F459731

General Info

Members Datasets Scaffolds Average Seq Length
528 268 1056 133

Family's Representative Sequence

Representative Sequence 3300049575|Ga0501039_0468023|Ga0501039_0468023_177_629
Length 150
Sequence MAVAHRRIVSETMNRMATMADLDELALAMPQTTKEVSEDGRPSYLVHGKMYCFHRSRRPDAVDPETGERMDDVLMFRVDGLEVKEVLLADDRGVFFTTPHFRGYPAVLVRIPDLARLDREELRDLVAEAWLTRAQKRVAXXXLAEQGEDA

Samples

Sample ID Description Type Environment
1 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
137 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
138 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
139 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
140 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
141 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
142 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
143 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
144 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
145 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
146 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
150 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
151 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
160 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
161 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
162 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
163 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
164 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
165 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
166 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
167 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
168 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
169 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
172 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
173 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
174 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
175 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
176 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
177 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
178 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
179 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
180 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
181 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
182 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
183 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
184 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
185 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
186 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
187 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
188 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
189 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
190 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
191 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
192 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
193 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
194 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
195 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
196 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
197 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
198 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
199 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
200 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
201 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
202 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
203 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
204 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
205 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
206 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
207 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
208 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
209 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
226 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
239 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
240 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
241 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
242 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
243 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
244 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
245 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
246 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
247 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
248 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
249 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
250 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
251 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
252 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
253 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
256 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
257 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
258 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
259 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
260 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
261 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
262 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
263 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
264 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
265 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
266 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
267 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
