F460002
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 530 | 317 | 488 | 435 |
Family's Representative Sequence
| Representative Sequence | 3300046507|Ga0495606_0045733|Ga0495606_0045733_1018_2577 |
| Length | 508 |
| Sequence | MALRHFGAAAAVAIAVGMTASPALATTEIQWWHAMTGANNDVIVKLANDFNASQSDYKVIPTYKGSYPDTMNAGIAAFRAGNAPHIMQVFEVGTATMMAATGAVKPVYKLMADAGEKFDPKNYLSAITGYYSTSKGEMLSFPFNSSSTVMWVNLDELKKVNAEIPKTWPEVFEVAKKLHDNGHPTCGFSNSAWHNVPLASKANGLDGFDTKLEFNAPLQEKHLEKLVELQKDKTYDYAGRTNQGEGRFTSGECAIYLTSSAFFGNVKAQAKFNFTAVPMPYYPDVKGAPQNSIIGGASLWVMGGKSADEYKGVAKFLTFLSDTDRQVYIHKASGYLPITKAAYEKAKAEGFYKDQPYLETPLIELTNKEPTDNSRGLRLGNMVQLRDVWAEEIEQALAGKKTAKQALEASVERGNTMLRQFEKTAVKYGEGAGGRTISGPPAPPHHAKASDFPIKAAAVRAGCAATRDCSDFLLLAGRAGRHPVLPAAGRFRPLDELRLVRELRRAVQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 2 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 3 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 4 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 5 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 6 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 7 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 8 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 9 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 10 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 11 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 12 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 13 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 14 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 15 | 2854681122 | Luteovulum sphaeroides SCJ | Isolate | Unclassified |
| 16 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 17 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 18 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 19 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 20 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 21 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 22 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 23 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 24 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 25 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 26 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 27 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 28 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 29 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 30 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 31 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 32 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 33 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 34 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 35 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 36 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 37 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 38 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 39 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 40 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 41 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 42 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 43 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 47 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 56 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 67 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 71 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 72 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 75 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 77 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 78 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 79 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 80 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 81 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 82 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 83 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 84 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 85 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 86 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 87 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 88 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 89 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 90 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 91 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 96 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 97 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 98 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 100 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 101 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 191 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 192 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 193 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 194 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 199 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 200 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 201 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 202 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 203 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 204 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 205 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 206 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 207 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 208 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 209 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 210 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 213 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 214 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 215 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 216 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 217 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 218 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 219 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 220 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 221 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 222 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 223 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 224 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 225 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 226 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 227 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 257 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 258 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 259 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 260 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 261 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 264 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 265 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 266 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 267 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 268 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 269 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 270 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 299 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 300 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 304 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 305 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 306 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 307 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 308 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 309 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 310 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 313 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 314 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 315 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 316 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 317 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.6 |
| Metatranscriptomes | 0 |
| Isolates | 7.4 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.6 |
| Nodule | 7.36 |
| Rhizoplane | 3.96 |
| Rhizosphere | 78.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.77 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10039738 | 3300001989 | Bacteria | 1574 |
| 2 | JGI24735J21928_10013429 | 3300002067 | Bacteria | 2575 |
| 3 | JGI25153J46596_10007816 | 3300003215 | Bacteria | 5195 |
| 4 | JGI25153J46596_10007902 | 3300003215 | Bacteria | 5161 |
| 5 | JGI25153J46596_10010396 | 3300003215 | Bacteria | 4212 |
| 6 | JGI25153J46596_10017295 | 3300003215 | Bacteria | 2845 |
| 7 | JGI25160J50197_1010795 | 3300003354 | Bacteria | 3281 |
| 8 | Ga0055542_1006636 | 3300003762 | Bacteria | 2450 |
| 9 | Ga0055536_1006610 | 3300003781 | Bacteria | 5353 |
| 10 | Ga0055536_1006721 | 3300003781 | Bacteria | 5283 |
| 11 | Ga0055531_10004770 | 3300003794 | Bacteria | 8103 |
| 12 | Ga0065712_10015671 | 3300005290 | Bacteria | 2077 |
| 13 | Ga0065715_10133360 | 3300005293 | Bacteria | 1974 |
| 14 | Ga0070658_10035380 | 3300005327 | Bacteria | 4022 |
| 15 | Ga0070658_10064977 | 3300005327 | Bacteria | 2977 |
| 16 | Ga0070683_100008196 | 3300005329 | Bacteria | 8875 |
| 17 | Ga0070683_100058369 | 3300005329 | Bacteria | 3585 |
| 18 | Ga0070683_100066845 | 3300005329 | Bacteria | 3348 |
| 19 | Ga0070670_100003522 | 3300005331 | Bacteria | 13011 |
| 20 | Ga0070670_100009835 | 3300005331 | Bacteria | 8170 |
| 21 | Ga0070670_100081131 | 3300005331 | Bacteria | 2787 |
| 22 | Ga0068869_100001725 | 3300005334 | Bacteria | 13059 |
| 23 | Ga0070666_10040404 | 3300005335 | Bacteria | 3113 |
| 24 | Ga0070660_100002704 | 3300005339 | Bacteria | 12173 |
