597
AF-A0A432RQP0-F1-model_v4 sn-glycerol-3-phosphate-binding periplasmic protein UgpB 0.9652 35 426 GO:0030313
GO:0055085
AF-A0A2X2TAB2-F1-model_v4 sn-glycerol-3-phosphate-binding periplasmic protein UgpB 0.962 20 430 GO:0016020
GO:0030288
GO:0055085

Feature Viewer

pLDDT pTM Quality
86.92 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map