268 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.43
Metatranscriptomes 0.57
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 12.69
Rhizosphere 87.12
Stem 0
Stem Tuber 0
Unclassified 8.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501039_0468023 3300049575 Bacteria 990
2 JGI25407J50210_10042565 3300003373 Bacteria 1162
3 Ga0070683_100186768 3300005329 Unclassified 1968
4 Ga0070683_100199663 3300005329 Bacteria 1899
5 Ga0070683_100685801 3300005329 Unclassified 981
6 Ga0070690_101775070 3300005330 Bacteria 503
7 Ga0070670_100148826 3300005331 Bacteria 2026
8 Ga0068869_100100508 3300005334 Bacteria 2187
9 Ga0068869_100390310 3300005334 Bacteria 1143
10 Ga0070680_100257933 3300005336 Bacteria 1474
11 Ga0070680_100648201 3300005336 Bacteria 908
12 Ga0070682_100458790 3300005337 Bacteria 978
13 Ga0068868_100015592 3300005338 Bacteria 5625
14 Ga0068868_100028022 3300005338 Bacteria 4302
15 Ga0068868_100105163 3300005338 Unclassified 2288
16 Ga0070660_100001712 3300005339 Bacteria 15036
17 Ga0070660_101026702 3300005339 Bacteria 697
18 Ga0070689_100038857 3300005340 Bacteria 3642
19 Ga0070689_100611771 3300005340 Bacteria 945
20 Ga0070691_10060488 3300005341 Bacteria 1821
21 Ga0070691_10066442 3300005341 Bacteria 1743
22 Ga0070691_10156758 3300005341 Bacteria 1171
23 Ga0070692_10052253 3300005345 Bacteria 2128
24 Ga0070692_10274752 3300005345 Bacteria 1019
25 Ga0070675_101032345 3300005354 Bacteria 755
26 Ga0070671_100172281 3300005355 Bacteria 1831
27 Ga0070671_101652294 3300005355 Bacteria 568
28 Ga0070673_100534382 3300005364 Bacteria 1064
29 Ga0070688_100272745 3300005365 Bacteria 1212
30 Ga0070659_100012757 3300005366 Bacteria 6238
31 Ga0070659_100059815 3300005366 Bacteria 3008
32 Ga0070659_100251730 3300005366 Unclassified 1464
33 Ga0070659_100452765 3300005366 Unclassified 1089
34 Ga0070667_100423499 3300005367 Bacteria 1214
35 Ga0070703_10239539 3300005406 Bacteria 731
36 Ga0070713_100104110 3300005436 Bacteria 2463
37 Ga0070701_10037701 3300005438 Bacteria 2442
38 Ga0070701_10305101 3300005438 Bacteria 980
39 Ga0070700_100060272 3300005441 Bacteria 2391
40 Ga0070678_100254015 3300005456 Bacteria 1475
41 Ga0070662_100019350 3300005457 Bacteria 4622
42 Ga0070662_100022207 3300005457 Bacteria 4341
43 Ga0070662_100157520 3300005457 Bacteria 1774
44 Ga0070681_10659059 3300005458 Bacteria 962
45 Ga0070681_10728316 3300005458 Unclassified 908
46 Ga0068867_100057892 3300005459 Bacteria 2871
47 Ga0070685_10223454 3300005466 Bacteria 1235
48 Ga0070685_10233541 3300005466 Bacteria 1211
49 Ga0070684_100057680 3300005535 Unclassified 3391
50 Ga0068853_100407114 3300005539 Bacteria 1274
51 Ga0068853_100522481 3300005539 Bacteria 1122
52 Ga0070672_100133433 3300005543 Bacteria 2043
53 Ga0070672_101755287 3300005543 Bacteria 558
54 Ga0070693_100111924 3300005547 Bacteria 1681
55 Ga0070693_101228539 3300005547 Bacteria 576
56 Ga0070704_100595828 3300005549 Bacteria 971
57 Ga0068855_100003269 3300005563 Bacteria 19833
58 Ga0068855_101696645 3300005563 Bacteria 644
59 Ga0070664_100260754 3300005564 Bacteria 1560
60 Ga0068857_101756999 3300005577 Bacteria 607
61 Ga0068854_100135506 3300005578 Bacteria 1885
62 Ga0068854_100645520 3300005578 Unclassified 908
63 Ga0070702_100007034 3300005615 Bacteria 5366
64 Ga0070702_100013905 3300005615 Bacteria 4074
65 Ga0068852_100052937 3300005616 Bacteria 3492
66 Ga0068852_100075930 3300005616 Bacteria 2966
67 Ga0068852_100152508 3300005616 Bacteria 2150
68 Ga0068852_100396926 3300005616 Bacteria 1356
69 Ga0068870_10071091 3300005840 Bacteria 1898
70 Ga0068870_10277445 3300005840 Bacteria 1049
71 Ga0068870_10661416 3300005840 Bacteria 717
72 Ga0068858_100344490 3300005842 Bacteria 1427
73 Ga0068860_100251857 3300005843 Bacteria 1720
74 Ga0068862_100296788 3300005844 Unclassified 1486
75 Ga0068862_100538604 3300005844 Bacteria 1113
76 Ga0081455_10178847 3300005937 Bacteria 1608
77 Ga0075432_10187114 3300006058 Bacteria 813
78 Ga0070712_100308725 3300006175 Bacteria 1283
79 Ga0097621_100059190 3300006237 Bacteria 3135
80 Ga0097621_100384272 3300006237 Bacteria 1254
81 Ga0068871_100114135 3300006358 Bacteria 2275
82 Ga0068871_100133202 3300006358 Bacteria 2109
83 Ga0075428_100114464 3300006844 Unclassified 2938
84 Ga0075428_102219710 3300006844 Unclassified 566
85 Ga0075430_100074352 3300006846 Bacteria 2850
86 Ga0075431_100119118 3300006847 Unclassified 2724
87 Ga0075433_10025959 3300006852 Bacteria 4955
88 Ga0075433_10052502 3300006852 Bacteria 3552
89 Ga0075433_10058198 3300006852 Bacteria 3380
90 Ga0075433_10129821 3300006852 Bacteria 2239
91 Ga0075434_100000531 3300006871 Bacteria 29081
92 Ga0075434_100015977 3300006871 Bacteria 7211
93 Ga0075434_100339509 3300006871 Bacteria 1523
94 Ga0068865_100165087 3300006881 Bacteria 1693
95 Ga0068865_100239269 3300006881 Bacteria 1428
96 Ga0068865_100460048 3300006881 Bacteria 1054
97 Ga0075436_100003446 3300006914 Bacteria 10845
98 Ga0075436_100079122 3300006914 Bacteria 2277
99 Ga0075436_100729258 3300006914 Bacteria 735
100 Ga0075435_100000473 3300007076 Bacteria 24417
101 Ga0075435_100035380 3300007076 Bacteria 3963
102 Ga0075435_100135631 3300007076 Bacteria 2062
103 Ga0111539_10002177 3300009094 Bacteria 26179
104 Ga0111539_10082671 3300009094 Unclassified 3777
105 Ga0111539_10606402 3300009094 Bacteria 1275
106 Ga0105245_10000665 3300009098 Bacteria 31126
107 Ga0105245_10047430 3300009098 Bacteria 3841
108 Ga0105245_10172880 3300009098 Unclassified 2058
109 Ga0105245_10193048 3300009098 Bacteria 1952
110 Ga0105245_10578828 3300009098 Bacteria 1147
111 Ga0105245_11623078 3300009098 Bacteria 698