| 25 | Ga0070660_100100462 | 3300005339 | Bacteria | 2291 |
| 26 | Ga0070661_100001413 | 3300005344 | Bacteria | 16755 |
| 27 | Ga0070661_100017823 | 3300005344 | Bacteria | 5040 |
| 28 | Ga0070668_100013749 | 3300005347 | Bacteria | 6045 |
| 29 | Ga0070668_100132856 | 3300005347 | Bacteria | 1999 |
| 30 | Ga0070668_100133201 | 3300005347 | Bacteria | 1996 |
| 31 | Ga0070669_100029674 | 3300005353 | Bacteria | 3944 |
| 32 | Ga0070669_100176757 | 3300005353 | Bacteria | 1668 |
| 33 | Ga0070675_100022720 | 3300005354 | Bacteria | 5011 |
| 34 | Ga0070675_100060283 | 3300005354 | Bacteria | 3133 |
| 35 | Ga0070671_100007541 | 3300005355 | Bacteria | 8699 |
| 36 | Ga0070673_100021366 | 3300005364 | Bacteria | 4691 |
| 37 | Ga0070688_100064519 | 3300005365 | Bacteria | 2324 |
| 38 | Ga0070659_100018465 | 3300005366 | Bacteria | 5263 |
| 39 | Ga0070709_10002152 | 3300005434 | Bacteria | 10666 |
| 40 | Ga0070709_10004534 | 3300005434 | Bacteria | 7496 |
| 41 | Ga0070714_100013143 | 3300005435 | Bacteria | 6629 |
| 42 | Ga0070713_100000045 | 3300005436 | Bacteria | 77398 |
| 43 | Ga0070713_100021807 | 3300005436 | Bacteria | 4937 |
| 44 | Ga0070710_10051082 | 3300005437 | Bacteria | 2320 |
| 45 | Ga0070711_100016348 | 3300005439 | Bacteria | 4711 |
| 46 | Ga0070711_100030366 | 3300005439 | Bacteria | 3576 |
| 47 | Ga0070663_100091220 | 3300005455 | Bacteria | 2257 |
| 48 | Ga0070663_100131112 | 3300005455 | Bacteria | 1903 |
| 49 | Ga0070678_100023376 | 3300005456 | Bacteria | 4118 |
| 50 | Ga0070662_100070087 | 3300005457 | Bacteria | 2582 |
| 51 | Ga0070662_100084286 | 3300005457 | Bacteria | 2374 |
| 52 | Ga0070681_10041429 | 3300005458 | Bacteria | 4615 |
| 53 | Ga0070681_10047103 | 3300005458 | Bacteria | 4309 |
| 54 | Ga0068867_100027466 | 3300005459 | Bacteria | 4091 |
| 55 | Ga0070706_100025322 | 3300005467 | Bacteria | 5460 |
| 56 | Ga0070706_100065313 | 3300005467 | Bacteria | 3365 |
| 57 | Ga0070706_100129477 | 3300005467 | Bacteria | 2355 |
| 58 | Ga0070707_100072841 | 3300005468 | Bacteria | 3312 |
| 59 | Ga0070698_100075213 | 3300005471 | Bacteria | 3382 |
| 60 | Ga0070679_100030656 | 3300005530 | Bacteria | 5311 |
| 61 | Ga0070679_100034699 | 3300005530 | Bacteria | 5001 |
| 62 | Ga0068853_100103852 | 3300005539 | Bacteria | 2516 |
| 63 | Ga0070672_100052703 | 3300005543 | Bacteria | 3177 |
| 64 | Ga0070672_100054150 | 3300005543 | Bacteria | 3140 |
| 65 | Ga0070665_100150070 | 3300005548 | Bacteria | 2333 |
| 66 | Ga0068855_100051723 | 3300005563 | Bacteria | 4839 |
| 67 | Ga0068855_100072739 | 3300005563 | Bacteria | 3995 |
| 68 | Ga0068855_100110816 | 3300005563 | Bacteria | 3150 |
| 69 | Ga0068855_100168338 | 3300005563 | Bacteria | 2482 |
| 70 | Ga0070664_100003038 | 3300005564 | Bacteria | 13572 |
| 71 | Ga0070664_100102378 | 3300005564 | Bacteria | 2492 |
| 72 | Ga0068857_100000810 | 3300005577 | Bacteria | 23378 |
| 73 | Ga0068857_100002261 | 3300005577 | Bacteria | 15660 |
| 74 | Ga0068854_100069318 | 3300005578 | Bacteria | 2574 |
| 75 | Ga0068856_100014288 | 3300005614 | Bacteria | 7678 |
| 76 | Ga0068856_100075629 | 3300005614 | Bacteria | 3336 |
| 77 | Ga0068852_100001129 | 3300005616 | Bacteria | 17663 |
| 78 | Ga0068859_100000466 | 3300005617 | Bacteria | 40002 |
| 79 | Ga0068859_100225633 | 3300005617 | Bacteria | 1961 |
| 80 | Ga0068864_100001455 | 3300005618 | Bacteria | 19514 |
| 81 | Ga0068864_100023418 | 3300005618 | Bacteria | 5185 |
| 82 | Ga0068864_100042872 | 3300005618 | Bacteria | 3873 |
| 83 | Ga0068864_100170161 | 3300005618 | Bacteria | 1986 |
| 84 | Ga0068861_100011143 | 3300005719 | Bacteria | 6242 |
| 85 | Ga0068861_100031998 | 3300005719 | Bacteria | 3869 |
| 86 | Ga0068861_100045614 | 3300005719 | Bacteria | 3302 |
| 87 | Ga0068851_10002809 | 3300005834 | Bacteria | 7676 |
| 88 | Ga0068851_10039586 | 3300005834 | Bacteria | 2367 |
| 89 | Ga0068863_100000829 | 3300005841 | Bacteria | 31008 |
| 90 | Ga0068863_100028656 | 3300005841 | Bacteria | 5316 |
| 91 | Ga0068858_100000624 | 3300005842 | Bacteria | 36860 |
| 92 | Ga0068858_100025937 | 3300005842 | Bacteria | 5450 |
| 93 | Ga0068860_100000782 | 3300005843 | Bacteria | 35765 |
| 94 | Ga0068862_100007370 | 3300005844 | Bacteria | 9127 |
| 95 | Ga0068862_100046933 | 3300005844 | Bacteria | 3685 |
| 96 | Ga0081455_10050878 | 3300005937 | Bacteria | 3558 |
| 97 | Ga0081540_1004334 | 3300005983 | Bacteria | 10871 |
| 98 | Ga0081540_1018763 | 3300005983 | Bacteria | 4229 |
| 99 | Ga0081540_1024850 | 3300005983 | Bacteria | 3465 |
| 100 | Ga0081539_10012946 | 3300005985 | Bacteria | 6345 |
| 101 | Ga0081539_10073239 | 3300005985 | Bacteria | 1828 |
| 102 | Ga0070717_10190093 | 3300006028 | Bacteria | 1794 |
| 103 | Ga0070716_100129097 | 3300006173 | Bacteria | 1595 |
| 104 | Ga0070712_100152497 | 3300006175 | Bacteria | 1776 |
| 105 | Ga0097621_100047547 | 3300006237 | Bacteria | 3478 |
| 106 | Ga0097621_100104056 | 3300006237 | Bacteria | 2392 |
| 107 | Ga0075370_10021464 | 3300006353 | Bacteria | 3537 |
| 108 | Ga0075434_100073727 | 3300006871 | Bacteria | 3406 |
| 109 | Ga0068865_100138541 | 3300006881 | Bacteria | 1832 |
| 110 | Ga0097620_100000466 | 3300006931 | Bacteria | 40002 |
| 111 | Ga0097620_100225639 | 3300006931 | Bacteria | 1961 |
| 112 | Ga0099822_1004364 | 3300006943 | Bacteria | 18407 |
| 113 | Ga0099823_1009115 | 3300006944 | Bacteria | 10076 |
| 114 | Ga0105240_10001807 | 3300009093 | Bacteria | 36004 |
| 115 | Ga0105240_10013166 | 3300009093 | Bacteria | 11377 |
| 116 | Ga0105240_10056620 | 3300009093 | Bacteria | 4905 |
| 117 | Ga0111539_10104860 | 3300009094 | Bacteria | 3317 |
| 118 | Ga0105245_10122043 | 3300009098 | Bacteria | 2435 |
| 119 | Ga0105245_10157120 | 3300009098 | Bacteria | 2155 |
| 120 | Ga0105247_10094955 | 3300009101 | Bacteria | 1898 |
| 121 | Ga0105243_10090220 | 3300009148 | Bacteria | 2522 |
| 122 | Ga0105242_10040904 | 3300009176 | Bacteria | 3736 |
| 123 | Ga0105242_10128297 | 3300009176 | Bacteria | 2186 |
| 124 | Ga0105248_10000736 | 3300009177 | Bacteria | 36816 |
| 125 | Ga0105248_10019836 | 3300009177 | Bacteria | 7446 |
| 126 | Ga0105237_10030893 | 3300009545 | Bacteria | 5435 |
| 127 | Ga0105237_10047164 | 3300009545 | Bacteria | 4332 |
| 128 | Ga0105237_10192243 | 3300009545 | Bacteria | 2040 |
| 129 | Ga0105238_10001317 | 3300009551 | Bacteria | 24891 |
| 130 | Ga0105239_10218890 | 3300010375 | Bacteria | 2135 |
| 131 | Ga0157371_10030019 | 3300013102 | Bacteria | 3924 |
| 132 | Ga0157371_10060192 | 3300013102 | Bacteria | 2693 |
| 133 | Ga0157370_10025696 | 3300013104 | Bacteria | 5827 |
| 134 | Ga0157370_10079448 | 3300013104 | Bacteria | 3089 |
| 135 | Ga0157369_10026262 | 3300013105 | Bacteria | 6462 |
| 136 | Ga0157369_10028351 | 3300013105 | Bacteria | 6197 |
| 137 | Ga0157369_10075412 | 3300013105 | Bacteria | 3617 |
| 138 | Ga0157374_10059243 | 3300013296 | Bacteria | 3579 |
| 139 | Ga0157378_10028724 | 3300013297 | Bacteria | 4910 |
| 140 | Ga0157378_10234577 | 3300013297 | Bacteria | 1750 |
| 141 | Ga0163162_10107477 | 3300013306 | Bacteria | 2886 |
| 142 | Ga0163162_10114095 | 3300013306 | Bacteria | 2801 |
| 143 | Ga0163162_10176752 | 3300013306 | Bacteria | 2260 |
| 144 | Ga0157372_10062406 | 3300013307 | Bacteria | 4175 |
| 145 | Ga0157372_10101310 | 3300013307 | Bacteria | 3287 |
| 146 | Ga0157375_10004326 | 3300013308 | Bacteria | 12329 |
| 147 | Ga0157375_10041140 | 3300013308 | Bacteria | 4460 |
| 148 | Ga0157375_10135677 | 3300013308 | Bacteria | 2584 |
| 149 | Ga0163163_10129302 | 3300014325 | Bacteria | 2565 |
| 150 | Ga0163163_10171872 | 3300014325 | Bacteria | 2214 |
| 151 | Ga0163163_10210410 | 3300014325 | Bacteria | 1994 |
| 152 | Ga0157380_10030766 | 3300014326 | Bacteria | 4114 |
| 153 | Ga0157380_10227029 | 3300014326 | Bacteria | 1674 |
| 154 | Ga0157379_10000233 | 3300014968 | Bacteria | 43500 |
| 155 | Ga0157379_10069172 | 3300014968 | Bacteria | 3157 |
| 156 | Ga0157379_10180524 | 3300014968 | Bacteria | 1907 |
| 157 | Ga0157376_10162542 | 3300014969 | Bacteria | 2026 |
| 158 | Ga0163161_10070747 | 3300017792 | Bacteria | 2551 |
| 159 | Ga0209677_104912 | 3300025253 | Bacteria | 3658 |
| 160 | Ga0209148_1000308 | 3300025254 | Bacteria | 70131 |
| 161 | Ga0209676_1000097 | 3300025292 | Bacteria | 237203 |
| 162 | Ga0209564_1007252 | 3300025295 | Bacteria | 5764 |
| 163 | Ga0209564_1009228 | 3300025295 | Bacteria | 4728 |
| 164 | Ga0209758_1000443 | 3300025297 | Bacteria | 69228 |
| 165 | Ga0209758_1000546 | 3300025297 | Bacteria | 59757 |
| 166 | Ga0209758_1004610 | 3300025297 | Bacteria | 11323 |
| 167 | Ga0209758_1008688 | 3300025297 | Bacteria | 6503 |
| 168 | Ga0209758_1013471 | 3300025297 | Bacteria | 4453 |
| 169 | Ga0209256_1002930 | 3300025299 | Bacteria | 12820 |
| 170 | Ga0207426_1007996 | 3300025302 | Bacteria | 4344 |
| 171 | Ga0209257_1001004 | 3300025304 | Bacteria | 38186 |
| 172 | Ga0209257_1015484 | 3300025304 | Bacteria | 3170 |
| 173 | Ga0207697_10000068 | 3300025315 | Bacteria | 44303 |
| 174 | Ga0207656_10008744 | 3300025321 | Bacteria | 3741 |
| 175 | Ga0207656_10042997 | 3300025321 | Bacteria | 1925 |
| 176 | Ga0207682_10000097 | 3300025893 | Bacteria | 39655 |
| 177 | Ga0207682_10000266 | 3300025893 | Bacteria | 23550 |
| 178 | Ga0207642_10031724 | 3300025899 | Bacteria | 2217 |
| 179 | Ga0207642_10088050 | 3300025899 | Bacteria | 1526 |
| 180 | Ga0207710_10020950 | 3300025900 | Bacteria | 2799 |
| 181 | Ga0207688_10105033 | 3300025901 | Bacteria | 1635 |
| 182 | Ga0207680_10042685 | 3300025903 | Bacteria | 2655 |
| 183 | Ga0207647_10023452 | 3300025904 | Bacteria | 4080 |
| 184 | Ga0207699_10001846 | 3300025906 | Bacteria | 9967 |
| 185 | Ga0207699_10091799 | 3300025906 | Bacteria | 1907 |