112 Ga0105247_10889556 3300009101 Bacteria 687
113 Ga0114129_10027711 3300009147 Bacteria 8021
114 Ga0114129_10321185 3300009147 Bacteria 2058
115 Ga0114129_10506729 3300009147 Unclassified 1575
116 Ga0114129_11060319 3300009147 Unclassified 1017
117 Ga0114129_11826218 3300009147 Unclassified 739
118 Ga0114129_11895100 3300009147 Bacteria 723
119 Ga0105243_10086408 3300009148 Bacteria 2573
120 Ga0105243_10105909 3300009148 Bacteria 2343
121 Ga0105243_10141135 3300009148 Bacteria 2055
122 Ga0105243_10416690 3300009148 Bacteria 1251
123 Ga0105241_10142620 3300009174 Bacteria 1952
124 Ga0105241_11158327 3300009174 Bacteria 730
125 Ga0105242_10020447 3300009176 Bacteria 5191
126 Ga0105242_10330114 3300009176 Bacteria 1402
127 Ga0105248_10343433 3300009177 Bacteria 1680
128 Ga0105248_10413649 3300009177 Bacteria 1518
129 Ga0105248_12631880 3300009177 Bacteria 574
130 Ga0105237_10224270 3300009545 Bacteria 1880
131 Ga0105237_10262329 3300009545 Bacteria 1730
132 Ga0105238_10008965 3300009551 Bacteria 10011
133 Ga0105238_10289569 3300009551 Bacteria 1620
134 Ga0105249_10218885 3300009553 Bacteria 1873
135 Ga0105249_11105759 3300009553 Bacteria 863
136 Ga0105249_11389876 3300009553 Bacteria 774
137 Ga0105239_10035247 3300010375 Bacteria 5496
138 Ga0105239_10167264 3300010375 Bacteria 2459
139 Ga0105239_10243557 3300010375 Bacteria 2018
140 Ga0105239_10365301 3300010375 Bacteria 1630
141 Ga0105239_10375140 3300010375 Bacteria 1608
142 Ga0105239_10616680 3300010375 Bacteria 1238
143 Ga0105239_12425938 3300010375 Bacteria 611
144 Ga0105246_10006349 3300011119 Bacteria 7216
145 Ga0105246_10026406 3300011119 Bacteria 3793
146 Ga0105246_10150020 3300011119 Bacteria 1763
147 Ga0105246_10763656 3300011119 Bacteria 854
148 Ga0157371_10350106 3300013102 Unclassified 1075
149 Ga0157374_10002739 3300013296 Bacteria 14799
150 Ga0157374_10436271 3300013296 Unclassified 1310
151 Ga0157378_10764245 3300013297 Unclassified 990
152 Ga0163162_11555540 3300013306 Bacteria 754
153 Ga0157372_10022101 3300013307 Bacteria 6880
154 Ga0157372_10052784 3300013307 Bacteria 4528
155 Ga0157372_10129471 3300013307 Unclassified 2903
156 Ga0157372_10695921 3300013307 Bacteria 1183
157 Ga0157375_10048226 3300013308 Bacteria 4165
158 Ga0157375_10274340 3300013308 Bacteria 1848
159 Ga0157375_10451867 3300013308 Bacteria 1450
160 Ga0163163_10004888 3300014325 Bacteria 11524
161 Ga0163163_10324740 3300014325 Bacteria 1593
162 Ga0163163_11544774 3300014325 Bacteria 725
163 Ga0157380_10004340 3300014326 Bacteria 9832
164 Ga0157380_10771933 3300014326 Unclassified 975
165 Ga0182008_10415817 3300014497 Bacteria 725
166 Ga0157377_10062293 3300014745 Bacteria 2134
167 Ga0157377_10070839 3300014745 Bacteria 2015
168 Ga0157379_10281144 3300014968 Bacteria 1514
169 Ga0157376_10067805 3300014969 Unclassified 3019
170 Ga0163161_10092283 3300017792 Bacteria 2242
171 Ga0163161_10646335 3300017792 Bacteria 876
172 Ga0206351_10032835 3300020077 Bacteria 602
173 Ga0206350_11171286 3300020080 Bacteria 767
174 Ga0206353_10061678 3300020082 Bacteria 1113
175 Ga0207653_10136678 3300025885 Bacteria 893
176 Ga0207688_10002499 3300025901 Bacteria 9902
177 Ga0207688_10023368 3300025901 Bacteria 3385
178 Ga0207699_10166688 3300025906 Bacteria 1471
179 Ga0207643_10083327 3300025908 Bacteria 1855
180 Ga0207654_10074982 3300025911 Bacteria 2020
181 Ga0207654_10323331 3300025911 Bacteria 1055
182 Ga0207707_10609276 3300025912 Bacteria 924
183 Ga0207671_10039948 3300025914 Bacteria 3474
184 Ga0207663_10596647 3300025916 Bacteria 867
185 Ga0207660_10276920 3300025917 Bacteria 1330
186 Ga0207660_10335539 3300025917 Bacteria 1209
187 Ga0207662_10694741 3300025918 Bacteria 713
188 Ga0207657_10000487 3300025919 Bacteria 41908
189 Ga0207652_10481021 3300025921 Bacteria 1118
190 Ga0207681_11178061 3300025923 Bacteria 644
191 Ga0207694_10006191 3300025924 Bacteria 9136
192 Ga0207650_10118049 3300025925 Bacteria 2062
193 Ga0207659_11458855 3300025926 Bacteria 586
194 Ga0207687_10000138 3300025927 Bacteria 48809
195 Ga0207687_10031121 3300025927 Bacteria 3605
196 Ga0207687_10287184 3300025927 Bacteria 1321
197 Ga0207687_10349638 3300025927 Unclassified 1204
198 Ga0207644_10157742 3300025931 Bacteria 1761
199 Ga0207644_10368496 3300025931 Bacteria 1170
200 Ga0207690_10013584 3300025932 Bacteria 4895
201 Ga0207690_10562899 3300025932 Bacteria 927
202 Ga0207706_10019003 3300025933 Bacteria 6182
203 Ga0207706_10042078 3300025933 Bacteria 4048
204 Ga0207706_10064101 3300025933 Bacteria 3235
205 Ga0207686_10113391 3300025934 Bacteria 1833
206 Ga0207686_10414690 3300025934 Bacteria 1029
207 Ga0207709_10146791 3300025935 Bacteria 1628
208 Ga0207709_10528328 3300025935 Bacteria 925
209 Ga0207709_10834707 3300025935 Bacteria 746
210 Ga0207709_11245959 3300025935 Bacteria 614
211 Ga0207670_10024439 3300025936 Bacteria 3776
212 Ga0207669_10091114 3300025937 Bacteria 1985
213 Ga0207704_10240031 3300025938 Bacteria 1353
214 Ga0207704_10269779 3300025938 Bacteria 1288
215 Ga0207704_10489237 3300025938 Bacteria 989
216 Ga0207691_10146439 3300025940 Bacteria 2079
217 Ga0207691_10257735 3300025940 Bacteria 1504
218 Ga0207711_10335474 3300025941 Bacteria 1399
219 Ga0207711_10392219 3300025941 Bacteria 1289
220 Ga0207711_11050987 3300025941 Bacteria 754
221 Ga0207689_10052566 3300025942 Bacteria 3356
222 Ga0207661_10067999 3300025944 Bacteria 2899
223 Ga0207661_10147965 3300025944 Bacteria 2028
224 Ga0207661_10335142 3300025944 Unclassified 1362
225 Ga0207679_10524330 3300025945 Bacteria 1060
226 Ga0207667_10006618 3300025949 Bacteria 14009
227 Ga0207667_11153425 3300025949 Unclassified 756
228 Ga0207712_10016010 3300025961 Bacteria 4847
229 Ga0207712_11198710 3300025961 Bacteria 677
230 Ga0207640_10126622 3300025981 Unclassified 1840
231 Ga0207640_10270798 3300025981 Bacteria 1328
232 Ga0207658_10203439 3300025986 Bacteria 1655
233 Ga0207658_10233924 3300025986 Bacteria 1553
234 Ga0207677_10001777 3300026023 Bacteria 11380
235 Ga0207677_10078976 3300026023 Bacteria 2352
236 Ga0207703_10280862 3300026035 Bacteria 1512
237 Ga0207639_10057577 3300026041 Bacteria 2985
238 Ga0207639_10259645 3300026041 Unclassified 1519
239 Ga0207678_10209282 3300026067 Bacteria 1668
240 Ga0207708_10014331 3300026075 Bacteria 5932
241 Ga0207708_10035014 3300026075 Bacteria 3821
242 Ga0207641_10330073 3300026088 Bacteria 1449
243 Ga0207674_10232427 3300026116 Bacteria 1791
244 Ga0207675_100179905 3300026118 Unclassified 2024
245 Ga0207675_100387646 3300026118 Bacteria 1375
246 Ga0207675_100455787 3300026118 Bacteria 1268
247 Ga0207683_10049437 3300026121 Bacteria 3681
248 Ga0207683_10106218 3300026121 Bacteria 2510
249 Ga0207698_10036893 3300026142 Bacteria 3594
250 Ga0207698_10237451 3300026142 Bacteria 1659
251 Ga0207698_11377278 3300026142 Bacteria 720
252 Ga0207428_10741086 3300027907 Bacteria 701
253 Ga0207428_10797496 3300027907 Bacteria 671
254 Ga0268264_10235906 3300028381 Bacteria 1692
255 Ga0268264_10294366 3300028381 Bacteria 1526
256 Ga0307405_10092653 3300031731 Bacteria 2005
257 Ga0307410_11407342 3300031852 Bacteria 612
258 Ga0307416_100562226 3300032002 Bacteria 1215
259 Ga0307415_100586659 3300032126 Bacteria 989
260 Ga0373934_0099479 3300035086 Bacteria 1176
261 Ga0373944_0210186 3300035089 Bacteria 707
262 Ga0373923_0303903 3300035111 Bacteria 755
263 Ga0373936_0019575 3300035113 Bacteria 2623
264 Ga0373939_0463388 3300035114 Bacteria 535
265 Ga0373945_0029379 3300035116 Bacteria 1931
266 Ga0373957_0068726 3300035120 Bacteria 1383
267 Ga0373943_0002150 3300035170 Bacteria 8962
268 Ga0373943_0003852 3300035170 Bacteria 6822
269 Ga0373943_0119719 3300035170 Bacteria 1398
270 Ga0373946_0020705 3300035171 Bacteria 2544
271 Ga0373955_0373967 3300035172 Bacteria 864
272 Ga0373924_0047287 3300035410 Bacteria 1775
273 Ga0373931_0327246 3300035691 Bacteria 954
274 Ga0373935_0085514 3300035692 Bacteria 2056
275 Ga0373935_1230271 3300035692 Bacteria 558
276 Ga0373927_0081541 3300035695 Bacteria 2097
277 Ga0373927_0265601 3300035695 Bacteria 1128
278 Ga0373927_1031028 3300035695 Unclassified 543
279 Ga0373933_0226894 3300035724 Bacteria 1199
280 Ga0373947_0046972 3300035725 Bacteria 2586
281 Ga0373937_0128847 3300036401 Bacteria 2362
282 Ga0373925_0234776 3300037068 Bacteria 1467
283 Ga0395899_0004928 3300037312 Bacteria 10385
284 Ga0395899_0014087 3300037312 Bacteria 6104
285 Ga0395899_0216985 3300037312 Bacteria 1327
286 Ga0395899_1013200 3300037312 Bacteria 500
287 Ga0395900_0001810 3300037418 Bacteria 24466
288 Ga0395900_0026049 3300037418 Bacteria 5987
289 Ga0395900_0034341 3300037418 Bacteria 5221
290 Ga0395900_0576700 3300037418 Bacteria 1067
291 Ga0395900_0592890 3300037418 Bacteria 1049
292 Ga0395900_1451949 3300037418 Bacteria 598
293 Ga0395898_0002634 3300037466 Bacteria 20880
294 Ga0395898_0049486 3300037466 Bacteria 4118
295 Ga0395898_0070469 3300037466 Bacteria 3379
296 Ga0395898_0090355 3300037466 Bacteria 2947
297 Ga0395898_0095534 3300037466 Bacteria 2855
298 Ga0395898_1704178 3300037466 Unclassified 553
299 Ga0395905_0012912 3300037471 Bacteria 8030
300 Ga0395905_0013593 3300037471 Bacteria 7798
301 Ga0395905_0087679 3300037471 Bacteria 2917
302 Ga0395905_0200696 3300037471 Bacteria 1870
303 Ga0395905_0886565 3300037471 Bacteria 795
304 Ga0395901_0009676 3300038443 Bacteria 9776
305 Ga0395901_0010238 3300038443 Bacteria 9497
306 Ga0395901_0035902 3300038443 Bacteria 5122
307 Ga0395901_0055611 3300038443 Bacteria 4115
308 Ga0395901_0196521 3300038443 Bacteria 2115
309 Ga0395901_0434635 3300038443 Bacteria 1344
310 Ga0439453_0004813 3300041408 Bacteria 2027
311 Ga0451793_1524031 3300041452 Bacteria 594
312 Ga0451795_0786567 3300041456 Bacteria 642
313 Ga0451795_1211917 3300041456 Bacteria 819
314 Ga0451845_0731638 3300041501 Bacteria 1025
315 Ga0439448_0206773 3300042005 Bacteria 689
316 Ga0439454_005154 3300042011 Bacteria 1547
317 Ga0450919_024594 3300042121 Bacteria 683
318 Ga0453683_0622615 3300044673 Unclassified 705
319 Ga0466964_0165222 3300044706 Bacteria 1038
320 Ga0466960_0252245 3300044901 Bacteria 980
321 Ga0466959_1170863 3300045049 Unclassified 511
322 Ga0466967_0507976 3300045976 Bacteria 1183
323 Ga0495603_0029760 3300046455 Bacteria 3292
324 Ga0495629_0007380 3300046459 Bacteria 8105
325 Ga0495641_0005237 3300046461 Bacteria 8836
326 Ga0495653_0011373 3300046463 Bacteria 7272
327 Ga0495580_0482512 3300046472 Bacteria 829
328 Ga0495639_0004628 3300046475 Bacteria 5904
329 Ga0495662_0000608 3300046476 Bacteria 16568
330 Ga0495662_0595637 3300046476 Bacteria 541
331 Ga0495584_0202232 3300046491 Unclassified 1010
332 Ga0495594_0000927 3300046499 Bacteria 15176
333 Ga0495594_0032684 3300046499 Bacteria 2825
334 Ga0495594_0147530 3300046499 Bacteria 1335
335 Ga0495618_0009265 3300046514 Bacteria 5941
336 Ga0495628_0290018 3300046516 Bacteria 1213
337 Ga0495628_0794015 3300046516 Bacteria 663
338 Ga0495652_0024292 3300046529 Bacteria 5366
339 Ga0495652_0413045 3300046529 Unclassified 953
340 Ga0495665_0006471 3300046531 Bacteria 6327
341 Ga0495640_0005209 3300046533 Bacteria 10333
342 Ga0495586_0035765 3300046535 Bacteria 2668
343 Ga0495621_0365207 3300046539 Bacteria 608
344 Ga0495622_0137363 3300046557 Bacteria 1111
345 Ga0495622_0533321 3300046557 Bacteria 501