| 186 | Ga0207645_10004546 | 3300025907 | Bacteria | 10248 |
| 187 | Ga0207645_10022990 | 3300025907 | Bacteria | 4051 |
| 188 | Ga0207645_10023460 | 3300025907 | Bacteria | 4010 |
| 189 | Ga0207643_10010998 | 3300025908 | Bacteria | 4884 |
| 190 | Ga0207643_10015498 | 3300025908 | Bacteria | 4149 |
| 191 | Ga0207705_10060071 | 3300025909 | Bacteria | 2745 |
| 192 | Ga0207684_10009875 | 3300025910 | Bacteria | 8418 |
| 193 | Ga0207684_10060801 | 3300025910 | Bacteria | 3209 |
| 194 | Ga0207684_10117214 | 3300025910 | Bacteria | 2282 |
| 195 | Ga0207654_10023650 | 3300025911 | Bacteria | 3294 |
| 196 | Ga0207707_10015977 | 3300025912 | Bacteria | 6546 |
| 197 | Ga0207695_10000107 | 3300025913 | Bacteria | 252606 |
| 198 | Ga0207695_10054785 | 3300025913 | Bacteria | 4161 |
| 199 | Ga0207695_10187513 | 3300025913 | Bacteria | 1987 |
| 200 | Ga0207695_10338442 | 3300025913 | Bacteria | 1393 |
| 201 | Ga0207671_10006765 | 3300025914 | Bacteria | 10136 |
| 202 | Ga0207671_10167552 | 3300025914 | Bacteria | 1704 |
| 203 | Ga0207693_10019351 | 3300025915 | Bacteria | 5417 |
| 204 | Ga0207693_10067049 | 3300025915 | Bacteria | 2810 |
| 205 | Ga0207693_10236362 | 3300025915 | Bacteria | 1435 |
| 206 | Ga0207663_10007451 | 3300025916 | Bacteria | 5675 |
| 207 | Ga0207657_10021865 | 3300025919 | Bacteria | 6007 |
| 208 | Ga0207657_10094822 | 3300025919 | Bacteria | 2484 |
| 209 | Ga0207657_10104246 | 3300025919 | Bacteria | 2350 |
| 210 | Ga0207652_10212846 | 3300025921 | Bacteria | 1741 |
| 211 | Ga0207646_10018727 | 3300025922 | Bacteria | 6453 |
| 212 | Ga0207681_10095540 | 3300025923 | Bacteria | 2132 |
| 213 | Ga0207694_10003964 | 3300025924 | Bacteria | 11677 |
| 214 | Ga0207694_10074789 | 3300025924 | Bacteria | 2651 |
| 215 | Ga0207694_10108133 | 3300025924 | Bacteria | 2209 |
| 216 | Ga0207650_10008850 | 3300025925 | Bacteria | 6879 |
| 217 | Ga0207650_10026884 | 3300025925 | Bacteria | 4111 |
| 218 | Ga0207650_10034291 | 3300025925 | Bacteria | 3680 |
| 219 | Ga0207650_10046657 | 3300025925 | Bacteria | 3191 |
| 220 | Ga0207659_10037471 | 3300025926 | Bacteria | 3367 |
| 221 | Ga0207659_10043335 | 3300025926 | Bacteria | 3160 |
| 222 | Ga0207659_10103169 | 3300025926 | Bacteria | 2154 |
| 223 | Ga0207687_10072474 | 3300025927 | Bacteria | 2464 |
| 224 | Ga0207687_10145749 | 3300025927 | Bacteria | 1801 |
| 225 | Ga0207700_10000051 | 3300025928 | Bacteria | 77057 |
| 226 | Ga0207700_10013199 | 3300025928 | Bacteria | 5365 |
| 227 | Ga0207700_10017262 | 3300025928 | Bacteria | 4817 |
| 228 | Ga0207664_10033510 | 3300025929 | Bacteria | 3947 |
| 229 | Ga0207690_10026056 | 3300025932 | Bacteria | 3680 |
| 230 | Ga0207706_10033238 | 3300025933 | Bacteria | 4591 |
| 231 | Ga0207706_10070833 | 3300025933 | Bacteria | 3067 |
| 232 | Ga0207706_10076316 | 3300025933 | Bacteria | 2947 |
| 233 | Ga0207706_10118076 | 3300025933 | Bacteria | 2333 |
| 234 | Ga0207706_10236260 | 3300025933 | Bacteria | 1598 |
| 235 | Ga0207686_10123188 | 3300025934 | Bacteria | 1767 |
| 236 | Ga0207670_10057680 | 3300025936 | Bacteria | 2634 |
| 237 | Ga0207669_10018077 | 3300025937 | Bacteria | 3633 |
| 238 | Ga0207704_10030438 | 3300025938 | Bacteria | 3026 |
| 239 | Ga0207704_10132220 | 3300025938 | Bacteria | 1730 |
| 240 | Ga0207704_10142158 | 3300025938 | Bacteria | 1680 |
| 241 | Ga0207665_10080351 | 3300025939 | Bacteria | 2243 |
| 242 | Ga0207665_10150052 | 3300025939 | Bacteria | 1669 |
| 243 | Ga0207665_10187602 | 3300025939 | Bacteria | 1501 |
| 244 | Ga0207691_10000331 | 3300025940 | Bacteria | 47246 |
| 245 | Ga0207691_10002783 | 3300025940 | Bacteria | 17058 |
| 246 | Ga0207691_10025670 | 3300025940 | Bacteria | 5529 |
| 247 | Ga0207711_10010140 | 3300025941 | Bacteria | 7824 |
| 248 | Ga0207711_10016463 | 3300025941 | Bacteria | 6143 |
| 249 | Ga0207689_10000310 | 3300025942 | Bacteria | 44928 |
| 250 | Ga0207689_10028706 | 3300025942 | Bacteria | 4653 |
| 251 | Ga0207689_10176957 | 3300025942 | Bacteria | 1759 |
| 252 | Ga0207661_10005122 | 3300025944 | Bacteria | 9203 |
| 253 | Ga0207661_10008755 | 3300025944 | Bacteria | 7239 |
| 254 | Ga0207661_10173181 | 3300025944 | Bacteria | 1880 |
| 255 | Ga0207679_10013209 | 3300025945 | Bacteria | 5410 |
| 256 | Ga0207679_10071933 | 3300025945 | Bacteria | 2610 |
| 257 | Ga0207679_10093421 | 3300025945 | Bacteria | 2333 |
| 258 | Ga0207667_10010866 | 3300025949 | Bacteria | 10616 |
| 259 | Ga0207667_10033168 | 3300025949 | Bacteria | 5555 |
| 260 | Ga0207667_10157991 | 3300025949 | Bacteria | 2333 |
| 261 | Ga0207667_10159374 | 3300025949 | Bacteria | 2321 |
| 262 | Ga0207667_10283852 | 3300025949 | Bacteria | 1692 |
| 263 | Ga0207651_10033592 | 3300025960 | Bacteria | 3310 |
| 264 | Ga0207651_10064308 | 3300025960 | Bacteria | 2567 |
| 265 | Ga0207668_10004867 | 3300025972 | Bacteria | 7905 |
| 266 | Ga0207640_10052873 | 3300025981 | Bacteria | 2648 |
| 267 | Ga0207640_10078096 | 3300025981 | Bacteria | 2252 |
| 268 | Ga0207658_10000650 | 3300025986 | Bacteria | 30420 |
| 269 | Ga0207658_10095301 | 3300025986 | Bacteria | 2318 |
| 270 | Ga0207703_10000443 | 3300026035 | Bacteria | 43710 |
| 271 | Ga0207703_10064385 | 3300026035 | Bacteria | 3009 |
| 272 | Ga0207703_10086720 | 3300026035 | Bacteria | 2623 |
| 273 | Ga0207703_10103230 | 3300026035 | Bacteria | 2420 |
| 274 | Ga0207639_10176445 | 3300026041 | Bacteria | 1814 |
| 275 | Ga0207678_10002621 | 3300026067 | Bacteria | 16388 |
| 276 | Ga0207678_10050007 | 3300026067 | Bacteria | 3612 |
| 277 | Ga0207708_10006748 | 3300026075 | Bacteria | 8492 |
| 278 | Ga0207702_10003982 | 3300026078 | Bacteria | 13259 |
| 279 | Ga0207702_10018926 | 3300026078 | Bacteria | 5697 |
| 280 | Ga0207702_10186150 | 3300026078 | Bacteria | 1915 |
| 281 | Ga0207641_10001097 | 3300026088 | Bacteria | 27224 |
| 282 | Ga0207641_10004409 | 3300026088 | Bacteria | 12196 |
| 283 | Ga0207648_10003029 | 3300026089 | Bacteria | 17753 |
| 284 | Ga0207648_10003723 | 3300026089 | Bacteria | 15960 |
| 285 | Ga0207648_10061587 | 3300026089 | Bacteria | 3272 |
| 286 | Ga0207648_10193386 | 3300026089 | Bacteria | 1804 |
| 287 | Ga0207676_10000995 | 3300026095 | Bacteria | 21861 |
| 288 | Ga0207674_10000418 | 3300026116 | Bacteria | 55342 |
| 289 | Ga0207674_10071635 | 3300026116 | Bacteria | 3482 |
| 290 | Ga0207675_100000726 | 3300026118 | Bacteria | 32704 |
| 291 | Ga0207675_100001605 | 3300026118 | Bacteria | 22659 |
| 292 | Ga0207675_100022891 | 3300026118 | Bacteria | 5812 |
| 293 | Ga0207675_100025019 | 3300026118 | Bacteria | 5556 |
| 294 | Ga0207675_100221489 | 3300026118 | Bacteria | 1823 |
| 295 | Ga0207683_10000276 | 3300026121 | Bacteria | 45906 |
| 296 | Ga0207683_10058191 | 3300026121 | Bacteria | 3393 |
| 297 | Ga0207698_10020906 | 3300026142 | Bacteria | 4516 |
| 298 | Ga0207698_10052986 | 3300026142 | Bacteria | 3111 |
| 299 | Ga0209389_1000153 | 3300027296 | Bacteria | 58606 |
| 300 | Ga0209389_1000344 | 3300027296 | Bacteria | 28211 |
| 301 | Ga0209589_1000032 | 3300027357 | Bacteria | 141881 |
| 302 | Ga0209589_1000046 | 3300027357 | Bacteria | 118780 |
| 303 | Ga0209489_100106 | 3300027361 | Bacteria | 118780 |
| 304 | Ga0209489_100936 | 3300027361 | Bacteria | 58586 |
| 305 | Ga0209489_102825 | 3300027361 | Bacteria | 34712 |
| 306 | Ga0209700_100011 | 3300027363 | Bacteria | 362159 |
| 307 | Ga0209700_100105 | 3300027363 | Bacteria | 118780 |
| 308 | Ga0209971_1002480 | 3300027682 | Bacteria | 4434 |
| 309 | Ga0268266_10235284 | 3300028379 | Bacteria | 1689 |
| 310 | Ga0268265_10019896 | 3300028380 | Bacteria | 4675 |
| 311 | Ga0268265_10173167 | 3300028380 | Bacteria | 1847 |
| 312 | Ga0268265_10187123 | 3300028380 | Bacteria | 1785 |
| 313 | Ga0268264_10000566 | 3300028381 | Bacteria | 45480 |
| 314 | Ga0265339_10090003 | 3300031249 | Bacteria | 1610 |
| 315 | Ga0307510_10066110 | 3300033180 | Bacteria | 3654 |
| 316 | Ga0315911_1000013 | 3300033442 | Bacteria | 239334 |
| 317 | Ga0373926_0022812 | 3300035083 | Bacteria | 2172 |
| 318 | Ga0373944_0009550 | 3300035089 | Bacteria | 2633 |
| 319 | Ga0373945_0005059 | 3300035116 | Bacteria | 4202 |
| 320 | Ga0373953_0036137 | 3300035117 | Bacteria | 1944 |
| 321 | Ga0373956_0032778 | 3300035119 | Bacteria | 2281 |
| 322 | Ga0373955_0087051 | 3300035172 | Bacteria | 1775 |
| 323 | Ga0373935_0010225 | 3300035692 | Bacteria | 5622 |
| 324 | Ga0373927_0028242 | 3300035695 | Bacteria | 3659 |
| 325 | Ga0373927_0028563 | 3300035695 | Bacteria | 3639 |
| 326 | Ga0373947_0006308 | 3300035725 | Bacteria | 6892 |
| 327 | Ga0373937_0015351 | 3300036401 | Bacteria | 6774 |
| 328 | Ga0373937_0104963 | 3300036401 | Bacteria | 2625 |
| 329 | Ga0373925_0046505 | 3300037068 | Bacteria | 3227 |
| 330 | Ga0373925_0114575 | 3300037068 | Bacteria | 2087 |
| 331 | Ga0395899_0003854 | 3300037312 | Bacteria | 11827 |
| 332 | Ga0395900_0007892 | 3300037418 | Bacteria | 10962 |
| 333 | Ga0395900_0143158 | 3300037418 | Bacteria | 2447 |
| 334 | Ga0395905_0195793 | 3300037471 | Bacteria | 1895 |
| 335 | Ga0395905_0486770 | 3300037471 | Bacteria | 1133 |
| 336 | Ga0436364_0059646 | 3300037853 | Bacteria | 4718 |
| 337 | Ga0242420_006119 | 3300038996 | Bacteria | 1892 |
| 338 | Ga0436365_0097731 | 3300039437 | Bacteria | 2358 |
| 339 | Ga0451577_0034575 | 3300042876 | Bacteria | 4556 |
| 340 | Ga0466972_0001405 | 3300044658 | Bacteria | 11669 |
| 341 | Ga0466972_0005312 | 3300044658 | Bacteria | 6449 |
| 342 | Ga0466972_0034717 | 3300044658 | Bacteria | 2469 |
| 343 | Ga0466966_0000209 | 3300044684 | Bacteria | 39062 |
| 344 | Ga0466961_0000110 | 3300044693 | Bacteria | 54241 |
| 345 | Ga0466968_0042359 | 3300044735 | Bacteria | 1925 |
| 346 | Ga0466968_0095111 | 3300044735 | Bacteria | 1325 |
| 347 | Ga0466970_0004728 | 3300044765 | Bacteria | 6727 |
| 348 | Ga0466959_0007187 | 3300045049 | Bacteria | 7798 |
| 349 | Ga0466959_0189675 | 3300045049 | Bacteria | 1435 |
| 350 | Ga0451576_0000030 | 3300045051 | Bacteria | 403352 |
| 351 | Ga0451576_0057362 | 3300045051 | Bacteria | 4071 |
| 352 | Ga0466967_0037924 | 3300045976 | Bacteria | 4129 |
| 353 | Ga0495629_0017962 | 3300046459 | Bacteria | 5070 |
| 354 | Ga0495638_0008749 | 3300046460 | Bacteria | 7152 |
| 355 | Ga0495580_0132900 | 3300046472 | Bacteria | 1725 |
| 356 | Ga0495664_0031902 | 3300046477 | Bacteria | 3089 |
| 357 | Ga0495585_0067208 | 3300046492 | Bacteria | 1961 |
| 358 | Ga0495594_0052304 | 3300046499 | Bacteria | 2249 |
| 359 | Ga0495606_0028489 | 3300046507 | Bacteria | 3940 |
| 360 | Ga0495606_0045733 | 3300046507 | Bacteria | 2898 |
| 361 | Ga0495608_0027653 | 3300046511 | Bacteria | 3858 |
| 362 | Ga0495652_0015898 | 3300046529 | Bacteria | 6736 |
| 363 | Ga0495640_0008874 | 3300046533 | Bacteria | 7855 |
| 364 | Ga0495640_0021916 | 3300046533 | Bacteria | 4680 |
| 365 | Ga0495598_0023593 | 3300046537 | Bacteria | 1659 |
| 366 | Ga0495667_0046711 | 3300046559 | Bacteria | 2862 |
| 367 | Ga0495634_0059320 | 3300046642 | Bacteria | 2549 |
| 368 | Ga0495635_0018265 | 3300046663 | Bacteria | 4895 |
| 369 | Ga0495657_0105491 | 3300046675 | Bacteria | 1790 |
| 370 | Ga0495623_0017667 | 3300046679 | Bacteria | 4607 |
| 371 | Ga0495646_0055703 | 3300046680 | Bacteria | 2373 |
| 372 | Ga0495647_0014535 | 3300046681 | Bacteria | 2744 |
| 373 | Ga0495624_0030288 | 3300046690 | Bacteria | 3526 |
| 374 | Ga0495600_0003817 | 3300046809 | Bacteria | 8926 |
| 375 | Ga0495581_0035160 | 3300047315 | Bacteria | 2899 |
| 376 | Ga0495581_0046456 | 3300047315 | Bacteria | 2509 |
| 377 | Ga0495604_0001495 | 3300047317 | Bacteria | 19268 |
| 378 | Ga0495674_0021283 | 3300047319 | Bacteria | 5999 |
| 379 | Ga0495676_0013624 | 3300047321 | Bacteria | 7299 |
| 380 | Ga0495676_0030025 | 3300047321 | Bacteria | 4621 |
| 381 | Ga0495680_0005483 | 3300047322 | Bacteria | 11927 |
| 382 | Ga0495687_011481 | 3300047443 | Bacteria | 4757 |
| 383 | Ga0495673_0037214 | 3300047469 | Bacteria | 2225 |
| 384 | Ga0495684_0011086 | 3300047471 | Bacteria | 6968 |
| 385 | Ga0495684_0042187 | 3300047471 | Bacteria | 3495 |
| 386 | Ga0495602_0026445 | 3300048088 | Bacteria | 5596 |
| 387 | Ga0495602_0059103 | 3300048088 | Bacteria | 3350 |
| 388 | Ga0496102_0214140 | 3300048905 | Bacteria | 1816 |
| 389 | Ga0496102_0298911 | 3300048905 | Bacteria | 1517 |
| 390 | Ga0496103_0179003 | 3300048906 | Bacteria | 1362 |
| 391 | Ga0496104_0001082 | 3300048907 | Bacteria | 23263 |
| 392 | Ga0496105_0001148 | 3300048908 | Bacteria | 18448 |
| 393 | Ga0496105_0122539 | 3300048908 | Bacteria | 2143 |
| 394 | Ga0496106_0098985 | 3300048909 | Bacteria | 2260 |
| 395 | Ga0496108_0001659 | 3300048911 | Bacteria | 17640 |
| 396 | Ga0496108_0134264 | 3300048911 | Bacteria | 2128 |
| 397 | Ga0496108_0290552 | 3300048911 | Bacteria | 1423 |
| 398 | Ga0496109_0052621 | 3300048912 | Bacteria | 3712 |
| 399 | Ga0496109_0100702 | 3300048912 | Bacteria | 2681 |
| 400 | Ga0496109_0392296 | 3300048912 | Bacteria | 1312 |
| 401 | Ga0496110_0008384 | 3300048913 | Bacteria | 8314 |
| 402 | Ga0496111_0083719 | 3300048914 | Bacteria | 2331 |
| 403 | Ga0496112_0000896 | 3300048915 | Bacteria | 21449 |
| 404 | Ga0496112_0002790 | 3300048915 | Bacteria | 14183 |
| 405 | Ga0496112_0145404 | 3300048915 | Bacteria | 2339 |
| 406 | Ga0496113_0000418 | 3300048916 | Bacteria | 20649 |
| 407 | Ga0496115_0001613 | 3300048918 | Bacteria | 16216 |
| 408 | Ga0496120_0066413 | 3300048923 | Bacteria | 1995 |
| 409 | Ga0496126_0014893 | 3300048929 | Bacteria | 7842 |
| 410 | Ga0496126_0025590 | 3300048929 | Bacteria | 5673 |
| 411 | Ga0496126_0078616 | 3300048929 | Bacteria | 2922 |
| 412 | Ga0501031_0000890 | 3300049568 | Bacteria | 18010 |
| 413 | Ga0501031_0022980 | 3300049568 | Bacteria | 4066 |
| 414 | Ga0501032_0000372 | 3300049569 | Bacteria | 37150 |
| 415 | Ga0501032_0029900 | 3300049569 | Bacteria | 3736 |
| 416 | Ga0501032_0064130 | 3300049569 | Bacteria | 2459 |
| 417 | Ga0501033_0000824 | 3300049570 | Bacteria | 28287 |
| 418 | Ga0501033_0028686 | 3300049570 | Bacteria | 4182 |
| 419 | Ga0501033_0040171 | 3300049570 | Bacteria | 3493 |
| 420 | Ga0501033_0057360 | 3300049570 | Bacteria | 2878 |
| 421 | Ga0501033_0148121 | 3300049570 | Bacteria | 1694 |
| 422 | Ga0501033_0214414 | 3300049570 | Bacteria | 1372 |
| 423 | Ga0501034_0000058 | 3300049571 | Bacteria | 198554 |
| 424 | Ga0501034_0128684 | 3300049571 | Bacteria | 2516 |
| 425 | Ga0501036_0000691 | 3300049572 | Bacteria | 24907 |
| 426 | Ga0501037_0001344 | 3300049573 | Bacteria | 18059 |
| 427 | Ga0501038_0000913 | 3300049574 | Bacteria | 26199 |
| 428 | Ga0501038_0008489 | 3300049574 | Bacteria | 9444 |
| 429 | Ga0501039_0051531 | 3300049575 | Bacteria | 3185 |
| 430 | Ga0501039_0156239 | 3300049575 | Bacteria | 1792 |
| 431 | Ga0501040_0005144 | 3300049576 | Bacteria | 8461 |
| 432 | Ga0501042_0066098 | 3300049578 | Bacteria | 2584 |
| 433 | Ga0501043_0000444 | 3300049579 | Bacteria | 37193 |
| 434 | Ga0501043_0012190 | 3300049579 | Bacteria | 6719 |
| 435 | Ga0501043_0051609 | 3300049579 | Bacteria | 3231 |
| 436 | Ga0501043_0125244 | 3300049579 | Bacteria | 2014 |
| 437 | Ga0501046_0029707 | 3300049580 | Bacteria | 4442 |
| 438 | Ga0501047_0000022 | 3300049581 | Bacteria | 249062 |
| 439 | Ga0501047_0025198 | 3300049581 | Bacteria | 5715 |
| 440 | Ga0501047_0042186 | 3300049581 | Bacteria | 4409 |
| 441 | Ga0501047_0045096 | 3300049581 | Bacteria | 4262 |
| 442 | Ga0501048_0000041 | 3300049582 | Bacteria | 62410 |
| 443 | Ga0501067_0000764 | 3300049583 | Bacteria | 17325 |
| 444 | Ga0501067_0001148 | 3300049583 | Bacteria | 14356 |
| 445 | Ga0501068_0000547 | 3300049584 | Bacteria | 19075 |
| 446 | Ga0501068_0071266 | 3300049584 | Bacteria | 2121 |
| 447 | Ga0501069_0043422 | 3300049585 | Bacteria | 2488 |
| 448 | Ga0501070_0004220 | 3300049586 | Bacteria | 12353 |
| 449 | Ga0501070_0112532 | 3300049586 | Bacteria | 2249 |
| 450 | Ga0501070_0134828 | 3300049586 | Bacteria | 2039 |
| 451 | Ga0501072_0003399 | 3300049588 | Bacteria | 11979 |
| 452 | Ga0501072_0214004 | 3300049588 | Bacteria | 1536 |
| 453 | Ga0501073_0000504 | 3300049589 | Bacteria | 27300 |
| 454 | Ga0501074_0000028 | 3300049590 | Bacteria | 67595 |
| 455 | Ga0501074_0000683 | 3300049590 | Bacteria | 21201 |
| 456 | Ga0501077_0075177 | 3300049593 | Bacteria | 2139 |
| 457 | Ga0501079_0002860 | 3300049741 | Bacteria | 12589 |
| 458 | Ga0501079_0083613 | 3300049741 | Bacteria | 2469 |
| 459 | Ga0501080_0012339 | 3300049742 | Bacteria | 7830 |
| 460 | Ga0501083_0001349 | 3300049744 | Bacteria | 16655 |
| 461 | Ga0501035_0001113 | 3300049822 | Bacteria | 28138 |
| 462 | Ga0501035_0015011 | 3300049822 | Bacteria | 7149 |
| 463 | Ga0501035_0098467 | 3300049822 | Bacteria | 2567 |
| 464 | Ga0501035_0146725 | 3300049822 | Bacteria | 2048 |
| 465 | Ga0501044_0000370 | 3300049823 | Bacteria | 56259 |
| 466 | Ga0501044_0024557 | 3300049823 | Bacteria | 6395 |
| 467 | Ga0501044_0239790 | 3300049823 | Bacteria | 1757 |
| 468 | Ga0501045_0006116 | 3300049824 | Bacteria | 8336 |
| 469 | Ga0501045_0014542 | 3300049824 | Bacteria | 5579 |
| 470 | nmdc:mga0yw44_57675_c1 | 3300050492 | Bacteria | 2370 |
| 471 | nmdc:mga0k408_32699_c1 | 3300050493 | Bacteria | 2971 |
| 472 | nmdc:mga0k408_75484_c1 | 3300050493 | Bacteria | 1970 |
| 473 | nmdc:mga05p37_163289_c1 | 3300050507 | Bacteria | 2719 |
| 474 | nmdc:mga08y16_50025_c1 | 3300050511 | Bacteria | 4373 |
| 475 | Ga0495601_0079609 | 3300053077 | Bacteria | 2101 |
| 476 | Ga0500643_000049 | 3300053087 | Bacteria | 147107 |
| 477 | Ga0500557_000192 | 3300053105 | Bacteria | 10407 |
| 478 | Ga0500642_0000056 | 3300053130 | Bacteria | 67746 |
| 479 | Ga0500559_0046016 | 3300053136 | Bacteria | 1912 |
| 480 | Ga0500616_0024201 | 3300053153 | Bacteria | 3377 |
| 481 | Ga0500636_0002629 | 3300053177 | Bacteria | 9982 |
| 482 | Ga0500636_0014012 | 3300053177 | Bacteria | 4713 |
| 483 | Ga0500601_003890 | 3300053737 | Bacteria | 1623 |
| 484 | Ga0501084_0007133 | 3300054114 | Bacteria | 9204 |
| 485 | Ga0501084_0055837 | 3300054114 | Bacteria | 3304 |
| 486 | Ga0501082_0000101 | 3300060353 | Bacteria | 66608 |
| 487 | Ga0501082_0013595 | 3300060353 | Bacteria | 6994 |
| 488 | Ga0501082_0057571 | 3300060353 | Bacteria | 3348 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037471 | Ga0395905_0486770 | Ga0395905_0486770_13_1122 | 360 |
| 2 | 3300049570 | Ga0501033_0148121 | Ga0501033_0148121_573_1682 | 360 |
| 3 | 3300025949 | Ga0207667_10283852 | Ga0207667_102838521 | 366 |
| 4 | iso_pu_bacteria | 2885374607 | 2885377939 | 392 |
| 5 | 3300044735 | Ga0466968_0095111 | Ga0466968_0095111_91_1305 | 396 |
| 6 | iso_pu_bacteria | 2906610324 | 2906613753 | 401 |
| 7 | 3300050493 | nmdc:mga0k408_32699_c1 | nmdc:mga0k408_32699_c1_453_1766 | 405 |
| 8 | 3300025942 | Ga0207689_10176957 | Ga0207689_101769571 | 407 |
| 9 | 3300025972 | Ga0207668_10004867 | Ga0207668_100048674 | 407 |
| 10 | 3300005353 | Ga0070669_100176757 | Ga0070669_1001767572 | 408 |
| 11 | 3300005354 | Ga0070675_100022720 | Ga0070675_1000227203 | 408 |
| 12 | 3300005618 | Ga0068864_100042872 | Ga0068864_1000428722 | 408 |
| 13 | 3300005834 | Ga0068851_10002809 | Ga0068851_100028094 | 408 |
| 14 | 3300006237 | Ga0097621_100047547 | Ga0097621_1000475473 | 408 |
| 15 | 3300014969 | Ga0157376_10162542 | Ga0157376_101625422 | 408 |
| 16 | 3300025893 | Ga0207682_10000097 | Ga0207682_1000009737 | 408 |
| 17 | 3300025907 | Ga0207645_10022990 | Ga0207645_100229901 | 408 |