346 Ga0495667_0048425 3300046559 Bacteria 2806
347 Ga0495634_0002813 3300046642 Bacteria 14298
348 Ga0495659_0251482 3300046664 Unclassified 737
349 Ga0495588_0019728 3300046674 Bacteria 3306
350 Ga0495657_0001586 3300046675 Bacteria 19540
351 Ga0495599_0064346 3300046678 Bacteria 2291
352 Ga0495599_0291404 3300046678 Bacteria 987
353 Ga0495647_0057271 3300046681 Bacteria 1529
354 Ga0495647_0208920 3300046681 Bacteria 858
355 Ga0495658_0019203 3300046683 Bacteria 3564
356 Ga0495613_0136500 3300046689 Bacteria 1754
357 Ga0495624_0002913 3300046690 Bacteria 12792
358 Ga0495671_0252705 3300046692 Bacteria 851
359 Ga0495589_0015559 3300046794 Bacteria 3913
360 Ga0495600_0012507 3300046809 Bacteria 5310
361 Ga0495581_0003434 3300047315 Bacteria 9098
362 Ga0495604_0054087 3300047317 Bacteria 3099
363 Ga0495676_0047038 3300047321 Bacteria 3494
364 Ga0495676_0335296 3300047321 Bacteria 1013
365 Ga0495675_0384967 3300047444 Bacteria 820
366 Ga0495677_0073498 3300047445 Bacteria 1276
367 Ga0495684_0331378 3300047471 Bacteria 1085
368 Ga0495593_0234607 3300047673 Bacteria 919
369 Ga0495602_0311917 3300048088 Bacteria 1147
370 Ga0495614_0037399 3300048089 Bacteria 2082
371 Ga0496100_0007788 3300048903 Bacteria 5939
372 Ga0496100_0025644 3300048903 Bacteria 3607
373 Ga0496100_0118060 3300048903 Bacteria 1852
374 Ga0496100_0441402 3300048903 Bacteria 996
375 Ga0496100_0715858 3300048903 Bacteria 782
376 Ga0496101_0006710 3300048904 Bacteria 7422
377 Ga0496101_0119836 3300048904 Bacteria 1988
378 Ga0496101_0266250 3300048904 Bacteria 1337
379 Ga0496101_0273339 3300048904 Bacteria 1319
380 Ga0496101_0314159 3300048904 Bacteria 1229
381 Ga0496101_0478607 3300048904 Bacteria 983
382 Ga0496101_1153098 3300048904 Unclassified 608
383 Ga0496102_0002474 3300048905 Bacteria 15769
384 Ga0496102_0547047 3300048905 Bacteria 1080
385 Ga0496103_0005915 3300048906 Bacteria 7312
386 Ga0496103_0055107 3300048906 Bacteria 2465
387 Ga0496103_0822757 3300048906 Bacteria 585
388 Ga0496104_0005490 3300048907 Bacteria 11106
389 Ga0496104_0027777 3300048907 Bacteria 5238
390 Ga0496104_0773753 3300048907 Bacteria 866
391 Ga0496104_1368516 3300048907 Bacteria 611
392 Ga0496105_0010912 3300048908 Bacteria 7157
393 Ga0496105_0219193 3300048908 Bacteria 1549
394 Ga0496106_0001965 3300048909 Bacteria 15454
395 Ga0496106_0057502 3300048909 Bacteria 2941
396 Ga0496106_0134655 3300048909 Bacteria 1939
397 Ga0496106_0178019 3300048909 Bacteria 1688
398 Ga0496107_0000334 3300048910 Bacteria 25483
399 Ga0496108_0000291 3300048911 Bacteria 43199
400 Ga0496108_0034836 3300048911 Bacteria 4183
401 Ga0496108_0091956 3300048911 Bacteria 2579
402 Ga0496108_0185567 3300048911 Bacteria 1802
403 Ga0496108_0915637 3300048911 Bacteria 752
404 Ga0496109_0002610 3300048912 Bacteria 15109
405 Ga0496109_0073516 3300048912 Bacteria 3141
406 Ga0496109_0079611 3300048912 Bacteria 3019
407 Ga0496109_0117622 3300048912 Bacteria 2474
408 Ga0496109_0146687 3300048912 Bacteria 2208
409 Ga0496109_0388268 3300048912 Bacteria 1319
410 Ga0496109_0658804 3300048912 Bacteria 984
411 Ga0496110_0000510 3300048913 Bacteria 26372
412 Ga0496110_0000774 3300048913 Bacteria 22221
413 Ga0496110_0103762 3300048913 Unclassified 2550
414 Ga0496110_0252607 3300048913 Bacteria 1605
415 Ga0496110_0325522 3300048913 Bacteria 1400
416 Ga0496111_0000517 3300048914 Bacteria 19933
417 Ga0496111_0037893 3300048914 Bacteria 3452
418 Ga0496111_0584470 3300048914 Bacteria 818
419 Ga0496112_0007065 3300048915 Bacteria 9919
420 Ga0496112_0020936 3300048915 Bacteria 6210
421 Ga0496112_0047329 3300048915 Bacteria 4219
422 Ga0496112_0459393 3300048915 Bacteria 1211
423 Ga0496113_0000190 3300048916 Bacteria 27916
424 Ga0496113_0568961 3300048916 Bacteria 908
425 Ga0496113_0900176 3300048916 Bacteria 700
426 Ga0496114_0012601 3300048917 Bacteria 6774
427 Ga0496114_0025448 3300048917 Bacteria 4838
428 Ga0496114_0035480 3300048917 Bacteria 4118
429 Ga0496114_0202594 3300048917 Bacteria 1738
430 Ga0496114_0237920 3300048917 Bacteria 1600
431 Ga0496115_0034818 3300048918 Bacteria 3980
432 Ga0496115_0036574 3300048918 Bacteria 3888
433 Ga0496115_0055658 3300048918 Bacteria 3177
434 Ga0496115_0350285 3300048918 Bacteria 1204
435 Ga0501031_0014453 3300049568 Bacteria 5130
436 Ga0501032_0160186 3300049569 Bacteria 1478
437 Ga0501032_0244211 3300049569 Bacteria 1166
438 Ga0501033_0035314 3300049570 Bacteria 3748
439 Ga0501033_0206482 3300049570 Bacteria 1402
440 Ga0501036_0030512 3300049572 Bacteria 4553
441 Ga0501036_0059250 3300049572 Bacteria 3244
442 Ga0501037_0059376 3300049573 Bacteria 2790
443 Ga0501038_0037084 3300049574 Bacteria 4277
444 Ga0501038_0046541 3300049574 Bacteria 3761
445 Ga0501038_0389823 3300049574 Bacteria 1079
446 Ga0501039_0042488 3300049575 Bacteria 3512
447 Ga0501039_0380997 3300049575 Bacteria 1108
448 Ga0501040_0016612 3300049576 Bacteria 4876
449 Ga0501040_0074407 3300049576 Bacteria 2347
450 Ga0501040_1080651 3300049576 Bacteria 582
451 Ga0501041_0042058 3300049577 Bacteria 2775
452 Ga0501041_0067823 3300049577 Bacteria 2187
453 Ga0501041_0203632 3300049577 Bacteria 1241
454 Ga0501042_0031104 3300049578 Bacteria 3776
455 Ga0501042_0042924 3300049578 Bacteria 3219
456 Ga0501043_0122642 3300049579 Bacteria 2038
457 Ga0501046_0042295 3300049580 Bacteria 3633
458 Ga0501048_0087520 3300049582 Bacteria 2198
459 Ga0501048_0198871 3300049582 Unclassified 1420
460 Ga0501067_0220123 3300049583 Bacteria 1057
461 Ga0501068_0023059 3300049584 Bacteria 3646
462 Ga0501068_0114712 3300049584 Unclassified 1677
463 Ga0501068_0194209 3300049584 Unclassified 1286
464 Ga0501068_0881642 3300049584 Bacteria 588