| 18 | 3300025908 | Ga0207643_10015498 | Ga0207643_100154982 | 408 |
| 19 | 3300025926 | Ga0207659_10103169 | Ga0207659_101031692 | 408 |
| 20 | 3300025940 | Ga0207691_10000331 | Ga0207691_1000033137 | 408 |
| 21 | 3300025986 | Ga0207658_10095301 | Ga0207658_100953011 | 408 |
| 22 | 3300026089 | Ga0207648_10061587 | Ga0207648_100615872 | 408 |
| 23 | 3300026121 | Ga0207683_10000276 | Ga0207683_100002766 | 408 |
| 24 | 3300028380 | Ga0268265_10187123 | Ga0268265_101871231 | 408 |
| 25 | 3300013297 | Ga0157378_10028724 | Ga0157378_100287242 | 409 |
| 26 | 3300014325 | Ga0163163_10210410 | Ga0163163_102104101 | 409 |
| 27 | 3300025910 | Ga0207684_10117214 | Ga0207684_101172142 | 409 |
| 28 | 3300025927 | Ga0207687_10145749 | Ga0207687_101457492 | 409 |
| 29 | 3300028379 | Ga0268266_10235284 | Ga0268266_102352842 | 409 |
| 30 | 3300049575 | Ga0501039_0156239 | Ga0501039_0156239_49_1362 | 409 |
| 31 | 3300049588 | Ga0501072_0214004 | Ga0501072_0214004_74_1387 | 409 |
| 32 | 3300009545 | Ga0105237_10030893 | Ga0105237_100308935 | 410 |
| 33 | 3300025939 | Ga0207665_10187602 | Ga0207665_101876021 | 411 |
| 34 | 3300053136 | Ga0500559_0046016 | Ga0500559_0046016_174_1445 | 411 |
| 35 | 3300013306 | Ga0163162_10107477 | Ga0163162_101074772 | 413 |
| 36 | 3300037068 | Ga0373925_0114575 | Ga0373925_0114575_735_2000 | 413 |
| 37 | 3300044658 | Ga0466972_0001405 | Ga0466972_0001405_6797_8062 | 413 |
| 38 | 3300046460 | Ga0495638_0008749 | Ga0495638_0008749_3303_4568 | 413 |
| 39 | 3300046477 | Ga0495664_0031902 | Ga0495664_0031902_37_1302 | 413 |
| 40 | 3300046559 | Ga0495667_0046711 | Ga0495667_0046711_885_2150 | 413 |
| 41 | 3300046675 | Ga0495657_0105491 | Ga0495657_0105491_59_1324 | 413 |
| 42 | 3300046679 | Ga0495623_0017667 | Ga0495623_0017667_2992_4257 | 413 |
| 43 | 3300046809 | Ga0495600_0003817 | Ga0495600_0003817_4836_6101 | 413 |
| 44 | 3300047317 | Ga0495604_0001495 | Ga0495604_0001495_13816_15081 | 413 |
| 45 | 3300047322 | Ga0495680_0005483 | Ga0495680_0005483_6820_8085 | 413 |
| 46 | 3300047443 | Ga0495687_011481 | Ga0495687_011481_3449_4714 | 413 |
| 47 | 3300047469 | Ga0495673_0037214 | Ga0495673_0037214_112_1377 | 413 |
| 48 | 3300047471 | Ga0495684_0042187 | Ga0495684_0042187_262_1527 | 413 |
| 49 | 3300048088 | Ga0495602_0026445 | Ga0495602_0026445_750_2015 | 413 |
| 50 | 3300048915 | Ga0496112_0145404 | Ga0496112_0145404_702_1967 | 413 |
| 51 | 3300048923 | Ga0496120_0066413 | Ga0496120_0066413_567_1832 | 413 |
| 52 | 3300053087 | Ga0500643_000049 | Ga0500643_000049_55537_56802 | 413 |
| 53 | 3300053105 | Ga0500557_000192 | Ga0500557_000192_2069_3334 | 413 |
| 54 | 3300053130 | Ga0500642_0000056 | Ga0500642_0000056_6854_8119 | 413 |
| 55 | 3300053153 | Ga0500616_0024201 | Ga0500616_0024201_209_1474 | 413 |
| 56 | 3300053737 | Ga0500601_003890 | Ga0500601_003890_330_1595 | 413 |
| 57 | iso_pu_bacteria | 2854681122 | 2854681327 | 413 |
| 58 | 3300005436 | Ga0070713_100021807 | Ga0070713_1000218071 | 414 |
| 59 | 3300005439 | Ga0070711_100030366 | Ga0070711_1000303661 | 414 |
| 60 | 3300006028 | Ga0070717_10190093 | Ga0070717_101900931 | 414 |
| 61 | 3300006175 | Ga0070712_100152497 | Ga0070712_1001524972 | 414 |
| 62 | 3300025915 | Ga0207693_10067049 | Ga0207693_100670491 | 414 |
| 63 | 3300025928 | Ga0207700_10013199 | Ga0207700_100131994 | 414 |
| 64 | 3300048912 | Ga0496109_0392296 | Ga0496109_0392296_11_1288 | 414 |
| 65 | 3300005467 | Ga0070706_100065313 | Ga0070706_1000653133 | 417 |
| 66 | 3300005468 | Ga0070707_100072841 | Ga0070707_1000728412 | 417 |
| 67 | 3300025922 | Ga0207646_10018727 | Ga0207646_100187278 | 417 |
| 68 | 3300048929 | Ga0496126_0014893 | Ga0496126_0014893_3176_4495 | 417 |
| 69 | 3300005983 | Ga0081540_1024850 | Ga0081540_10248501 | 418 |
| 70 | 3300006944 | Ga0099823_1009115 | Ga0099823_10091152 | 418 |
| 71 | 3300027296 | Ga0209389_1000153 | Ga0209389_10001538 | 418 |
| 72 | 3300027361 | Ga0209489_100936 | Ga0209489_10093659 | 418 |
| 73 | 3300027363 | Ga0209700_100011 | Ga0209700_10001192 | 418 |
| 74 | 3300033442 | Ga0315911_1000013 | Ga0315911_100001389 | 418 |
| 75 | 3300044684 | Ga0466966_0000209 | Ga0466966_0000209_8659_9978 | 418 |
| 76 | 3300044693 | Ga0466961_0000110 | Ga0466961_0000110_45147_46466 | 418 |
| 77 | 3300045049 | Ga0466959_0007187 | Ga0466959_0007187_5310_6629 | 418 |
| 78 | 3300048909 | Ga0496106_0098985 | Ga0496106_0098985_98_1441 | 418 |
| 79 | iso_pu_bacteria | 2818991461 | 2819687911 | 418 |
| 80 | 3300005434 | Ga0070709_10002152 | Ga0070709_100021522 | 419 |
| 81 | 3300006173 | Ga0070716_100129097 | Ga0070716_1001290971 | 419 |
| 82 | 3300025906 | Ga0207699_10091799 | Ga0207699_100917992 | 419 |
| 83 | 3300045049 | Ga0466959_0189675 | Ga0466959_0189675_91_1389 | 419 |
| 84 | 3300003215 | JGI25153J46596_10007816 | JGI25153J46596_100078161 | 420 |
| 85 | 3300005456 | Ga0070678_100023376 | Ga0070678_1000233762 | 420 |
| 86 | 3300009176 | Ga0105242_10040904 | Ga0105242_100409043 | 420 |
| 87 | 3300014968 | Ga0157379_10069172 | Ga0157379_100691722 | 420 |
| 88 | 3300025295 | Ga0209564_1009228 | Ga0209564_10092284 | 420 |
| 89 | 3300025297 | Ga0209758_1000443 | Ga0209758_100044361 | 420 |
| 90 | 3300025899 | Ga0207642_10031724 | Ga0207642_100317242 | 420 |
| 91 | 3300025938 | Ga0207704_10132220 | Ga0207704_101322202 | 420 |
| 92 | 3300026121 | Ga0207683_10058191 | Ga0207683_100581912 | 420 |
| 93 | 3300049570 | Ga0501033_0028686 | Ga0501033_0028686_2706_4037 | 420 |
| 94 | iso_pu_bacteria | 2643221603 | 2644027976 | 420 |
| 95 | 3300003781 | Ga0055536_1006721 | Ga0055536_10067213 | 421 |
| 96 | 3300005467 | Ga0070706_100129477 | Ga0070706_1001294771 | 421 |
| 97 | 3300005471 | Ga0070698_100075213 | Ga0070698_1000752131 | 421 |
| 98 | 3300025910 | Ga0207684_10060801 | Ga0207684_100608012 | 421 |
| 99 | 3300035692 | Ga0373935_0010225 | Ga0373935_0010225_2446_3756 | 421 |
| 100 | 3300035695 | Ga0373927_0028563 | Ga0373927_0028563_876_2186 | 421 |
| 101 | 3300037068 | Ga0373925_0046505 | Ga0373925_0046505_1895_3205 | 421 |
| 102 | 3300005563 | Ga0068855_100110816 | Ga0068855_1001108163 | 422 |
| 103 | 3300005983 | Ga0081540_1004334 | Ga0081540_100433410 | 422 |
| 104 | 3300009093 | Ga0105240_10013166 | Ga0105240_100131661 | 422 |
| 105 | 3300025913 | Ga0207695_10338442 | Ga0207695_103384421 | 422 |
| 106 | 3300025919 | Ga0207657_10094822 | Ga0207657_100948223 | 422 |
| 107 | 3300025924 | Ga0207694_10074789 | Ga0207694_100747892 | 422 |
| 108 | 3300025949 | Ga0207667_10033168 | Ga0207667_100331684 | 422 |
| 109 | 3300044658 | Ga0466972_0034717 | Ga0466972_0034717_458_1765 | 422 |
| 110 | 3300044735 | Ga0466968_0042359 | Ga0466968_0042359_558_1865 | 422 |
| 111 | iso_pu_bacteria | 2900577576 | 2900580149 | 422 |
| 112 | 3300003781 | Ga0055536_1006610 | Ga0055536_10066103 | 423 |
| 113 | 3300025292 | Ga0209676_1000097 | Ga0209676_100009783 | 423 |
| 114 | 3300042876 | Ga0451577_0034575 | Ga0451577_0034575_2949_4259 | 423 |
| 115 | 3300045051 | Ga0451576_0000030 | Ga0451576_0000030_207771_209081 | 423 |
| 116 | 3300009093 | Ga0105240_10056620 | Ga0105240_100566202 | 424 |
| 117 | 3300009545 | Ga0105237_10192243 | Ga0105237_101922431 | 424 |
| 118 | 3300025913 | Ga0207695_10187513 | Ga0207695_101875131 | 424 |
| 119 | 3300025914 | Ga0207671_10167552 | Ga0207671_101675521 | 424 |
| 120 | 3300026041 | Ga0207639_10176445 | Ga0207639_101764452 | 424 |
| 121 | 3300037312 | Ga0395899_0003854 | Ga0395899_0003854_5731_7041 | 424 |
| 122 | 3300037471 | Ga0395905_0195793 | Ga0395905_0195793_142_1452 | 424 |
| 123 | 3300046537 | Ga0495598_0023593 | Ga0495598_0023593_97_1407 | 424 |
| 124 | 3300044765 | Ga0466970_0004728 | Ga0466970_0004728_575_1897 | 425 |
| 125 | iso_pu_bacteria | 2513237096 | 2513660977 | 425 |
| 126 | iso_pu_bacteria | 2513237137 | 2513860468 | 425 |
| 127 | iso_pu_bacteria | 2513237145 | 2513922719 | 425 |
| 128 | iso_pu_bacteria | 2517572143 | 2517888724 | 425 |
| 129 | iso_pu_bacteria | 2524023228 | 2524538819 | 425 |
| 130 | iso_pu_bacteria | 2667528175 | 2671119897 | 425 |
| 131 | iso_pu_bacteria | 2728368998 | 2728754888 | 425 |
| 132 | iso_pu_bacteria | 2791355197 | 2793067543 | 425 |
| 133 | iso_pu_bacteria | 2903748898 | 2903756378 | 425 |
| 134 | iso_pu_bacteria | 2904699407 | 2904708853 | 425 |
| 135 | iso_pu_bacteria | 2906635258 | 2906640094 | 425 |
| 136 | iso_pu_bacteria | 2906660503 | 2906667488 | 425 |
| 137 | iso_pu_bacteria | 2908739725 | 2908747317 | 425 |
| 138 | iso_pu_bacteria | 2922425934 | 2922434407 | 425 |
| 139 | iso_pu_bacteria | 2935630451 | 2935635460 | 425 |
| 140 | iso_pu_bacteria | 2941507105 | 2941512243 | 425 |
| 141 | iso_pu_bacteria | 2941515067 | 2941519944 | 425 |
| 142 | iso_pu_bacteria | 2941523033 | 2941528115 | 425 |
| 143 | iso_pu_bacteria | 3005474847 | 3005474955 | 425 |
| 144 | iso_pu_bacteria | 8006933436 | 8006936377 | 425 |
| 145 | iso_pu_bacteria | 8006973647 | 8006976346 | 425 |
| 146 | iso_pu_bacteria | 8019555841 | 8019562283 | 425 |
| 147 | iso_pu_bacteria | 8019565922 | 8019572353 | 425 |
| 148 | iso_pu_bacteria | 8056681323 | 8056687499 | 425 |
| 149 | 3300005458 | Ga0070681_10041429 | Ga0070681_100414292 | 426 |
| 150 | 3300005530 | Ga0070679_100034699 | Ga0070679_1000346991 | 426 |
| 151 | 3300014325 | Ga0163163_10129302 | Ga0163163_101293022 | 426 |
| 152 | 3300025921 | Ga0207652_10212846 | Ga0207652_102128462 | 426 |
| 153 | 3300025949 | Ga0207667_10159374 | Ga0207667_101593742 | 426 |
| 154 | 3300027296 | Ga0209389_1000344 | Ga0209389_10003449 | 426 |
| 155 | 3300027357 | Ga0209589_1000032 | Ga0209589_1000032108 | 426 |
| 156 | 3300027361 | Ga0209489_102825 | Ga0209489_10282532 | 426 |
| 157 | 3300037853 | Ga0436364_0059646 | Ga0436364_0059646_2602_3915 | 426 |