465 Ga0501069_0072190 3300049585 Bacteria 1935
466 Ga0501069_0173631 3300049585 Bacteria 1244
467 Ga0501070_0016178 3300049586 Bacteria 6268
468 Ga0501070_0412652 3300049586 Bacteria 1091
469 Ga0501071_0051525 3300049587 Bacteria 2966
470 Ga0501071_0098929 3300049587 Bacteria 2149
471 Ga0501071_0240338 3300049587 Bacteria 1365
472 Ga0501072_0015308 3300049588 Bacteria 5882
473 Ga0501072_0018829 3300049588 Bacteria 5326
474 Ga0501072_0134372 3300049588 Bacteria 1972
475 Ga0501073_0023097 3300049589 Bacteria 4471
476 Ga0501074_0116980 3300049590 Bacteria 1907
477 Ga0501074_0458581 3300049590 Bacteria 903
478 Ga0501075_0453077 3300049591 Bacteria 978
479 Ga0501075_0475140 3300049591 Bacteria 953
480 Ga0501076_0019681 3300049592 Bacteria 5161
481 Ga0501076_0065513 3300049592 Bacteria 2897
482 Ga0501077_0012645 3300049593 Bacteria 5284
483 Ga0501077_0124169 3300049593 Bacteria 1636
484 Ga0501077_0200802 3300049593 Bacteria 1267
485 Ga0501079_0131177 3300049741 Bacteria 1950
486 Ga0501079_0207871 3300049741 Bacteria 1529
487 Ga0501079_0417831 3300049741 Bacteria 1052
488 Ga0501079_1267298 3300049741 Bacteria 580
489 Ga0501080_0033101 3300049742 Bacteria 4824
490 Ga0501080_0838024 3300049742 Bacteria 805
491 Ga0501080_1773548 3300049742 Bacteria 519
492 Ga0501081_0335638 3300049743 Bacteria 1112
493 Ga0501083_0074441 3300049744 Bacteria 2256
494 Ga0501035_0040865 3300049822 Bacteria 4189
495 Ga0501044_0075258 3300049823 Bacteria 3428
496 Ga0501045_0014609 3300049824 Bacteria 5567
497 Ga0501045_0318766 3300049824 Bacteria 1157
498 nmdc:mga05p37_24202_c1 3300050507 Bacteria 7378
499 nmdc:mga05p37_263108_c1 3300050507 Bacteria 2063
500 nmdc:mga05p37_271390_c1 3300050507 Bacteria 2026
501 nmdc:mga05p37_65421_c1 3300050507 Bacteria 4473
502 nmdc:mga0qj67_76892_c1 3300050509 Bacteria 2670
503 nmdc:mga06r32_108641_c1 3300050510 Unclassified 1881
504 nmdc:mga08y16_100767_c1 3300050511 Unclassified 3007
505 nmdc:mga08y16_1466716_c1 3300050511 Bacteria 644
506 nmdc:mga08y16_650660_c1 3300050511 Bacteria 1058
507 nmdc:mga0n895_11821_c1 3300050512 Bacteria 7805
508 nmdc:mga0n895_5084_c1 3300050512 Bacteria 10924
509 nmdc:mga0n895_654322_c1 3300050512 Bacteria 1049
510 nmdc:mga0rr50_242823_c1 3300050513 Bacteria 1493
511 nmdc:mga0rr50_329_c1 3300050513 Bacteria 25831
512 nmdc:mga0rr50_5600_c1 3300050513 Bacteria 7515
513 nmdc:mga0rr50_676904_c1 3300050513 Unclassified 880
514 nmdc:mga08x19_293286_c1 3300050514 Bacteria 1129
515 nmdc:mga08x19_313192_c1 3300050514 Bacteria 1091
516 nmdc:mga08x19_6471_c1 3300050514 Bacteria 6935
517 nmdc:mga08x19_658349_c1 3300050514 Bacteria 743
518 nmdc:mga0a205_17379_c2 3300050515 Bacteria 4368
519 nmdc:mga0a205_225797_c1 3300050515 Bacteria 1757
520 nmdc:mga0a205_22691_c1 3300050515 Bacteria 5949
521 Ga0495612_0023441 3300053078 Bacteria 2477
522 Ga0495619_0128512 3300053085 Bacteria 1740
523 Ga0501084_0097011 3300054114 Bacteria 2475
524 Ga0501084_0100974 3300054114 Bacteria 2422
525 Ga0501082_2013484 3300060353 Bacteria 503
526 Ga0530510_0052962 3300061734 Bacteria 2932
527 Ga0530510_0068338 3300061734 Bacteria 2577
528 Ga0530510_0227985 3300061734 Bacteria 1385
529 Ga0501039_0468023
530 JGI25407J50210_10042565
531 Ga0070683_100186768
532 Ga0070683_100199663
533 Ga0070683_100685801
534 Ga0070690_101775070
535 Ga0070670_100148826
536 Ga0068869_100100508
537 Ga0068869_100390310
538 Ga0070680_100257933
539 Ga0070680_100648201
540 Ga0070682_100458790
541 Ga0068868_100015592
542 Ga0068868_100028022
543 Ga0068868_100105163
544 Ga0070660_100001712
545 Ga0070660_101026702
546 Ga0070689_100038857
547 Ga0070689_100611771
548 Ga0070691_10060488
549 Ga0070691_10066442
550 Ga0070691_10156758
551 Ga0070692_10052253
552 Ga0070692_10274752
553 Ga0070675_101032345
554 Ga0070671_100172281
555 Ga0070671_101652294
556 Ga0070673_100534382
557 Ga0070688_100272745
558 Ga0070659_100012757
559 Ga0070659_100059815
560 Ga0070659_100251730
561 Ga0070659_100452765
562 Ga0070667_100423499
563 Ga0070703_10239539
564 Ga0070713_100104110
565 Ga0070701_10037701
566 Ga0070701_10305101
567 Ga0070700_100060272
568 Ga0070678_100254015
569 Ga0070662_100019350
570 Ga0070662_100022207
571 Ga0070662_100157520
572 Ga0070681_10659059
573 Ga0070681_10728316
574 Ga0068867_100057892
575 Ga0070685_10223454
576 Ga0070685_10233541
577 Ga0070684_100057680
578 Ga0068853_100407114
579 Ga0068853_100522481
580 Ga0070672_100133433
581 Ga0070672_101755287
582 Ga0070693_100111924
583 Ga0070693_101228539
584 Ga0070704_100595828
585 Ga0068855_100003269
586 Ga0068855_101696645
587 Ga0070664_100260754
588 Ga0068857_101756999
589 Ga0068854_100135506
590 Ga0068854_100645520
591 Ga0070702_100007034
592 Ga0070702_100013905
593 Ga0068852_100052937
594 Ga0068852_100075930
595 Ga0068852_100152508
596 Ga0068852_100396926
597 Ga0068870_10071091
598 Ga0068870_10277445
599 Ga0068870_10661416
600 Ga0068858_100344490
601 Ga0068860_100251857
602 Ga0068862_100296788
603 Ga0068862_100538604
604 Ga0081455_10178847
605 Ga0075432_10187114
606 Ga0070712_100308725
607 Ga0097621_100059190
608 Ga0097621_100384272
609 Ga0068871_100114135
610 Ga0068871_100133202
611 Ga0075428_100114464
612 Ga0075428_102219710
613 Ga0075430_100074352
614 Ga0075431_100119118
615 Ga0075433_10025959
616 Ga0075433_10052502
617 Ga0075433_10058198
618 Ga0075433_10129821
619 Ga0075434_100000531
620 Ga0075434_100015977
621 Ga0075434_100339509
622 Ga0068865_100165087
623 Ga0068865_100239269
624 Ga0068865_100460048
625 Ga0075436_100003446
626 Ga0075436_100079122
627 Ga0075436_100729258
628 Ga0075435_100000473
629 Ga0075435_100035380
630 Ga0075435_100135631
631 Ga0111539_10002177
632 Ga0111539_10082671
633 Ga0111539_10606402
634 Ga0105245_10000665
635 Ga0105245_10047430
636 Ga0105245_10172880
637 Ga0105245_10193048
638 Ga0105245_10578828
639 Ga0105245_11623078
640 Ga0105247_10889556
641 Ga0114129_10027711
642 Ga0114129_10321185
643 Ga0114129_10506729
644 Ga0114129_11060319
645 Ga0114129_11826218
646 Ga0114129_11895100
647 Ga0105243_10086408
648 Ga0105243_10105909
649 Ga0105243_10141135
650 Ga0105243_10416690
651 Ga0105241_10142620
652 Ga0105241_11158327
653 Ga0105242_10020447
654 Ga0105242_10330114
655 Ga0105248_10343433
656 Ga0105248_10413649
657 Ga0105248_12631880
658 Ga0105237_10224270
659 Ga0105237_10262329
660 Ga0105238_10008965
661 Ga0105238_10289569
662 Ga0105249_10218885
663 Ga0105249_11105759
664 Ga0105249_11389876
665 Ga0105239_10035247
666 Ga0105239_10167264
667 Ga0105239_10243557
668 Ga0105239_10365301
669 Ga0105239_10375140
670 Ga0105239_10616680
671 Ga0105239_12425938
672 Ga0105246_10006349
673 Ga0105246_10026406
674 Ga0105246_10150020
675 Ga0105246_10763656
676 Ga0157371_10350106
677 Ga0157374_10002739
678 Ga0157374_10436271
679 Ga0157378_10764245
680 Ga0163162_11555540
681 Ga0157372_10022101
682 Ga0157372_10052784
683 Ga0157372_10129471
684 Ga0157372_10695921
685 Ga0157375_10048226
686 Ga0157375_10274340
687 Ga0157375_10451867
688 Ga0163163_10004888
689 Ga0163163_10324740
690 Ga0163163_11544774
691 Ga0157380_10004340
692 Ga0157380_10771933
693 Ga0182008_10415817
694 Ga0157377_10062293
695 Ga0157377_10070839
696 Ga0157379_10281144
697 Ga0157376_10067805
698 Ga0163161_10092283
699 Ga0163161_10646335
700 Ga0206351_10032835
701 Ga0206350_11171286
702 Ga0206353_10061678
703 Ga0207653_10136678
704 Ga0207688_10002499
705 Ga0207688_10023368
706 Ga0207699_10166688
707 Ga0207643_10083327
708 Ga0207654_10074982
709 Ga0207654_10323331
710 Ga0207707_10609276
711 Ga0207671_10039948
712 Ga0207663_10596647
713 Ga0207660_10276920
714 Ga0207660_10335539
715 Ga0207662_10694741
716 Ga0207657_10000487
717 Ga0207652_10481021
718 Ga0207681_11178061
719 Ga0207694_10006191
720 Ga0207650_10118049
721 Ga0207659_11458855
722 Ga0207687_10000138
723 Ga0207687_10031121
724 Ga0207687_10287184
725 Ga0207687_10349638
726 Ga0207644_10157742
727 Ga0207644_10368496
728 Ga0207690_10013584
729 Ga0207690_10562899
730 Ga0207706_10019003
731 Ga0207706_10042078
732 Ga0207706_10064101
733 Ga0207686_10113391
734 Ga0207686_10414690
735 Ga0207709_10146791
736 Ga0207709_10528328
737 Ga0207709_10834707
738 Ga0207709_11245959
739 Ga0207670_10024439
740 Ga0207669_10091114
741 Ga0207704_10240031
742 Ga0207704_10269779
743 Ga0207704_10489237
744 Ga0207691_10146439
745 Ga0207691_10257735
746 Ga0207711_10335474
747 Ga0207711_10392219
748 Ga0207711_11050987
749 Ga0207689_10052566
750 Ga0207661_10067999
751 Ga0207661_10147965
752 Ga0207661_10335142
753 Ga0207679_10524330
754 Ga0207667_10006618
755 Ga0207667_11153425
756 Ga0207712_10016010
757 Ga0207712_11198710
758 Ga0207640_10126622
759 Ga0207640_10270798
760 Ga0207658_10203439
761 Ga0207658_10233924
762 Ga0207677_10001777
763 Ga0207677_10078976
764 Ga0207703_10280862
765 Ga0207639_10057577
766 Ga0207639_10259645
767 Ga0207678_10209282
768 Ga0207708_10014331
769 Ga0207708_10035014
770 Ga0207641_10330073
771 Ga0207674_10232427
772 Ga0207675_100179905
773 Ga0207675_100387646
774 Ga0207675_100455787
775 Ga0207683_10049437
776 Ga0207683_10106218
777 Ga0207698_10036893
778 Ga0207698_10237451
779 Ga0207698_11377278
780 Ga0207428_10741086
781 Ga0207428_10797496
782 Ga0268264_10235906
783 Ga0268264_10294366
784 Ga0307405_10092653
785 Ga0307410_11407342
786 Ga0307416_100562226
787 Ga0307415_100586659
788 Ga0373934_0099479
789 Ga0373944_0210186
790 Ga0373923_0303903
791 Ga0373936_0019575
792 Ga0373939_0463388
793 Ga0373945_0029379
794 Ga0373957_0068726
795 Ga0373943_0002150
796 Ga0373943_0003852
797 Ga0373943_0119719
798 Ga0373946_0020705
799 Ga0373955_0373967
800 Ga0373924_0047287
801 Ga0373931_0327246
802 Ga0373935_0085514
803 Ga0373935_1230271
804 Ga0373927_0081541
805 Ga0373927_0265601
806 Ga0373927_1031028
807 Ga0373933_0226894
808 Ga0373947_0046972
809 Ga0373937_0128847
810 Ga0373925_0234776
811 Ga0395899_0004928
812 Ga0395899_0014087
813 Ga0395899_0216985
814 Ga0395899_1013200
815 Ga0395900_0001810
816 Ga0395900_0026049
817 Ga0395900_0034341
818 Ga0395900_0576700
819 Ga0395900_0592890
820 Ga0395900_1451949
821 Ga0395898_0002634
822 Ga0395898_0049486
823 Ga0395898_0070469
824 Ga0395898_0090355
825 Ga0395898_0095534
826 Ga0395898_1704178
827 Ga0395905_0012912
828 Ga0395905_0013593
829 Ga0395905_0087679
830 Ga0395905_0200696
831 Ga0395905_0886565
832 Ga0395901_0009676
833 Ga0395901_0010238
834 Ga0395901_0035902
835 Ga0395901_0055611
836 Ga0395901_0196521
837 Ga0395901_0434635
838 Ga0439453_0004813
839 Ga0451793_1524031
840 Ga0451795_0786567
841 Ga0451795_1211917
842 Ga0451845_0731638
843 Ga0439448_0206773
844 Ga0439454_005154
845 Ga0450919_024594
846 Ga0453683_0622615
847 Ga0466964_0165222
848 Ga0466960_0252245
849 Ga0466959_1170863
850 Ga0466967_0507976
851 Ga0495603_0029760
852 Ga0495629_0007380
853 Ga0495641_0005237
854 Ga0495653_0011373
855 Ga0495580_0482512
856 Ga0495639_0004628
857 Ga0495662_0000608
858 Ga0495662_0595637
859 Ga0495584_0202232
860 Ga0495594_0000927
861 Ga0495594_0032684
862 Ga0495594_0147530
863 Ga0495618_0009265
864 Ga0495628_0290018
865 Ga0495628_0794015
866 Ga0495652_0024292
867 Ga0495652_0413045
868 Ga0495665_0006471
869 Ga0495640_0005209
870 Ga0495586_0035765
871 Ga0495621_0365207
872 Ga0495622_0137363
873 Ga0495622_0533321
874 Ga0495667_0048425
875 Ga0495634_0002813
876 Ga0495659_0251482
877 Ga0495588_0019728
878 Ga0495657_0001586
879 Ga0495599_0064346
880 Ga0495599_0291404
881 Ga0495647_0057271
882 Ga0495647_0208920
883 Ga0495658_0019203
884 Ga0495613_0136500
885 Ga0495624_0002913
886 Ga0495671_0252705
887 Ga0495589_0015559
888 Ga0495600_0012507
889 Ga0495581_0003434
890 Ga0495604_0054087
891 Ga0495676_0047038
892 Ga0495676_0335296
893 Ga0495675_0384967
894 Ga0495677_0073498
895 Ga0495684_0331378
896 Ga0495593_0234607
897 Ga0495602_0311917
898 Ga0495614_0037399
899 Ga0496100_0007788
900 Ga0496100_0025644
901 Ga0496100_0118060
902 Ga0496100_0441402
903 Ga0496100_0715858
904 Ga0496101_0006710
905 Ga0496101_0119836
906 Ga0496101_0266250
907 Ga0496101_0273339
908 Ga0496101_0314159
909 Ga0496101_0478607
910 Ga0496101_1153098
911 Ga0496102_0002474
912 Ga0496102_0547047
913 Ga0496103_0005915
914 Ga0496103_0055107
915 Ga0496103_0822757
916 Ga0496104_0005490
917 Ga0496104_0027777
918 Ga0496104_0773753
919 Ga0496104_1368516
920 Ga0496105_0010912
921 Ga0496105_0219193
922 Ga0496106_0001965
923 Ga0496106_0057502
924 Ga0496106_0134655
925 Ga0496106_0178019
926 Ga0496107_0000334
927 Ga0496108_0000291
928 Ga0496108_0034836
929 Ga0496108_0091956
930 Ga0496108_0185567
931 Ga0496108_0915637
932 Ga0496109_0002610
933 Ga0496109_0073516
934 Ga0496109_0079611
935 Ga0496109_0117622
936 Ga0496109_0146687
937 Ga0496109_0388268
938 Ga0496109_0658804
939 Ga0496110_0000510
940 Ga0496110_0000774
941 Ga0496110_0103762
942 Ga0496110_0252607
943 Ga0496110_0325522
944 Ga0496111_0000517
945 Ga0496111_0037893
946 Ga0496111_0584470
947 Ga0496112_0007065
948 Ga0496112_0020936
949 Ga0496112_0047329
950 Ga0496112_0459393
951 Ga0496113_0000190
952 Ga0496113_0568961
953 Ga0496113_0900176
954 Ga0496114_0012601
955 Ga0496114_0025448
956 Ga0496114_0035480
957 Ga0496114_0202594
958 Ga0496114_0237920
959 Ga0496115_0034818
960 Ga0496115_0036574
961 Ga0496115_0055658
962 Ga0496115_0350285
963 Ga0501031_0014453
964 Ga0501032_0160186
965 Ga0501032_0244211
966 Ga0501033_0035314
967 Ga0501033_0206482
968 Ga0501036_0030512
969 Ga0501036_0059250
970 Ga0501037_0059376
971 Ga0501038_0037084
972 Ga0501038_0046541
973 Ga0501038_0389823
974 Ga0501039_0042488
975 Ga0501039_0380997
976 Ga0501040_0016612
977 Ga0501040_0074407
978 Ga0501040_1080651
979 Ga0501041_0042058
980 Ga0501041_0067823
981 Ga0501041_0203632
982 Ga0501042_0031104
983 Ga0501042_0042924
984 Ga0501043_0122642
985 Ga0501046_0042295
986 Ga0501048_0087520
987 Ga0501048_0198871
988 Ga0501067_0220123
989 Ga0501068_0023059
990 Ga0501068_0114712
991 Ga0501068_0194209
992 Ga0501068_0881642
993 Ga0501069_0072190
994 Ga0501069_0173631
995 Ga0501070_0016178
996 Ga0501070_0412652
997 Ga0501071_0051525
998 Ga0501071_0098929
999 Ga0501071_0240338
1000 Ga0501072_0015308
1001 Ga0501072_0018829
1002 Ga0501072_0134372
1003 Ga0501073_0023097
1004 Ga0501074_0116980
1005 Ga0501074_0458581
1006 Ga0501075_0453077
1007 Ga0501075_0475140
1008 Ga0501076_0019681
1009 Ga0501076_0065513
1010 Ga0501077_0012645
1011 Ga0501077_0124169
1012 Ga0501077_0200802
1013 Ga0501079_0131177
1014 Ga0501079_0207871
1015 Ga0501079_0417831
1016 Ga0501079_1267298
1017 Ga0501080_0033101
1018 Ga0501080_0838024
1019 Ga0501080_1773548
1020 Ga0501081_0335638
1021 Ga0501083_0074441
1022 Ga0501035_0040865
1023 Ga0501044_0075258
1024 Ga0501045_0014609
1025 Ga0501045_0318766
1026 nmdc:mga05p37_24202_c1
1027 nmdc:mga05p37_263108_c1
1028 nmdc:mga05p37_271390_c1
1029 nmdc:mga05p37_65421_c1
1030 nmdc:mga0qj67_76892_c1
1031 nmdc:mga06r32_108641_c1
1032 nmdc:mga08y16_100767_c1
1033 nmdc:mga08y16_1466716_c1
1034 nmdc:mga08y16_650660_c1
1035 nmdc:mga0n895_11821_c1
1036 nmdc:mga0n895_5084_c1
1037 nmdc:mga0n895_654322_c1
1038 nmdc:mga0rr50_242823_c1
1039 nmdc:mga0rr50_329_c1
1040 nmdc:mga0rr50_5600_c1
1041 nmdc:mga0rr50_676904_c1
1042 nmdc:mga08x19_293286_c1
1043 nmdc:mga08x19_313192_c1
1044 nmdc:mga08x19_6471_c1
1045 nmdc:mga08x19_658349_c1
1046 nmdc:mga0a205_17379_c2
1047 nmdc:mga0a205_225797_c1
1048 nmdc:mga0a205_22691_c1
1049 Ga0495612_0023441
1050 Ga0495619_0128512
1051 Ga0501084_0097011
1052 Ga0501084_0100974
1053 Ga0501082_2013484
1054 Ga0530510_0052962
1055 Ga0530510_0068338
1056 Ga0530510_0227985

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04237

YjbR

YjbR

27

132

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cd7-assembly1.cif.gz_A crystal structure of the ntd l199m of drosophila oskar protein 0.787 4 32
2n4t-assembly1.cif.gz_A nmr structure of fbp28 ww domain l453w mutant 0.7464 11 32
5vb0-assembly6.cif.gz_H crystal structure of fosfomycin resistance protein fosa3 0.7351 2 32
2n4w-assembly1.cif.gz_A nmr structure of fbp28 ww domain t456y mutant 0.6853 11 29
3oxh-assembly1.cif.gz_A mycobacterium tuberculosis kinase inhibitor homolog rv0577 0.6802 2 33
ID Description Score Start End Superfamily
af_O53222_1_83_3.30.920.30 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.7093 2 35 3.30.920.30
af_P9WL91_4_123_3.30.70.1230 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.7077 1 122 3.30.70.1230
af_P9WL91_4_123_3.30.70.1230 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.698 1 122 3.30.70.1230
3oxhA01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.6802 2 33 3.10.180.10
af_Q9VP47_1_234_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6499 1 29 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2E9MVU1-F1-model_v4 Uncharacterized protein 0.8623 4 36
AF-A0A4Q7WC82-F1-model_v4 deleted 0.8405 2 35
AF-A0A848YD34-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.8243 2 41 GO:0003677
AF-A0A6I6S411-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.819 2 41
AF-A0A538CKX9-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.8101 1 97

Map