| 158 | 3300047315 | Ga0495581_0035160 | Ga0495581_0035160_742_2055 | 426 |
| 159 | 3300047321 | Ga0495676_0030025 | Ga0495676_0030025_1008_2321 | 426 |
| 160 | 3300048907 | Ga0496104_0001082 | Ga0496104_0001082_6543_7856 | 426 |
| 161 | 3300048908 | Ga0496105_0001148 | Ga0496105_0001148_5856_7169 | 426 |
| 162 | 3300048911 | Ga0496108_0001659 | Ga0496108_0001659_13937_15250 | 426 |
| 163 | 3300048913 | Ga0496110_0008384 | Ga0496110_0008384_3192_4505 | 426 |
| 164 | 3300048915 | Ga0496112_0000896 | Ga0496112_0000896_4857_6170 | 426 |
| 165 | 3300048916 | Ga0496113_0000418 | Ga0496113_0000418_11047_12360 | 426 |
| 166 | 3300048918 | Ga0496115_0001613 | Ga0496115_0001613_2805_4118 | 426 |
| 167 | iso_pu_bacteria | 2513237098 | 2513677588 | 426 |
| 168 | iso_pu_bacteria | 2513237104 | 2513719800 | 426 |
| 169 | iso_pu_bacteria | 2524023210 | 2524467399 | 426 |
| 170 | iso_pu_bacteria | 2643221651 | 2644290859 | 426 |
| 171 | iso_pu_bacteria | 2885383462 | 2885391013 | 426 |
| 172 | iso_pu_bacteria | 2903768456 | 2903772359 | 426 |
| 173 | iso_pu_bacteria | 2904690495 | 2904690615 | 426 |
| 174 | iso_pu_bacteria | 2908756301 | 2908756395 | 426 |
| 175 | iso_pu_bacteria | 2932794094 | 2932794431 | 426 |
| 176 | iso_pu_bacteria | 2932801729 | 2932806713 | 426 |
| 177 | iso_pu_bacteria | 2935883170 | 2935888484 | 426 |
| 178 | iso_pu_bacteria | 8056689827 | 8056695307 | 426 |
| 179 | 3300003215 | JGI25153J46596_10007902 | JGI25153J46596_100079023 | 427 |
| 180 | 3300003215 | JGI25153J46596_10017295 | JGI25153J46596_100172953 | 427 |
| 181 | 3300005937 | Ga0081455_10050878 | Ga0081455_100508783 | 427 |
| 182 | 3300006353 | Ga0075370_10021464 | Ga0075370_100214642 | 427 |
| 183 | 3300010375 | Ga0105239_10218890 | Ga0105239_102188902 | 427 |
| 184 | 3300025297 | Ga0209758_1004610 | Ga0209758_10046105 | 427 |
| 185 | 3300025297 | Ga0209758_1008688 | Ga0209758_10086887 | 427 |
| 186 | 3300025911 | Ga0207654_10023650 | Ga0207654_100236503 | 427 |
| 187 | 3300025913 | Ga0207695_10000107 | Ga0207695_10000107112 | 427 |
| 188 | 3300025914 | Ga0207671_10006765 | Ga0207671_100067655 | 427 |
| 189 | 3300025927 | Ga0207687_10072474 | Ga0207687_100724742 | 427 |
| 190 | 3300037418 | Ga0395900_0007892 | Ga0395900_0007892_3438_4754 | 427 |
| 191 | 3300039437 | Ga0436365_0097731 | Ga0436365_0097731_751_2067 | 427 |
| 192 | 3300045976 | Ga0466967_0037924 | Ga0466967_0037924_308_1624 | 427 |
| 193 | 3300046507 | Ga0495606_0045733 | Ga0495606_0045733_1018_2577 | 427 |
| 194 | 3300053177 | Ga0500636_0014012 | Ga0500636_0014012_2925_4244 | 427 |
| 195 | 3300005290 | Ga0065712_10015671 | Ga0065712_100156712 | 428 |
| 196 | 3300005293 | Ga0065715_10133360 | Ga0065715_101333602 | 428 |
| 197 | 3300005327 | Ga0070658_10035380 | Ga0070658_100353802 | 428 |
| 198 | 3300005327 | Ga0070658_10064977 | Ga0070658_100649773 | 428 |
| 199 | 3300005329 | Ga0070683_100008196 | Ga0070683_1000081968 | 428 |
| 200 | 3300005329 | Ga0070683_100058369 | Ga0070683_1000583693 | 428 |
| 201 | 3300005331 | Ga0070670_100003522 | Ga0070670_1000035225 | 428 |
| 202 | 3300005331 | Ga0070670_100009835 | Ga0070670_1000098354 | 428 |
| 203 | 3300005334 | Ga0068869_100001725 | Ga0068869_1000017255 | 428 |
| 204 | 3300005335 | Ga0070666_10040404 | Ga0070666_100404042 | 428 |
| 205 | 3300005339 | Ga0070660_100002704 | Ga0070660_1000027043 | 428 |
| 206 | 3300005344 | Ga0070661_100001413 | Ga0070661_1000014135 | 428 |
| 207 | 3300005344 | Ga0070661_100017823 | Ga0070661_1000178232 | 428 |
| 208 | 3300005347 | Ga0070668_100013749 | Ga0070668_1000137493 | 428 |
| 209 | 3300005347 | Ga0070668_100132856 | Ga0070668_1001328562 | 428 |
| 210 | 3300005353 | Ga0070669_100029674 | Ga0070669_1000296742 | 428 |
| 211 | 3300005354 | Ga0070675_100060283 | Ga0070675_1000602831 | 428 |
| 212 | 3300005355 | Ga0070671_100007541 | Ga0070671_1000075413 | 428 |
| 213 | 3300005364 | Ga0070673_100021366 | Ga0070673_1000213661 | 428 |
| 214 | 3300005365 | Ga0070688_100064519 | Ga0070688_1000645192 | 428 |
| 215 | 3300005366 | Ga0070659_100018465 | Ga0070659_1000184653 | 428 |
| 216 | 3300005435 | Ga0070714_100013143 | Ga0070714_1000131432 | 428 |
| 217 | 3300005436 | Ga0070713_100000045 | Ga0070713_10000004549 | 428 |
| 218 | 3300005455 | Ga0070663_100131112 | Ga0070663_1001311122 | 428 |
| 219 | 3300005457 | Ga0070662_100070087 | Ga0070662_1000700872 | 428 |
| 220 | 3300005459 | Ga0068867_100027466 | Ga0068867_1000274665 | 428 |
| 221 | 3300005467 | Ga0070706_100025322 | Ga0070706_1000253223 | 428 |
| 222 | 3300005543 | Ga0070672_100052703 | Ga0070672_1000527031 | 428 |
| 223 | 3300005543 | Ga0070672_100054150 | Ga0070672_1000541502 | 428 |
| 224 | 3300005548 | Ga0070665_100150070 | Ga0070665_1001500702 | 428 |
| 225 | 3300005563 | Ga0068855_100051723 | Ga0068855_1000517233 | 428 |
| 226 | 3300005563 | Ga0068855_100072739 | Ga0068855_1000727392 | 428 |
| 227 | 3300005564 | Ga0070664_100003038 | Ga0070664_1000030382 | 428 |
| 228 | 3300005564 | Ga0070664_100102378 | Ga0070664_1001023782 | 428 |
| 229 | 3300005577 | Ga0068857_100000810 | Ga0068857_10000081013 | 428 |
| 230 | 3300005577 | Ga0068857_100002261 | Ga0068857_10000226113 | 428 |
| 231 | 3300005578 | Ga0068854_100069318 | Ga0068854_1000693182 | 428 |
| 232 | 3300005614 | Ga0068856_100014288 | Ga0068856_1000142884 | 428 |
| 233 | 3300005614 | Ga0068856_100075629 | Ga0068856_1000756292 | 428 |
| 234 | 3300005616 | Ga0068852_100001129 | Ga0068852_1000011294 | 428 |
| 235 | 3300005617 | Ga0068859_100000466 | Ga0068859_10000046614 | 428 |
| 236 | 3300005617 | Ga0068859_100225633 | Ga0068859_1002256332 | 428 |
| 237 | 3300005618 | Ga0068864_100001455 | Ga0068864_10000145514 | 428 |
| 238 | 3300005618 | Ga0068864_100023418 | Ga0068864_1000234183 | 428 |
| 239 | 3300005618 | Ga0068864_100170161 | Ga0068864_1001701612 | 428 |
| 240 | 3300005719 | Ga0068861_100011143 | Ga0068861_1000111432 | 428 |
| 241 | 3300005719 | Ga0068861_100031998 | Ga0068861_1000319982 | 428 |
| 242 | 3300005719 | Ga0068861_100045614 | Ga0068861_1000456142 | 428 |
| 243 | 3300005834 | Ga0068851_10039586 | Ga0068851_100395862 | 428 |
| 244 | 3300005841 | Ga0068863_100000829 | Ga0068863_10000082924 | 428 |
| 245 | 3300005841 | Ga0068863_100028656 | Ga0068863_1000286562 | 428 |
| 246 | 3300005842 | Ga0068858_100000624 | Ga0068858_10000062414 | 428 |
| 247 | 3300005842 | Ga0068858_100025937 | Ga0068858_1000259372 | 428 |
| 248 | 3300005843 | Ga0068860_100000782 | Ga0068860_10000078214 | 428 |
| 249 | 3300005844 | Ga0068862_100007370 | Ga0068862_1000073702 | 428 |
| 250 | 3300005844 | Ga0068862_100046933 | Ga0068862_1000469332 | 428 |
| 251 | 3300005985 | Ga0081539_10012946 | Ga0081539_100129462 | 428 |
| 252 | 3300005985 | Ga0081539_10073239 | Ga0081539_100732392 | 428 |
| 253 | 3300006871 | Ga0075434_100073727 | Ga0075434_1000737272 | 428 |
| 254 | 3300006881 | Ga0068865_100138541 | Ga0068865_1001385412 | 428 |
| 255 | 3300006931 | Ga0097620_100000466 | Ga0097620_10000046614 | 428 |
| 256 | 3300006931 | Ga0097620_100225639 | Ga0097620_1002256392 | 428 |
| 257 | 3300009093 | Ga0105240_10001807 | Ga0105240_1000180730 | 428 |
| 258 | 3300009094 | Ga0111539_10104860 | Ga0111539_101048603 | 428 |
| 259 | 3300009098 | Ga0105245_10122043 | Ga0105245_101220432 | 428 |
| 260 | 3300009101 | Ga0105247_10094955 | Ga0105247_100949551 | 428 |
| 261 | 3300009148 | Ga0105243_10090220 | Ga0105243_100902203 | 428 |
| 262 | 3300009176 | Ga0105242_10128297 | Ga0105242_101282972 | 428 |
| 263 | 3300009177 | Ga0105248_10000736 | Ga0105248_1000073614 | 428 |
| 264 | 3300009177 | Ga0105248_10019836 | Ga0105248_100198364 | 428 |
| 265 | 3300009551 | Ga0105238_10001317 | Ga0105238_1000131713 | 428 |
| 266 | 3300013102 | Ga0157371_10060192 | Ga0157371_100601922 | 428 |
| 267 | 3300013104 | Ga0157370_10025696 | Ga0157370_100256967 | 428 |
| 268 | 3300013105 | Ga0157369_10026262 | Ga0157369_100262623 | 428 |
| 269 | 3300013105 | Ga0157369_10075412 | Ga0157369_100754122 | 428 |
| 270 | 3300013297 | Ga0157378_10234577 | Ga0157378_102345771 | 428 |
| 271 | 3300013306 | Ga0163162_10114095 | Ga0163162_101140952 | 428 |
| 272 | 3300013306 | Ga0163162_10176752 | Ga0163162_101767522 | 428 |
| 273 | 3300013307 | Ga0157372_10062406 | Ga0157372_100624062 | 428 |
| 274 | 3300013307 | Ga0157372_10101310 | Ga0157372_101013102 | 428 |
| 275 | 3300013308 | Ga0157375_10004326 | Ga0157375_100043266 | 428 |
| 276 | 3300013308 | Ga0157375_10041140 | Ga0157375_100411402 | 428 |
| 277 | 3300013308 | Ga0157375_10135677 | Ga0157375_101356772 | 428 |
| 278 | 3300014325 | Ga0163163_10171872 | Ga0163163_101718722 | 428 |
| 279 | 3300014326 | Ga0157380_10030766 | Ga0157380_100307662 | 428 |
| 280 | 3300014326 | Ga0157380_10227029 | Ga0157380_102270292 | 428 |
| 281 | 3300014968 | Ga0157379_10000233 | Ga0157379_1000023314 | 428 |
| 282 | 3300014968 | Ga0157379_10180524 | Ga0157379_101805242 | 428 |
| 283 | 3300017792 | Ga0163161_10070747 | Ga0163161_100707472 | 428 |
| 284 | 3300025315 | Ga0207697_10000068 | Ga0207697_1000006821 | 428 |
| 285 | 3300025321 | Ga0207656_10008744 | Ga0207656_100087442 | 428 |
| 286 | 3300025321 | Ga0207656_10042997 | Ga0207656_100429972 | 428 |
| 287 | 3300025893 | Ga0207682_10000266 | Ga0207682_1000026619 | 428 |
| 288 | 3300025899 | Ga0207642_10088050 | Ga0207642_100880501 | 428 |
| 289 | 3300025901 | Ga0207688_10105033 | Ga0207688_101050332 | 428 |
| 290 | 3300025903 | Ga0207680_10042685 | Ga0207680_100426852 | 428 |
| 291 | 3300025907 | Ga0207645_10004546 | Ga0207645_100045464 | 428 |
| 292 | 3300025907 | Ga0207645_10023460 | Ga0207645_100234603 | 428 |
| 293 | 3300025908 | Ga0207643_10010998 | Ga0207643_100109981 | 428 |
| 294 | 3300025909 | Ga0207705_10060071 | Ga0207705_100600712 | 428 |
| 295 | 3300025910 | Ga0207684_10009875 | Ga0207684_100098757 | 428 |
| 296 | 3300025913 | Ga0207695_10054785 | Ga0207695_100547853 | 428 |
| 297 | 3300025915 | Ga0207693_10236362 | Ga0207693_102363621 | 428 |
| 298 | 3300025923 | Ga0207681_10095540 | Ga0207681_100955401 | 428 |
| 299 | 3300025924 | Ga0207694_10003964 | Ga0207694_100039642 | 428 |
| 300 | 3300025925 | Ga0207650_10008850 | Ga0207650_100088502 | 428 |
| 301 | 3300025925 | Ga0207650_10026884 | Ga0207650_100268843 | 428 |
| 302 | 3300025925 | Ga0207650_10034291 | Ga0207650_100342912 | 428 |
| 303 | 3300025925 | Ga0207650_10046657 | Ga0207650_100466572 | 428 |
| 304 | 3300025926 | Ga0207659_10037471 | Ga0207659_100374713 | 428 |
| 305 | 3300025926 | Ga0207659_10043335 | Ga0207659_100433352 | 428 |
| 306 | 3300025928 | Ga0207700_10000051 | Ga0207700_1000005148 | 428 |
| 307 | 3300025929 | Ga0207664_10033510 | Ga0207664_100335103 | 428 |
| 308 | 3300025932 | Ga0207690_10026056 | Ga0207690_100260563 | 428 |
| 309 | 3300025933 | Ga0207706_10033238 | Ga0207706_100332383 | 428 |
| 310 | 3300025933 | Ga0207706_10070833 | Ga0207706_100708332 | 428 |
| 311 | 3300025933 | Ga0207706_10076316 | Ga0207706_100763161 | 428 |
| 312 | 3300025933 | Ga0207706_10236260 | Ga0207706_102362601 | 428 |
| 313 | 3300025934 | Ga0207686_10123188 | Ga0207686_101231882 | 428 |
| 314 | 3300025936 | Ga0207670_10057680 | Ga0207670_100576802 | 428 |
| 315 | 3300025937 | Ga0207669_10018077 | Ga0207669_100180775 | 428 |
| 316 | 3300025938 | Ga0207704_10030438 | Ga0207704_100304381 | 428 |
| 317 | 3300025938 | Ga0207704_10142158 | Ga0207704_101421581 | 428 |
| 318 | 3300025940 | Ga0207691_10002783 | Ga0207691_1000278312 | 428 |
| 319 | 3300025940 | Ga0207691_10025670 | Ga0207691_100256702 | 428 |
| 320 | 3300025941 | Ga0207711_10010140 | Ga0207711_100101406 | 428 |
| 321 | 3300025941 | Ga0207711_10016463 | Ga0207711_100164632 | 428 |
| 322 | 3300025942 | Ga0207689_10000310 | Ga0207689_1000031034 | 428 |
| 323 | 3300025942 | Ga0207689_10028706 | Ga0207689_100287062 | 428 |
| 324 | 3300025944 | Ga0207661_10005122 | Ga0207661_100051223 | 428 |
| 325 | 3300025944 | Ga0207661_10173181 | Ga0207661_101731812 | 428 |
| 326 | 3300025945 | Ga0207679_10013209 | Ga0207679_100132092 | 428 |
| 327 | 3300025945 | Ga0207679_10071933 | Ga0207679_100719332 | 428 |
| 328 | 3300025945 | Ga0207679_10093421 | Ga0207679_100934212 | 428 |
| 329 | 3300025949 | Ga0207667_10010866 | Ga0207667_100108668 | 428 |
| 330 | 3300025949 | Ga0207667_10157991 | Ga0207667_101579912 | 428 |
| 331 | 3300025960 | Ga0207651_10033592 | Ga0207651_100335922 | 428 |
| 332 | 3300025960 | Ga0207651_10064308 | Ga0207651_100643082 | 428 |
| 333 | 3300025981 | Ga0207640_10052873 | Ga0207640_100528731 | 428 |
| 334 | 3300025981 | Ga0207640_10078096 | Ga0207640_100780961 | 428 |
| 335 | 3300025986 | Ga0207658_10000650 | Ga0207658_100006506 | 428 |
| 336 | 3300026035 | Ga0207703_10000443 | Ga0207703_1000044322 | 428 |
| 337 | 3300026035 | Ga0207703_10064385 | Ga0207703_100643852 | 428 |
| 338 | 3300026035 | Ga0207703_10086720 | Ga0207703_100867202 | 428 |
| 339 | 3300026035 | Ga0207703_10103230 | Ga0207703_101032302 | 428 |
| 340 | 3300026067 | Ga0207678_10002621 | Ga0207678_100026212 | 428 |
| 341 | 3300026067 | Ga0207678_10050007 | Ga0207678_100500073 | 428 |
| 342 | 3300026075 | Ga0207708_10006748 | Ga0207708_100067486 | 428 |
| 343 | 3300026078 | Ga0207702_10003982 | Ga0207702_100039829 | 428 |
| 344 | 3300026078 | Ga0207702_10018926 | Ga0207702_100189262 | 428 |
| 345 | 3300026088 | Ga0207641_10001097 | Ga0207641_100010978 | 428 |
| 346 | 3300026088 | Ga0207641_10004409 | Ga0207641_100044093 | 428 |
| 347 | 3300026089 | Ga0207648_10003029 | Ga0207648_100030292 | 428 |
| 348 | 3300026089 | Ga0207648_10003723 | Ga0207648_100037232 | 428 |
| 349 | 3300026089 | Ga0207648_10193386 | Ga0207648_101933862 | 428 |
| 350 | 3300026095 | Ga0207676_10000995 | Ga0207676_1000099514 | 428 |
| 351 | 3300026116 | Ga0207674_10000418 | Ga0207674_1000041831 | 428 |
| 352 | 3300026116 | Ga0207674_10071635 | Ga0207674_100716352 | 428 |
| 353 | 3300026118 | Ga0207675_100000726 | Ga0207675_1000007265 | 428 |
| 354 | 3300026118 | Ga0207675_100001605 | Ga0207675_1000016057 | 428 |
| 355 | 3300026118 | Ga0207675_100022891 | Ga0207675_1000228914 | 428 |
| 356 | 3300026118 | Ga0207675_100025019 | Ga0207675_1000250195 | 428 |
| 357 | 3300026118 | Ga0207675_100221489 | Ga0207675_1002214891 | 428 |
| 358 | 3300026142 | Ga0207698_10020906 | Ga0207698_100209064 | 428 |
| 359 | 3300026142 | Ga0207698_10052986 | Ga0207698_100529862 | 428 |
| 360 | 3300027682 | Ga0209971_1002480 | Ga0209971_10024802 | 428 |
| 361 | 3300028380 | Ga0268265_10019896 | Ga0268265_100198962 | 428 |
| 362 | 3300028380 | Ga0268265_10173167 | Ga0268265_101731672 | 428 |
| 363 | 3300028381 | Ga0268264_10000566 | Ga0268264_1000056614 | 428 |
| 364 | 3300035172 | Ga0373955_0087051 | Ga0373955_0087051_343_1665 | 428 |
| 365 | 3300036401 | Ga0373937_0015351 | Ga0373937_0015351_1012_2334 | 428 |
| 366 | 3300038996 | Ga0242420_006119 | Ga0242420_006119_200_1525 | 428 |
| 367 | 3300045051 | Ga0451576_0057362 | Ga0451576_0057362_743_2065 | 428 |
| 368 | 3300048905 | Ga0496102_0298911 | Ga0496102_0298911_120_1445 | 428 |
| 369 | 3300048906 | Ga0496103_0179003 | Ga0496103_0179003_22_1344 | 428 |
| 370 | 3300048911 | Ga0496108_0134264 | Ga0496108_0134264_138_1463 | 428 |
| 371 | 3300048911 | Ga0496108_0290552 | Ga0496108_0290552_31_1353 | 428 |
| 372 | 3300048912 | Ga0496109_0052621 | Ga0496109_0052621_2056_3381 | 428 |
| 373 | 3300048912 | Ga0496109_0100702 | Ga0496109_0100702_1165_2490 | 428 |
| 374 | 3300048915 | Ga0496112_0002790 | Ga0496112_0002790_10417_11742 | 428 |
| 375 | 3300050507 | nmdc:mga05p37_163289_c1 | nmdc:mga05p37_163289_c1_898_2220 | 428 |
| 376 | 3300050511 | nmdc:mga08y16_50025_c1 | nmdc:mga08y16_50025_c1_656_1981 | 428 |
| 377 | 3300060353 | Ga0501082_0000101 | Ga0501082_0000101_2801_4114 | 428 |
| 378 | 3300005339 | Ga0070660_100100462 | Ga0070660_1001004621 | 429 |
| 379 | 3300006943 | Ga0099822_1004364 | Ga0099822_100436418 | 429 |
| 380 | 3300013102 | Ga0157371_10030019 | Ga0157371_100300193 | 429 |
| 381 | 3300013104 | Ga0157370_10079448 | Ga0157370_100794481 | 429 |
| 382 | 3300025919 | Ga0207657_10021865 | Ga0207657_100218654 | 429 |
| 383 | 3300025924 | Ga0207694_10108133 | Ga0207694_101081332 | 429 |
| 384 | 3300026078 | Ga0207702_10186150 | Ga0207702_101861501 | 429 |
| 385 | 3300027357 | Ga0209589_1000046 | Ga0209589_100004637 | 429 |
| 386 | 3300027361 | Ga0209489_100106 | Ga0209489_10010637 | 429 |
| 387 | 3300027363 | Ga0209700_100105 | Ga0209700_10010537 | 429 |
| 388 | 3300031249 | Ga0265339_10090003 | Ga0265339_100900031 | 429 |
| 389 | 3300046681 | Ga0495647_0014535 | Ga0495647_0014535_1206_2528 | 429 |
| 390 | 3300049568 | Ga0501031_0000890 | Ga0501031_0000890_4929_6272 | 429 |
| 391 | 3300049568 | Ga0501031_0022980 | Ga0501031_0022980_1330_2649 | 429 |
| 392 | 3300049569 | Ga0501032_0000372 | Ga0501032_0000372_12177_13520 | 429 |
| 393 | 3300049569 | Ga0501032_0029900 | Ga0501032_0029900_985_2304 | 429 |
| 394 | 3300049569 | Ga0501032_0064130 | Ga0501032_0064130_568_1887 | 429 |
| 395 | 3300049570 | Ga0501033_0000824 | Ga0501033_0000824_18447_19790 | 429 |
| 396 | 3300049570 | Ga0501033_0040171 | Ga0501033_0040171_2104_3426 | 429 |
| 397 | 3300049570 | Ga0501033_0057360 | Ga0501033_0057360_238_1554 | 429 |
| 398 | 3300049570 | Ga0501033_0214414 | Ga0501033_0214414_40_1359 | 429 |
| 399 | 3300049571 | Ga0501034_0000058 | Ga0501034_0000058_148098_149441 | 429 |
| 400 | 3300049571 | Ga0501034_0128684 | Ga0501034_0128684_850_2169 | 429 |
| 401 | 3300049572 | Ga0501036_0000691 | Ga0501036_0000691_19964_21307 | 429 |
| 402 | 3300049573 | Ga0501037_0001344 | Ga0501037_0001344_4944_6287 | 429 |
| 403 | 3300049574 | Ga0501038_0000913 | Ga0501038_0000913_13617_14960 | 429 |
| 404 | 3300049574 | Ga0501038_0008489 | Ga0501038_0008489_3646_4965 | 429 |
| 405 | 3300049575 | Ga0501039_0051531 | Ga0501039_0051531_439_1770 | 429 |
| 406 | 3300049576 | Ga0501040_0005144 | Ga0501040_0005144_2586_3905 | 429 |
| 407 | 3300049578 | Ga0501042_0066098 | Ga0501042_0066098_895_2214 | 429 |
| 408 | 3300049579 | Ga0501043_0000444 | Ga0501043_0000444_12185_13528 | 429 |
| 409 | 3300049579 | Ga0501043_0012190 | Ga0501043_0012190_3045_4364 | 429 |
| 410 | 3300049579 | Ga0501043_0051609 | Ga0501043_0051609_287_1618 | 429 |
| 411 | 3300049579 | Ga0501043_0125244 | Ga0501043_0125244_123_1442 | 429 |
| 412 | 3300049580 | Ga0501046_0029707 | Ga0501046_0029707_567_1886 | 429 |
| 413 | 3300049581 | Ga0501047_0000022 | Ga0501047_0000022_55505_56848 | 429 |
| 414 | 3300049581 | Ga0501047_0025198 | Ga0501047_0025198_139_1461 | 429 |
| 415 | 3300049581 | Ga0501047_0042186 | Ga0501047_0042186_1170_2489 | 429 |
| 416 | 3300049581 | Ga0501047_0045096 | Ga0501047_0045096_1735_3054 | 429 |
| 417 | 3300049582 | Ga0501048_0000041 | Ga0501048_0000041_36503_37846 | 429 |
| 418 | 3300049583 | Ga0501067_0000764 | Ga0501067_0000764_4264_5607 | 429 |
| 419 | 3300049583 | Ga0501067_0001148 | Ga0501067_0001148_6922_8241 | 429 |
| 420 | 3300049584 | Ga0501068_0000547 | Ga0501068_0000547_7130_8473 | 429 |
| 421 | 3300049584 | Ga0501068_0071266 | Ga0501068_0071266_34_1353 | 429 |
| 422 | 3300049585 | Ga0501069_0043422 | Ga0501069_0043422_790_2109 | 429 |
| 423 | 3300049586 | Ga0501070_0004220 | Ga0501070_0004220_8735_10078 | 429 |
| 424 | 3300049586 | Ga0501070_0112532 | Ga0501070_0112532_573_1892 | 429 |
| 425 | 3300049586 | Ga0501070_0134828 | Ga0501070_0134828_93_1424 | 429 |
| 426 | 3300049588 | Ga0501072_0003399 | Ga0501072_0003399_7000_8343 | 429 |
| 427 | 3300049589 | Ga0501073_0000504 | Ga0501073_0000504_15459_16802 | 429 |
| 428 | 3300049590 | Ga0501074_0000028 | Ga0501074_0000028_17139_18482 | 429 |
| 429 | 3300049590 | Ga0501074_0000683 | Ga0501074_0000683_13245_14564 | 429 |
| 430 | 3300049593 | Ga0501077_0075177 | Ga0501077_0075177_652_1971 | 429 |
| 431 | 3300049741 | Ga0501079_0002860 | Ga0501079_0002860_6303_7646 | 429 |
| 432 | 3300049741 | Ga0501079_0083613 | Ga0501079_0083613_284_1603 | 429 |
| 433 | 3300049742 | Ga0501080_0012339 | Ga0501080_0012339_5752_7095 | 429 |
| 434 | 3300049744 | Ga0501083_0001349 | Ga0501083_0001349_7358_8701 | 429 |
| 435 | 3300049822 | Ga0501035_0001113 | Ga0501035_0001113_2814_4157 | 429 |
| 436 | 3300049822 | Ga0501035_0015011 | Ga0501035_0015011_5751_7073 | 429 |
| 437 | 3300049822 | Ga0501035_0098467 | Ga0501035_0098467_648_1967 | 429 |
| 438 | 3300049822 | Ga0501035_0146725 | Ga0501035_0146725_573_1892 | 429 |
| 439 | 3300049823 | Ga0501044_0000370 | Ga0501044_0000370_31251_32594 | 429 |
| 440 | 3300049823 | Ga0501044_0024557 | Ga0501044_0024557_1298_2620 | 429 |
| 441 | 3300049823 | Ga0501044_0239790 | Ga0501044_0239790_222_1541 | 429 |
| 442 | 3300049824 | Ga0501045_0006116 | Ga0501045_0006116_4953_6272 | 429 |
| 443 | 3300049824 | Ga0501045_0014542 | Ga0501045_0014542_938_2281 | 429 |
| 444 | 3300054114 | Ga0501084_0007133 | Ga0501084_0007133_4046_5389 | 429 |
| 445 | 3300054114 | Ga0501084_0055837 | Ga0501084_0055837_448_1767 | 429 |
| 446 | 3300060353 | Ga0501082_0013595 | Ga0501082_0013595_4854_6197 | 429 |
| 447 | 3300060353 | Ga0501082_0057571 | Ga0501082_0057571_452_1771 | 429 |
| 448 | 3300001989 | JGI24739J22299_10039738 | JGI24739J22299_100397382 | 430 |
| 449 | 3300002067 | JGI24735J21928_10013429 | JGI24735J21928_100134292 | 430 |
| 450 | 3300003215 | JGI25153J46596_10010396 | JGI25153J46596_100103962 | 430 |
| 451 | 3300003354 | JGI25160J50197_1010795 | JGI25160J50197_10107951 | 430 |
| 452 | 3300003762 | Ga0055542_1006636 | Ga0055542_10066362 | 430 |
| 453 | 3300003794 | Ga0055531_10004770 | Ga0055531_100047704 | 430 |
| 454 | 3300005329 | Ga0070683_100066845 | Ga0070683_1000668454 | 430 |
| 455 | 3300005331 | Ga0070670_100081131 | Ga0070670_1000811313 | 430 |
| 456 | 3300005347 | Ga0070668_100133201 | Ga0070668_1001332012 | 430 |
| 457 | 3300005434 | Ga0070709_10004534 | Ga0070709_100045349 | 430 |
| 458 | 3300005437 | Ga0070710_10051082 | Ga0070710_100510821 | 430 |
| 459 | 3300005439 | Ga0070711_100016348 | Ga0070711_1000163483 | 430 |
| 460 | 3300005455 | Ga0070663_100091220 | Ga0070663_1000912201 | 430 |
| 461 | 3300005457 | Ga0070662_100084286 | Ga0070662_1000842862 | 430 |
| 462 | 3300005458 | Ga0070681_10047103 | Ga0070681_100471033 | 430 |
| 463 | 3300005530 | Ga0070679_100030656 | Ga0070679_1000306564 | 430 |
| 464 | 3300005539 | Ga0068853_100103852 | Ga0068853_1001038522 | 430 |
| 465 | 3300005563 | Ga0068855_100168338 | Ga0068855_1001683382 | 430 |
| 466 | 3300005983 | Ga0081540_1018763 | Ga0081540_10187634 | 430 |
| 467 | 3300006237 | Ga0097621_100104056 | Ga0097621_1001040562 | 430 |
| 468 | 3300009098 | Ga0105245_10157120 | Ga0105245_101571202 | 430 |
| 469 | 3300009545 | Ga0105237_10047164 | Ga0105237_100471642 | 430 |
| 470 | 3300013105 | Ga0157369_10028351 | Ga0157369_100283513 | 430 |
| 471 | 3300013296 | Ga0157374_10059243 | Ga0157374_100592432 | 430 |
| 472 | 3300025253 | Ga0209677_104912 | Ga0209677_1049124 | 430 |
| 473 | 3300025254 | Ga0209148_1000308 | Ga0209148_100030861 | 430 |
| 474 | 3300025295 | Ga0209564_1007252 | Ga0209564_10072522 | 430 |
| 475 | 3300025297 | Ga0209758_1000546 | Ga0209758_100054653 | 430 |
| 476 | 3300025297 | Ga0209758_1013471 | Ga0209758_10134712 | 430 |
| 477 | 3300025299 | Ga0209256_1002930 | Ga0209256_10029302 | 430 |
| 478 | 3300025302 | Ga0207426_1007996 | Ga0207426_10079962 | 430 |
| 479 | 3300025304 | Ga0209257_1001004 | Ga0209257_10010042 | 430 |
| 480 | 3300025304 | Ga0209257_1015484 | Ga0209257_10154843 | 430 |
| 481 | 3300025900 | Ga0207710_10020950 | Ga0207710_100209502 | 430 |
| 482 | 3300025904 | Ga0207647_10023452 | Ga0207647_100234522 | 430 |
| 483 | 3300025906 | Ga0207699_10001846 | Ga0207699_100018468 | 430 |
| 484 | 3300025912 | Ga0207707_10015977 | Ga0207707_100159776 | 430 |
| 485 | 3300025915 | Ga0207693_10019351 | Ga0207693_100193512 | 430 |
| 486 | 3300025916 | Ga0207663_10007451 | Ga0207663_100074514 | 430 |
| 487 | 3300025919 | Ga0207657_10104246 | Ga0207657_101042462 | 430 |
| 488 | 3300025928 | Ga0207700_10017262 | Ga0207700_100172623 | 430 |
| 489 | 3300025933 | Ga0207706_10118076 | Ga0207706_101180762 | 430 |
| 490 | 3300025939 | Ga0207665_10080351 | Ga0207665_100803512 | 430 |
| 491 | 3300025939 | Ga0207665_10150052 | Ga0207665_101500521 | 430 |
| 492 | 3300025944 | Ga0207661_10008755 | Ga0207661_100087553 | 430 |
| 493 | 3300033180 | Ga0307510_10066110 | Ga0307510_100661102 | 430 |
| 494 | 3300035083 | Ga0373926_0022812 | Ga0373926_0022812_242_1561 | 430 |
| 495 | 3300035089 | Ga0373944_0009550 | Ga0373944_0009550_640_1959 | 430 |
| 496 | 3300035116 | Ga0373945_0005059 | Ga0373945_0005059_2094_3413 | 430 |
| 497 | 3300035117 | Ga0373953_0036137 | Ga0373953_0036137_526_1845 | 430 |
| 498 | 3300035119 | Ga0373956_0032778 | Ga0373956_0032778_612_1931 | 430 |
| 499 | 3300035695 | Ga0373927_0028242 | Ga0373927_0028242_521_1840 | 430 |
| 500 | 3300035725 | Ga0373947_0006308 | Ga0373947_0006308_3063_4382 | 430 |
| 501 | 3300036401 | Ga0373937_0104963 | Ga0373937_0104963_395_1714 | 430 |
| 502 | 3300037418 | Ga0395900_0143158 | Ga0395900_0143158_224_1540 | 430 |
| 503 | 3300044658 | Ga0466972_0005312 | Ga0466972_0005312_2952_4268 | 430 |
| 504 | 3300046459 | Ga0495629_0017962 | Ga0495629_0017962_707_2023 | 430 |
| 505 | 3300046472 | Ga0495580_0132900 | Ga0495580_0132900_48_1367 | 430 |
| 506 | 3300046492 | Ga0495585_0067208 | Ga0495585_0067208_143_1459 | 430 |
| 507 | 3300046499 | Ga0495594_0052304 | Ga0495594_0052304_898_2217 | 430 |
| 508 | 3300046507 | Ga0495606_0028489 | Ga0495606_0028489_761_2077 | 430 |
| 509 | 3300046511 | Ga0495608_0027653 | Ga0495608_0027653_678_1994 | 430 |
| 510 | 3300046529 | Ga0495652_0015898 | Ga0495652_0015898_1391_2707 | 430 |
| 511 | 3300046533 | Ga0495640_0008874 | Ga0495640_0008874_3011_4327 | 430 |
| 512 | 3300046533 | Ga0495640_0021916 | Ga0495640_0021916_613_1932 | 430 |
| 513 | 3300046642 | Ga0495634_0059320 | Ga0495634_0059320_1189_2508 | 430 |
| 514 | 3300046663 | Ga0495635_0018265 | Ga0495635_0018265_2739_4055 | 430 |
| 515 | 3300046680 | Ga0495646_0055703 | Ga0495646_0055703_292_1611 | 430 |
| 516 | 3300046690 | Ga0495624_0030288 | Ga0495624_0030288_360_1679 | 430 |
| 517 | 3300047315 | Ga0495581_0046456 | Ga0495581_0046456_218_1537 | 430 |
| 518 | 3300047319 | Ga0495674_0021283 | Ga0495674_0021283_4068_5387 | 430 |
| 519 | 3300047321 | Ga0495676_0013624 | Ga0495676_0013624_1231_2547 | 430 |
| 520 | 3300047471 | Ga0495684_0011086 | Ga0495684_0011086_1617_2936 | 430 |
| 521 | 3300048088 | Ga0495602_0059103 | Ga0495602_0059103_1463_2779 | 430 |
| 522 | 3300048905 | Ga0496102_0214140 | Ga0496102_0214140_42_1358 | 430 |
| 523 | 3300048908 | Ga0496105_0122539 | Ga0496105_0122539_59_1375 | 430 |
| 524 | 3300048914 | Ga0496111_0083719 | Ga0496111_0083719_898_2214 | 430 |
| 525 | 3300048929 | Ga0496126_0025590 | Ga0496126_0025590_2098_3417 | 430 |
| 526 | 3300048929 | Ga0496126_0078616 | Ga0496126_0078616_838_2154 | 430 |
| 527 | 3300050492 | nmdc:mga0yw44_57675_c1 | nmdc:mga0yw44_57675_c1_722_2038 | 430 |
| 528 | 3300050493 | nmdc:mga0k408_75484_c1 | nmdc:mga0k408_75484_c1_327_1643 | 430 |
| 529 | 3300053077 | Ga0495601_0079609 | Ga0495601_0079609_378_1697 | 430 |
| 530 | 3300053177 | Ga0500636_0002629 | Ga0500636_0002629_6178_7494 | 430 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4aq4-assembly1.cif.gz_A | substrate bound sn-glycerol-3-phosphate binding periplasmic protein ugpb from escherichia coli | 0.9652 | 26 | 427 |
| 4aq4-assembly1.cif.gz_A | substrate bound sn-glycerol-3-phosphate binding periplasmic protein ugpb from escherichia coli | 0.9268 | 26 | 427 |
| 6x84-assembly2.cif.gz_B | sn-glycerol-3-phosphate binding periplasmic protein ugpb from escherichia coli - w169s, w172s | 0.902 | 25 | 428 |
| 6x84-assembly2.cif.gz_B | sn-glycerol-3-phosphate binding periplasmic protein ugpb from escherichia coli - w169s, w172s | 0.8796 | 25 | 428 |
| 7c0u-assembly2.cif.gz_B | crystal structure of a dinucleotide-binding protein (s127a) of abc transporter endogenously bound to uridylyl-3'-5'-phospho-guanosine | 0.8613 | 27 | 422 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AG80_145_437_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9649 | 147 | 427 | 3.40.190.10 |
| 4aq4A01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9564 | 26 | 374 | 3.40.190.10 |
| 4aq4A01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9288 | 26 | 374 | 3.40.190.10 |
| af_P0AG80_145_437_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9231 | 147 | 427 | 3.40.190.10 |
| 4aq4A02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8948 | 147 | 427 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G3RQS8-F1-model_v4 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein | 0.9721 | 35 | 429 |
GO:0030313
GO:0055085 |
| AF-A0A0E1UNP6-F1-model_v4 | deleted | 0.9691 | 21 | 416 |
|
| AF-A0A0R3CB30-F1-model_v4 | sn-glycerol-3-phosphate-binding periplasmic protein UgpB | 0.9662 | 20 | 428 |
GO:0042597
|
| AF-A0A432RQP0-F1-model_v4 | sn-glycerol-3-phosphate-binding periplasmic protein UgpB | 0.9652 | 35 | 426 |
GO:0030313
GO:0055085 |
| AF-A0A2X2TAB2-F1-model_v4 | sn-glycerol-3-phosphate-binding periplasmic protein UgpB | 0.962 | 20 | 430 |
GO:0016020
GO:0030288 GO:0055085 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar