F459387

General Info

Members Datasets Scaffolds Average Seq Length
526 260 1052 99

Family's Representative Sequence

Representative Sequence 3300006163|Ga0070715_10720883|Ga0070715_107208832
Length 116
Sequence MRRIVPSATGSVARYHRGMATLSRSDVEHVAHLARLGLTDEELGRLEGQLNHILDQYAILAEVPTDHIAPTAQTIELENILREDVVTPSLPVADVVRNAAEHEGDLIVVPAILGGD

Samples

Sample ID Description Type Environment
1 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
148 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
149 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
150 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
151 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
152 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
153 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
154 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
155 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
156 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
157 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
158 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
159 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
160 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
161 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
162 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
165 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
174 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
175 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
176 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
179 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
180 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
181 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
182 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
183 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
184 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
185 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
188 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
189 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
190 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
191 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
192 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
193 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
194 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
195 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
196 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
197 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
198 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
199 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
200 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
201 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
202 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
203 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
204 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
205 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
206 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
207 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
214 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
215 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
234 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
235 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
236 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
237 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
238 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
239 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
240 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
241 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
242 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
243 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
244 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
245 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
246 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
247 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
248 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
251 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
252 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
253 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
254 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
255 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
256 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
257 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
258 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
259 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
260 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.19
Nodule 0
Rhizoplane 9.13
Rhizosphere 90.68
Stem 0
Stem Tuber 0
Unclassified 8.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070715_10720883 3300006163 Bacteria 598
2 JGI24742J22300_10010744 3300002244 Bacteria 1516
3 Ga0065712_10467128 3300005290 Bacteria 639
4 Ga0065712_10468017 3300005290 Bacteria 672
5 Ga0065715_10903218 3300005293 Unclassified 574
6 Ga0070658_10579043 3300005327 Bacteria 972
7 Ga0070676_10695706 3300005328 Bacteria 742
8 Ga0070690_100008229 3300005330 Bacteria 6000
9 Ga0070670_100023487 3300005331 Bacteria 5307
10 Ga0070670_100461347 3300005331 Bacteria 1127
11 Ga0070677_10792070 3300005333 Bacteria 541
12 Ga0070666_10374847 3300005335 Bacteria 1021
13 Ga0070680_100700363 3300005336 Bacteria 872
14 Ga0070682_100063072 3300005337 Bacteria 2349
15 Ga0068868_100011106 3300005338 Bacteria 6552
16 Ga0068868_100445950 3300005338 Bacteria 1125
17 Ga0068868_102063573 3300005338 Unclassified 542
18 Ga0070660_100077478 3300005339 Bacteria 2605
19 Ga0070689_100002884 3300005340 Bacteria 11307
20 Ga0070691_10144047 3300005341 Bacteria 1217
21 Ga0070687_100000769 3300005343 Bacteria 10662
22 Ga0070692_10002793 3300005345 Bacteria 6886
23 Ga0070692_10011847 3300005345 Bacteria 4019
24 Ga0070692_10386161 3300005345 Bacteria 880
25 Ga0070668_100014998 3300005347 Bacteria 5789
26 Ga0070669_100030992 3300005353 Bacteria 3861
27 Ga0070669_100755630 3300005353 Bacteria 824
28 Ga0070675_100002223 3300005354 Bacteria 14397
29 Ga0070675_100780773 3300005354 Bacteria 873
30 Ga0070674_100001178 3300005356 Bacteria 13731
31 Ga0070674_100375462 3300005356 Bacteria 1155
32 Ga0070674_101686047 3300005356 Bacteria 573
33 Ga0070673_100260908 3300005364 Bacteria 1514
34 Ga0070688_100002121 3300005365 Bacteria 9998
35 Ga0070688_101254783 3300005365 Bacteria 597
36 Ga0070659_100019644 3300005366 Bacteria 5125
37 Ga0070667_100340728 3300005367 Bacteria 1356
38 Ga0070703_10499799 3300005406 Bacteria 547
39 Ga0070705_100220282 3300005440 Bacteria 1313
40 Ga0070700_100010105 3300005441 Bacteria 5197
41 Ga0070700_100772583 3300005441 Bacteria 771
42 Ga0070694_100005694 3300005444 Bacteria 7555
43 Ga0070694_100077824 3300005444 Bacteria 2299
44 Ga0070694_100170290 3300005444 Bacteria 1604
45 Ga0070708_100005397 3300005445 Bacteria 10137
46 Ga0070708_100006051 3300005445 Bacteria 9623
47 Ga0070708_100689444 3300005445 Bacteria 962
48 Ga0070708_100698797 3300005445 Bacteria 955
49 Ga0070708_100826475 3300005445 Bacteria 871
50 Ga0070663_100986318 3300005455 Bacteria 732
51 Ga0070678_100134370 3300005456 Bacteria 1971
52 Ga0070662_100004271 3300005457 Bacteria 9016
53 Ga0070662_100339224 3300005457 Bacteria 1229
54 Ga0070681_10244916 3300005458 Bacteria 1706
55 Ga0070681_10556336 3300005458 Unclassified 1061
56 Ga0070681_11073008 3300005458 Bacteria 726
57 Ga0068867_100049519 3300005459 Bacteria 3093
58 Ga0070685_10222761 3300005466 Bacteria 1237
59 Ga0070685_10349366 3300005466 Bacteria 1010
60 Ga0070706_100000652 3300005467 Bacteria 39619
61 Ga0070706_100010814 3300005467 Bacteria 8471
62 Ga0070706_100148373 3300005467 Bacteria 2189
63 Ga0070706_100269915 3300005467 Bacteria 1588
64 Ga0070707_100001833 3300005468 Bacteria 20413
65 Ga0070707_100036467 3300005468 Bacteria 4692
66 Ga0070707_100234338 3300005468 Bacteria 1786
67 Ga0070707_100613371 3300005468 Bacteria 1050
68 Ga0070698_100508809 3300005471 Bacteria 1142
69 Ga0070698_101015721 3300005471 Bacteria 777
70 Ga0070698_101035224 3300005471 Bacteria 768
71 Ga0070699_100221592 3300005518 Bacteria 1686
72 Ga0070699_101301384 3300005518 Bacteria 667
73 Ga0070699_101965090 3300005518 Bacteria 535
74 Ga0070684_100019079 3300005535 Bacteria 5668
75 Ga0070684_100234392 3300005535 Bacteria 1676
76 Ga0070684_100701130 3300005535 Bacteria 944
77 Ga0070697_100049478 3300005536 Bacteria 3411
78 Ga0068853_100212919 3300005539 Bacteria 1762
79 Ga0070672_100004097 3300005543 Bacteria 9519
80 Ga0070672_100736148 3300005543 Bacteria 865
81 Ga0070672_101384893 3300005543 Unclassified 629
82 Ga0070686_100028529 3300005544 Bacteria 3385
83 Ga0070686_100311289 3300005544 Unclassified 1171
84 Ga0070686_101666934 3300005544 Bacteria 541
85 Ga0070695_101479434 3300005545 Unclassified 565
86 Ga0070696_100037010 3300005546 Bacteria 3366
87 Ga0070696_100172933 3300005546 Bacteria 1598
88 Ga0070696_100193383 3300005546 Bacteria 1515
89 Ga0070696_100666292 3300005546 Bacteria 845
90 Ga0070696_101741650 3300005546 Unclassified 538
91 Ga0070693_100235797 3300005547 Bacteria 1206
92 Ga0070693_100373168 3300005547 Bacteria 982
93 Ga0070693_100937850 3300005547 Bacteria 651
94 Ga0070704_100061389 3300005549 Bacteria 2690
95 Ga0070704_100120534 3300005549 Bacteria 2014
96 Ga0070704_100172376 3300005549 Bacteria 1722
97 Ga0068857_100062121 3300005577 Bacteria 3320
98 Ga0068856_100721411 3300005614 Bacteria 1017
99 Ga0070702_100261006 3300005615 Bacteria 1179
100 Ga0070702_100590872 3300005615 Bacteria 831
101 Ga0068852_101547468 3300005616 Bacteria 685
102 Ga0068859_100003929 3300005617 Bacteria 15179
103 Ga0068864_100348386 3300005618 Bacteria 1397
104 Ga0068861_100087684 3300005719 Bacteria 2449
105 Ga0068863_100563456 3300005841 Bacteria 1126
106 Ga0068863_100937862 3300005841 Bacteria 867
107 Ga0068858_100234643 3300005842 Bacteria 1739
108 Ga0068858_101481446 3300005842 Bacteria 669
109 Ga0068860_100288016 3300005843 Bacteria 1607
110 Ga0068860_101036226 3300005843 Bacteria 839
111 Ga0068862_100031466 3300005844 Bacteria 4480
112 Ga0081455_10666929 3300005937 Bacteria 667
113 Ga0081539_10002575 3300005985 Bacteria 25032
114 Ga0075432_10377574 3300006058 Unclassified 607
115 Ga0097621_100276230 3300006237 Bacteria 1478
116 Ga0068871_100456662 3300006358 Bacteria 1146
117 Ga0075428_100116374 3300006844 Bacteria 2912
118 Ga0075428_100168104 3300006844 Bacteria 2378
119 Ga0075428_100972854 3300006844 Bacteria 899
120 Ga0075431_100285461 3300006847 Bacteria 1671
121 Ga0075433_11541388 3300006852 Unclassified 574
122 Ga0075434_100071027 3300006871 Bacteria 3473
123 Ga0068865_100043153 3300006881 Bacteria 3079
124 Ga0097620_100003929 3300006931 Bacteria 15179
125 Ga0105244_10308407 3300009036 Bacteria 732
126 Ga0111539_10150884 3300009094 Bacteria 2720
127 Ga0111539_10330938 3300009094 Bacteria 1773
128 Ga0111539_11411077 3300009094 Bacteria 808
129 Ga0111539_12570827 3300009094 Bacteria 590
130 Ga0105245_10034411 3300009098 Bacteria 4494
131 Ga0105245_10945748 3300009098 Bacteria 904
132 Ga0105247_10116847 3300009101 Bacteria 1723
133 Ga0105247_11454885 3300009101 Bacteria 557
134 Ga0114129_10047309 3300009147 Bacteria 6045
135 Ga0114129_10237833 3300009147 Bacteria 2449
136 Ga0114129_10323501 3300009147 Bacteria 2050
137 Ga0114129_10548200 3300009147 Bacteria 1504
138 Ga0114129_11938718 3300009147 Bacteria 713
139 Ga0105243_10002853 3300009148 Bacteria 14323
140 Ga0105243_10130442 3300009148 Bacteria 2132
141 Ga0105243_10234487 3300009148 Bacteria 1630
142 Ga0105243_11114648 3300009148 Bacteria 798
143 Ga0105242_10045048 3300009176 Bacteria 3574
144 Ga0105242_10252828 3300009176 Bacteria 1589
145 Ga0105248_10084553 3300009177 Bacteria 3569
146 Ga0105248_10347386 3300009177 Bacteria 1670
147 Ga0105248_10661879 3300009177 Bacteria 1178
148 Ga0105248_11034168 3300009177 Bacteria 928
149 Ga0105249_10003789 3300009553 Bacteria 13064
150 Ga0105249_10007699 3300009553 Bacteria 9388
151 Ga0099796_10288146 3300010159 Bacteria 692
152 Ga0105239_10010101 3300010375 Bacteria 10581
153 Ga0105239_10778053 3300010375 Bacteria 1096
154 Ga0105239_12452309 3300010375 Bacteria 608
155 Ga0105246_10543006 3300011119 Bacteria 995
156 Ga0157369_12237051 3300013105 Bacteria 554
157 Ga0157378_10004439 3300013297 Bacteria 12341
158 Ga0157378_11780208 3300013297 Unclassified 664
159 Ga0163162_10555931 3300013306 Bacteria 1276
160 Ga0163162_11545411 3300013306 Bacteria 756
161 Ga0157372_11710884 3300013307 Unclassified 724
162 Ga0157375_10105712 3300013308 Bacteria 2906
163 Ga0157375_10862734 3300013308 Bacteria 1051
164 Ga0157375_11114947 3300013308 Bacteria 924
165 Ga0163163_10006201 3300014325 Bacteria 10429
166 Ga0163163_10265013 3300014325 Bacteria 1769
167 Ga0163163_10294882 3300014325 Bacteria 1674
168 Ga0157380_10007308 3300014326 Bacteria 7839
169 Ga0157380_10413070 3300014326 Bacteria 1284
170 Ga0157380_11301659 3300014326 Bacteria 774
171 Ga0157377_10012148 3300014745 Bacteria 4322
172 Ga0157379_10072456 3300014968 Bacteria 3082
173 Ga0157379_10085014 3300014968 Bacteria 2835
174 Ga0157379_12336986 3300014968 Bacteria 533
175 Ga0157376_10929493 3300014969 Bacteria 889
176 Ga0157376_11154771 3300014969 Bacteria 801
177 Ga0163161_10189235 3300017792 Bacteria 1581
178 Ga0206353_10434727 3300020082 Bacteria 535
179 Ga0207653_10084668 3300025885 Unclassified 1102
180 Ga0207682_10175286 3300025893 Bacteria 977
181 Ga0207642_10931054 3300025899 Bacteria 558
182 Ga0207710_10288307 3300025900 Bacteria 827
183 Ga0207688_10004251 3300025901 Bacteria 7806
184 Ga0207688_10463324 3300025901 Unclassified 791
185 Ga0207688_10796756 3300025901 Bacteria 598
186 Ga0207680_10956431 3300025903 Bacteria 614
187 Ga0207647_10200776 3300025904 Bacteria 1154
188 Ga0207645_10090122 3300025907 Bacteria 1972
189 Ga0207645_10157017 3300025907 Bacteria 1487
190 Ga0207645_10393048 3300025907 Bacteria 932
191 Ga0207684_10000698 3300025910 Bacteria 39706
192 Ga0207684_10127823 3300025910 Bacteria 2181
193 Ga0207684_11217091 3300025910 Bacteria 623
194 Ga0207707_10514647 3300025912 Unclassified 1020
195 Ga0207707_10582042 3300025912 Unclassified 949
196 Ga0207662_10000293 3300025918 Bacteria 23069
197 Ga0207657_10034293 3300025919 Bacteria 4567
198 Ga0207652_11162333 3300025921 Bacteria 673
199 Ga0207652_11423261 3300025921 Bacteria 597
200 Ga0207652_11692011 3300025921 Unclassified 537
201 Ga0207646_10004060 3300025922 Bacteria 16158
202 Ga0207646_10021251 3300025922 Bacteria 5999
203 Ga0207646_10035523 3300025922 Bacteria 4501
204 Ga0207646_10514924 3300025922 Bacteria 1077
205 Ga0207646_10603143 3300025922 Bacteria 985
206 Ga0207681_10024994 3300025923 Bacteria 3838
207 Ga0207650_10040404 3300025925 Bacteria 3413
208 Ga0207650_10877677 3300025925 Bacteria 761
209 Ga0207659_10032563 3300025926 Bacteria 3579
210 Ga0207659_10090024 3300025926 Bacteria 2289
211 Ga0207687_10035602 3300025927 Bacteria 3387
212 Ga0207690_10004466 3300025932 Bacteria 8260
213 Ga0207706_10013253 3300025933 Bacteria 7501
214 Ga0207709_10146930 3300025935 Bacteria 1628
215 Ga0207709_10254668 3300025935 Bacteria 1284
216 Ga0207709_10342336 3300025935 Bacteria 1126
217 Ga0207709_10521163 3300025935 Bacteria 930
218 Ga0207670_10019295 3300025936 Bacteria 4163
219 Ga0207669_10302506 3300025937 Bacteria 1216
220 Ga0207704_10013239 3300025938 Bacteria 4122
221 Ga0207665_11154789 3300025939 Bacteria 618
222 Ga0207691_10130235 3300025940 Bacteria 2223
223 Ga0207711_10096799 3300025941 Bacteria 2605
224 Ga0207711_10364119 3300025941 Bacteria 1340
225 Ga0207689_10221623 3300025942 Bacteria 1563
226 Ga0207661_10263207 3300025944 Bacteria 1537
227 Ga0207661_11683619 3300025944 Unclassified 579
228 Ga0207651_10801047 3300025960 Bacteria 835
229 Ga0207651_11447352 3300025960 Bacteria 619
230 Ga0207712_10007664 3300025961 Bacteria 6827
231 Ga0207712_10068823 3300025961 Bacteria 2538
232 Ga0207712_11142958 3300025961 Bacteria 694
233 Ga0207668_10015620 3300025972 Bacteria 4720
234 Ga0207658_10995643 3300025986 Bacteria 765
235 Ga0207677_10978078 3300026023 Bacteria 766
236 Ga0207703_10096172 3300026035 Bacteria 2500
237 Ga0207703_10193642 3300026035 Bacteria 1802
238 Ga0207703_10327093 3300026035 Bacteria 1405
239 Ga0207639_10153938 3300026041 Bacteria 1929
240 Ga0207678_10118641 3300026067 Bacteria 2258
241 Ga0207708_10000889 3300026075 Bacteria 22462
242 Ga0207702_11632659 3300026078 Bacteria 638
243 Ga0207641_10322714 3300026088 Bacteria 1465
244 Ga0207648_10020029 3300026089 Bacteria 6035
245 Ga0207648_10175740 3300026089 Bacteria 1894
246 Ga0207648_10974583 3300026089 Unclassified 794
247 Ga0207676_10186718 3300026095 Bacteria 1820
248 Ga0207676_10873175 3300026095 Bacteria 881
249 Ga0207674_10047617 3300026116 Bacteria 4393
250 Ga0207674_10430951 3300026116 Bacteria 1274
251 Ga0207674_11257323 3300026116 Bacteria 710
252 Ga0207675_100121783 3300026118 Bacteria 2469
253 Ga0207675_100778038 3300026118 Bacteria 969
254 Ga0207683_10156628 3300026121 Bacteria 2058
255 Ga0207683_11157930 3300026121 Bacteria 717
256 Ga0207698_10296969 3300026142 Bacteria 1502
257 Ga0209998_10060435 3300027717 Bacteria 892
258 Ga0209998_10069925 3300027717 Bacteria 838
259 Ga0209974_10072072 3300027876 Bacteria 1179
260 Ga0268265_10093677 3300028380 Bacteria 2407
261 Ga0268265_10404909 3300028380 Bacteria 1262
262 Ga0268264_10044163 3300028381 Bacteria 3696
263 Ga0265337_1178107 3300028556 Bacteria 577
264 Ga0265319_1013332 3300028563 Bacteria 3275
265 Ga0265334_10024129 3300028573 Bacteria 2469
266 Ga0265334_10024527 3300028573 Bacteria 2445
267 Ga0265334_10043879 3300028573 Bacteria 1738
268 Ga0265318_10020022 3300028577 Bacteria 2706
269 Ga0265318_10145403 3300028577 Bacteria 870
270 Ga0265322_10011350 3300028654 Bacteria 2585
271 Ga0265322_10047250 3300028654 Bacteria 1224
272 Ga0265338_10035823 3300028800 Bacteria 4760
273 Ga0265338_10233666 3300028800 Bacteria 1366
274 Ga0265338_11007178 3300028800 Bacteria 564
275 Ga0265324_10104804 3300029957 Bacteria 960
276 Ga0265330_10257899 3300031235 Bacteria 734
277 Ga0265330_10296889 3300031235 Bacteria 681
278 Ga0265332_10166300 3300031238 Unclassified 921
279 Ga0265320_10001970 3300031240 Bacteria 14512
280 Ga0265320_10067564 3300031240 Bacteria 1691
281 Ga0265320_10261671 3300031240 Bacteria 766
282 Ga0265325_10027497 3300031241 Bacteria 3074
283 Ga0265325_10070435 3300031241 Bacteria 1757
284 Ga0265329_10010475 3300031242 Bacteria 3399
285 Ga0265340_10001907 3300031247 Bacteria 11894
286 Ga0265340_10168128 3300031247 Bacteria 994
287 Ga0265339_10029874 3300031249 Bacteria 3089
288 Ga0265339_10094130 3300031249 Bacteria 1567
289 Ga0265331_10068267 3300031250 Bacteria 1667
290 Ga0265331_10148740 3300031250 Bacteria 1064
291 Ga0265316_10033522 3300031344 Bacteria 4181
292 Ga0265316_10160004 3300031344 Bacteria 1684
293 Ga0265316_10183005 3300031344 Bacteria 1559
294 Ga0265316_10336746 3300031344 Bacteria 1094
295 Ga0265316_10466749 3300031344 Bacteria 904
296 Ga0265316_11259967 3300031344 Bacteria 511
297 Ga0307408_100127901 3300031548 Bacteria 1978
298 Ga0307408_101361132 3300031548 Bacteria 667
299 Ga0265313_10025219 3300031595 Bacteria 3158
300 Ga0265313_10083564 3300031595 Bacteria 1446
301 Ga0265314_10046673 3300031711 Bacteria 3054
302 Ga0265314_10389185 3300031711 Bacteria 757
303 Ga0307405_10030358 3300031731 Bacteria 3169
304 Ga0316577_10030098 3300031733 Bacteria 3030
305 Ga0307406_10054425 3300031901 Bacteria 2554
306 Ga0307409_100678389 3300031995 Bacteria 1027
307 Ga0307409_102011694 3300031995 Bacteria 607
308 Ga0307416_100013372 3300032002 Bacteria 5575
309 Ga0307416_100285308 3300032002 Bacteria 1631
310 Ga0307416_101284630 3300032002 Unclassified 838
311 Ga0307416_102384363 3300032002 Bacteria 629
312 Ga0307416_103128786 3300032002 Bacteria 554
313 Ga0307411_10550948 3300032005 Bacteria 984
314 Ga0307415_100007795 3300032126 Bacteria 5883
315 Ga0373952_0214698 3300035092 Bacteria 569
316 Ga0373941_0022448 3300035115 Bacteria 1791
317 Ga0373962_0047444 3300035242 Bacteria 1229
318 Ga0373931_0073116 3300035691 Bacteria 1876
319 Ga0373937_0443372 3300036401 Bacteria 1233
320 Ga0373937_0586564 3300036401 Bacteria 1058
321 Ga0316584_0062934 3300036712 Bacteria 2778
322 Ga0316581_0032265 3300037588 Bacteria 1580
323 Ga0451798_0573668 3300041458 Bacteria 779
324 Ga0451800_1370156 3300041459 Unclassified 661
325 Ga0451807_0382051 3300041486 Unclassified 584
326 Ga0439463_101823 3300042016 Bacteria 741
327 Ga0450916_019296 3300042530 Unclassified 925
328 Ga0453683_0289611 3300044673 Bacteria 1047
329 Ga0451576_1646328 3300045051 Bacteria 665
330 Ga0451576_1744376 3300045051 Bacteria 644
331 Ga0495603_0050324 3300046455 Bacteria 2478
332 Ga0495603_0228177 3300046455 Bacteria 1074
333 Ga0495651_0432452 3300046462 Bacteria 853
334 Ga0495653_0557955 3300046463 Unclassified 708
335 Ga0495605_0482670 3300046474 Bacteria 508
336 Ga0495584_0413933 3300046491 Bacteria 685
337 Ga0495584_0570802 3300046491 Unclassified 577
338 Ga0495596_0228825 3300046500 Bacteria 722
339 Ga0495607_0510238 3300046501 Unclassified 532
340 Ga0495618_0615734 3300046514 Bacteria 645
341 Ga0495630_1375539 3300046517 Bacteria 531
342 Ga0495644_0115926 3300046523 Bacteria 1018
343 Ga0495644_0394884 3300046523 Bacteria 547
344 Ga0495656_0310884 3300046615 Unclassified 810
345 Ga0495635_0211373 3300046663 Bacteria 1314
346 Ga0495658_0261857 3300046683 Bacteria 1089
347 Ga0495658_1008205 3300046683 Bacteria 532
348 Ga0495613_0860421 3300046689 Unclassified 589
349 Ga0495624_0237686 3300046690 Bacteria 1103
350 Ga0495624_0246082 3300046690 Bacteria 1082
351 Ga0495604_0334467 3300047317 Bacteria 1010
352 Ga0495636_0225816 3300047318 Unclassified 860
353 Ga0495676_1004132 3300047321 Bacteria 532
354 Ga0495680_0331600 3300047322 Bacteria 1063
355 Ga0495680_0733341 3300047322 Bacteria 650
356 Ga0495680_0876571 3300047322 Unclassified 581
357 Ga0496100_0008826 3300048903 Bacteria 5638
358 Ga0496100_0574180 3300048903 Unclassified 874
359 Ga0496101_0008214 3300048904 Bacteria 6816
360 Ga0496101_0094469 3300048904 Bacteria 2229
361 Ga0496101_0138014 3300048904 Bacteria 1857
362 Ga0496102_0155712 3300048905 Bacteria 2148
363 Ga0496102_0167456 3300048905 Bacteria 2068
364 Ga0496102_0821389 3300048905 Bacteria 852
365 Ga0496103_0320457 3300048906 Bacteria 997
366 Ga0496103_0411903 3300048906 Bacteria 868
367 Ga0496104_0002688 3300048907 Bacteria 15312
368 Ga0496104_0071993 3300048907 Bacteria 3286
369 Ga0496104_0096235 3300048907 Bacteria 2832
370 Ga0496105_0038046 3300048908 Bacteria 3963
371 Ga0496105_0054619 3300048908 Bacteria 3298
372 Ga0496105_0674184 3300048908 Bacteria 796
373 Ga0496106_0155012 3300048909 Bacteria 1808
374 Ga0496106_0203703 3300048909 Bacteria 1575
375 Ga0496107_0079208 3300048910 Bacteria 2395
376 Ga0496107_0674643 3300048910 Bacteria 761
377 Ga0496108_0004551 3300048911 Bacteria 11174
378 Ga0496108_0011250 3300048911 Bacteria 7270
379 Ga0496108_0167972 3300048911 Bacteria 1897
380 Ga0496108_0981055 3300048911 Bacteria 722
381 Ga0496109_0005601 3300048912 Bacteria 10510
382 Ga0496109_0027751 3300048912 Bacteria 5058
383 Ga0496109_0044994 3300048912 Bacteria 4005
384 Ga0496109_0530397 3300048912 Bacteria 1111
385 Ga0496110_0215842 3300048913 Bacteria 1744
386 Ga0496110_0272358 3300048913 Bacteria 1541
387 Ga0496110_0401461 3300048913 Bacteria 1249
388 Ga0496110_0479117 3300048913 Bacteria 1133
389 Ga0496111_0083745 3300048914 Bacteria 2331
390 Ga0496111_0169703 3300048914 Bacteria 1621
391 Ga0496112_0000007 3300048915 Bacteria 338850
392 Ga0496112_0006712 3300048915 Bacteria 10135
393 Ga0496112_0410232 3300048915 Bacteria 1294
394 Ga0496113_0024928 3300048916 Bacteria 4258
395 Ga0496113_0050149 3300048916 Bacteria 3111
396 Ga0496113_0065463 3300048916 Bacteria 2751
397 Ga0496113_0454133 3300048916 Bacteria 1030
398 Ga0496114_0034009 3300048917 Bacteria 4203
399 Ga0496114_0162962 3300048917 Bacteria 1940
400 Ga0496114_0246737 3300048917 Bacteria 1571
401 Ga0496114_0384897 3300048917 Bacteria 1242
402 Ga0501031_0058943 3300049568 Bacteria 2502
403 Ga0501031_0119854 3300049568 Unclassified 1719
404 Ga0501031_0282688 3300049568 Bacteria 1076
405 Ga0501031_0673395 3300049568 Bacteria 665
406 Ga0501031_0754463 3300049568 Bacteria 624
407 Ga0501033_0744524 3300049570 Bacteria 665
408 Ga0501036_0161791 3300049572 Bacteria 1887
409 Ga0501036_0265310 3300049572 Bacteria 1438
410 Ga0501036_1661527 3300049572 Bacteria 515
411 Ga0501037_0117610 3300049573 Bacteria 1913
412 Ga0501037_0968609 3300049573 Unclassified 555
413 Ga0501038_0365602 3300049574 Bacteria 1121
414 Ga0501038_0521333 3300049574 Bacteria 907
415 Ga0501039_0254654 3300049575 Bacteria 1380
416 Ga0501039_0339304 3300049575 Bacteria 1181
417 Ga0501039_0404978 3300049575 Bacteria 1071
418 Ga0501039_1334187 3300049575 Bacteria 553
419 Ga0501040_0025628 3300049576 Bacteria 3966
420 Ga0501040_0060221 3300049576 Bacteria 2609
421 Ga0501040_0203272 3300049576 Bacteria 1407
422 Ga0501040_0231841 3300049576 Bacteria 1315
423 Ga0501040_0420620 3300049576 Bacteria 960
424 Ga0501041_0035945 3300049577 Bacteria 3002
425 Ga0501041_0160209 3300049577 Unclassified 1407
426 Ga0501041_0687742 3300049577 Bacteria 654
427 Ga0501042_0155083 3300049578 Bacteria 1652
428 Ga0501042_0453869 3300049578 Bacteria 930
429 Ga0501042_1100746 3300049578 Unclassified 579
430 Ga0501043_0408804 3300049579 Bacteria 1025
431 Ga0501043_0471165 3300049579 Bacteria 941
432 Ga0501046_0033988 3300049580 Bacteria 4117
433 Ga0501048_0137742 3300049582 Bacteria 1725
434 Ga0501048_0244482 3300049582 Bacteria 1273
435 Ga0501048_0824128 3300049582 Bacteria 667
436 Ga0501067_0042037 3300049583 Bacteria 2538
437 Ga0501068_0054087 3300049584 Bacteria 2432
438 Ga0501068_0511481 3300049584 Bacteria 779
439 Ga0501068_0529189 3300049584 Bacteria 766
440 Ga0501068_1050482 3300049584 Bacteria 538
441 Ga0501069_0013876 3300049585 Bacteria 4301
442 Ga0501070_0407679 3300049586 Bacteria 1099
443 Ga0501070_0812192 3300049586 Bacteria 734
444 Ga0501071_0063541 3300049587 Bacteria 2677
445 Ga0501071_0080496 3300049587 Bacteria 2382
446 Ga0501071_0240164 3300049587 Unclassified 1366
447 Ga0501071_0260966 3300049587 Bacteria 1309
448 Ga0501071_0343329 3300049587 Unclassified 1136
449 Ga0501072_0056948 3300049588 Bacteria 3080
450 Ga0501072_0285057 3300049588 Bacteria 1313
451 Ga0501072_0373329 3300049588 Bacteria 1132
452 Ga0501072_0691004 3300049588 Bacteria 802
453 Ga0501072_1328634 3300049588 Bacteria 557
454 Ga0501073_0076375 3300049589 Bacteria 2331
455 Ga0501074_0056868 3300049590 Bacteria 2819
456 Ga0501074_0086061 3300049590 Bacteria 2252
457 Ga0501074_0457015 3300049590 Bacteria 905
458 Ga0501074_0856483 3300049590 Unclassified 640
459 Ga0501075_0076222 3300049591 Bacteria 2536
460 Ga0501075_0077041 3300049591 Bacteria 2523
461 Ga0501075_0094895 3300049591 Bacteria 2264
462 Ga0501075_0216934 3300049591 Bacteria 1459
463 Ga0501075_0317015 3300049591 Bacteria 1188
464 Ga0501075_1102378 3300049591 Bacteria 603
465 Ga0501075_1131833 3300049591 Unclassified 594
466 Ga0501075_1248630 3300049591 Unclassified 563
467 Ga0501076_0020830 3300049592 Bacteria 5022
468 Ga0501076_0180833 3300049592 Bacteria 1719
469 Ga0501076_0423619 3300049592 Bacteria 1095
470 Ga0501076_0445096 3300049592 Bacteria 1066
471 Ga0501076_0816216 3300049592 Bacteria 769
472 Ga0501076_0990042 3300049592 Bacteria 693
473 Ga0501077_0157305 3300049593 Bacteria 1443
474 Ga0501077_0457755 3300049593 Bacteria 817
475 Ga0501077_0561064 3300049593 Unclassified 733
476 Ga0501077_0833317 3300049593 Bacteria 593
477 Ga0501079_0010478 3300049741 Bacteria 7050
478 Ga0501079_0115957 3300049741 Bacteria 2082
479 Ga0501079_0164668 3300049741 Bacteria 1729
480 Ga0501079_0362711 3300049741 Bacteria 1136
481 Ga0501080_0153711 3300049742 Bacteria 2126
482 Ga0501080_0373115 3300049742 Bacteria 1286
483 Ga0501080_1070664 3300049742 Bacteria 697
484 Ga0501080_1374927 3300049742 Bacteria 603
485 Ga0501081_0068065 3300049743 Bacteria 2478
486 Ga0501081_0187995 3300049743 Bacteria 1495
487 Ga0501081_0304985 3300049743 Bacteria 1168
488 Ga0501081_0359766 3300049743 Bacteria 1073
489 Ga0501081_0459794 3300049743 Unclassified 946
490 Ga0501083_0255004 3300049744 Bacteria 1142
491 Ga0501035_0175461 3300049822 Bacteria 1849
492 Ga0501035_0665005 3300049822 Bacteria 843
493 Ga0501044_0305480 3300049823 Bacteria 1519
494 Ga0501045_0031601 3300049824 Bacteria 3835
495 Ga0501045_0133049 3300049824 Bacteria 1849
496 Ga0501045_0376139 3300049824 Bacteria 1057
497 nmdc:mga0yw44_636711_c1 3300050492 Unclassified 725
498 nmdc:mga05p37_111318_c1 3300050507 Bacteria 3367
499 nmdc:mga06r32_1006491_c1 3300050510 Bacteria 786
500 nmdc:mga08y16_35056_c1 3300050511 Bacteria 5271
501 nmdc:mga08y16_62470_c1 3300050511 Bacteria 3890
502 nmdc:mga0n895_80648_c1 3300050512 Bacteria 3242
503 nmdc:mga0a205_1085153_c1 3300050515 Unclassified 648
504 nmdc:mga0a205_197243_c1 3300050515 Bacteria 1904
505 Ga0495595_0437049 3300053084 Bacteria 665
506 Ga0501084_0113064 3300054114 Bacteria 2282
507 Ga0501084_0125983 3300054114 Bacteria 2155
508 Ga0501084_0255216 3300054114 Bacteria 1480
509 Ga0501084_0262376 3300054114 Bacteria 1458
510 Ga0501084_0525437 3300054114 Bacteria 1000
511 Ga0501084_0644009 3300054114 Bacteria 895
512 Ga0501084_0847611 3300054114 Unclassified 769
513 Ga0501084_0982438 3300054114 Bacteria 710
514 Ga0501084_1230506 3300054114 Unclassified 628
515 Ga0501082_0159954 3300060353 Bacteria 1957
516 Ga0501082_0244457 3300060353 Bacteria 1562
517 Ga0501082_0339291 3300060353 Bacteria 1309
518 Ga0501082_0546858 3300060353 Bacteria 1013
519 Ga0501082_1804662 3300060353 Bacteria 533
520 Ga0530510_0023693 3300061734 Bacteria 4377
521 Ga0530510_0056309 3300061734 Bacteria 2840
522 Ga0530510_0058068 3300061734 Bacteria 2797
523 Ga0530510_0339625 3300061734 Bacteria 1127
524 Ga0530510_0447633 3300061734 Bacteria 976
525 Ga0530510_0459916 3300061734 Bacteria 963
526 Ga0530510_0727337 3300061734 Bacteria 757
527 Ga0070715_10720883
528 JGI24742J22300_10010744
529 Ga0065712_10467128
530 Ga0065712_10468017
531 Ga0065715_10903218
532 Ga0070658_10579043
533 Ga0070676_10695706
534 Ga0070690_100008229
535 Ga0070670_100023487
536 Ga0070670_100461347
537 Ga0070677_10792070
538 Ga0070666_10374847
539 Ga0070680_100700363
540 Ga0070682_100063072
541 Ga0068868_100011106
542 Ga0068868_100445950
543 Ga0068868_102063573
544 Ga0070660_100077478
545 Ga0070689_100002884
546 Ga0070691_10144047
547 Ga0070687_100000769
548 Ga0070692_10002793
549 Ga0070692_10011847
550 Ga0070692_10386161
551 Ga0070668_100014998
552 Ga0070669_100030992
553 Ga0070669_100755630
554 Ga0070675_100002223
555 Ga0070675_100780773
556 Ga0070674_100001178
557 Ga0070674_100375462
558 Ga0070674_101686047
559 Ga0070673_100260908
560 Ga0070688_100002121
561 Ga0070688_101254783
562 Ga0070659_100019644
563 Ga0070667_100340728
564 Ga0070703_10499799
565 Ga0070705_100220282
566 Ga0070700_100010105
567 Ga0070700_100772583
568 Ga0070694_100005694
569 Ga0070694_100077824
570 Ga0070694_100170290
571 Ga0070708_100005397
572 Ga0070708_100006051
573 Ga0070708_100689444
574 Ga0070708_100698797
575 Ga0070708_100826475
576 Ga0070663_100986318
577 Ga0070678_100134370
578 Ga0070662_100004271
579 Ga0070662_100339224
580 Ga0070681_10244916
581 Ga0070681_10556336
582 Ga0070681_11073008
583 Ga0068867_100049519
584 Ga0070685_10222761
585 Ga0070685_10349366
586 Ga0070706_100000652
587 Ga0070706_100010814
588 Ga0070706_100148373
589 Ga0070706_100269915
590 Ga0070707_100001833
591 Ga0070707_100036467
592 Ga0070707_100234338
593 Ga0070707_100613371
594 Ga0070698_100508809
595 Ga0070698_101015721
596 Ga0070698_101035224
597 Ga0070699_100221592
598 Ga0070699_101301384
599 Ga0070699_101965090
600 Ga0070684_100019079
601 Ga0070684_100234392
602 Ga0070684_100701130
603 Ga0070697_100049478
604 Ga0068853_100212919
605 Ga0070672_100004097
606 Ga0070672_100736148
607 Ga0070672_101384893
608 Ga0070686_100028529
609 Ga0070686_100311289
610 Ga0070686_101666934
611 Ga0070695_101479434
612 Ga0070696_100037010
613 Ga0070696_100172933
614 Ga0070696_100193383
615 Ga0070696_100666292
616 Ga0070696_101741650
617 Ga0070693_100235797
618 Ga0070693_100373168
619 Ga0070693_100937850
620 Ga0070704_100061389
621 Ga0070704_100120534
622 Ga0070704_100172376
623 Ga0068857_100062121
624 Ga0068856_100721411
625 Ga0070702_100261006
626 Ga0070702_100590872
627 Ga0068852_101547468
628 Ga0068859_100003929
629 Ga0068864_100348386
630 Ga0068861_100087684
631 Ga0068863_100563456
632 Ga0068863_100937862
633 Ga0068858_100234643
634 Ga0068858_101481446
635 Ga0068860_100288016
636 Ga0068860_101036226
637 Ga0068862_100031466
638 Ga0081455_10666929
639 Ga0081539_10002575
640 Ga0075432_10377574
641 Ga0097621_100276230
642 Ga0068871_100456662
643 Ga0075428_100116374
644 Ga0075428_100168104
645 Ga0075428_100972854
646 Ga0075431_100285461
647 Ga0075433_11541388
648 Ga0075434_100071027
649 Ga0068865_100043153
650 Ga0097620_100003929
651 Ga0105244_10308407
652 Ga0111539_10150884
653 Ga0111539_10330938
654 Ga0111539_11411077
655 Ga0111539_12570827
656 Ga0105245_10034411
657 Ga0105245_10945748
658 Ga0105247_10116847
659 Ga0105247_11454885
660 Ga0114129_10047309
661 Ga0114129_10237833
662 Ga0114129_10323501
663 Ga0114129_10548200
664 Ga0114129_11938718
665 Ga0105243_10002853
666 Ga0105243_10130442
667 Ga0105243_10234487
668 Ga0105243_11114648
669 Ga0105242_10045048
670 Ga0105242_10252828
671 Ga0105248_10084553
672 Ga0105248_10347386
673 Ga0105248_10661879
674 Ga0105248_11034168
675 Ga0105249_10003789
676 Ga0105249_10007699
677 Ga0099796_10288146
678 Ga0105239_10010101
679 Ga0105239_10778053
680 Ga0105239_12452309
681 Ga0105246_10543006
682 Ga0157369_12237051
683 Ga0157378_10004439
684 Ga0157378_11780208
685 Ga0163162_10555931
686 Ga0163162_11545411
687 Ga0157372_11710884
688 Ga0157375_10105712
689 Ga0157375_10862734
690 Ga0157375_11114947
691 Ga0163163_10006201
692 Ga0163163_10265013
693 Ga0163163_10294882
694 Ga0157380_10007308
695 Ga0157380_10413070
696 Ga0157380_11301659
697 Ga0157377_10012148
698 Ga0157379_10072456
699 Ga0157379_10085014
700 Ga0157379_12336986
701 Ga0157376_10929493
702 Ga0157376_11154771
703 Ga0163161_10189235
704 Ga0206353_10434727
705 Ga0207653_10084668
706 Ga0207682_10175286
707 Ga0207642_10931054
708 Ga0207710_10288307
709 Ga0207688_10004251
710 Ga0207688_10463324
711 Ga0207688_10796756
712 Ga0207680_10956431
713 Ga0207647_10200776
714 Ga0207645_10090122
715 Ga0207645_10157017
716 Ga0207645_10393048
717 Ga0207684_10000698
718 Ga0207684_10127823
719 Ga0207684_11217091
720 Ga0207707_10514647
721 Ga0207707_10582042
722 Ga0207662_10000293
723 Ga0207657_10034293
724 Ga0207652_11162333
725 Ga0207652_11423261
726 Ga0207652_11692011
727 Ga0207646_10004060
728 Ga0207646_10021251
729 Ga0207646_10035523
730 Ga0207646_10514924
731 Ga0207646_10603143
732 Ga0207681_10024994
733 Ga0207650_10040404
734 Ga0207650_10877677
735 Ga0207659_10032563
736 Ga0207659_10090024
737 Ga0207687_10035602
738 Ga0207690_10004466
739 Ga0207706_10013253
740 Ga0207709_10146930
741 Ga0207709_10254668
742 Ga0207709_10342336
743 Ga0207709_10521163
744 Ga0207670_10019295
745 Ga0207669_10302506
746 Ga0207704_10013239
747 Ga0207665_11154789
748 Ga0207691_10130235
749 Ga0207711_10096799
750 Ga0207711_10364119
751 Ga0207689_10221623
752 Ga0207661_10263207
753 Ga0207661_11683619
754 Ga0207651_10801047
755 Ga0207651_11447352
756 Ga0207712_10007664
757 Ga0207712_10068823
758 Ga0207712_11142958
759 Ga0207668_10015620
760 Ga0207658_10995643
761 Ga0207677_10978078
762 Ga0207703_10096172
763 Ga0207703_10193642
764 Ga0207703_10327093
765 Ga0207639_10153938
766 Ga0207678_10118641
767 Ga0207708_10000889
768 Ga0207702_11632659
769 Ga0207641_10322714
770 Ga0207648_10020029
771 Ga0207648_10175740
772 Ga0207648_10974583
773 Ga0207676_10186718
774 Ga0207676_10873175
775 Ga0207674_10047617
776 Ga0207674_10430951
777 Ga0207674_11257323
778 Ga0207675_100121783
779 Ga0207675_100778038
780 Ga0207683_10156628
781 Ga0207683_11157930
782 Ga0207698_10296969
783 Ga0209998_10060435
784 Ga0209998_10069925
785 Ga0209974_10072072
786 Ga0268265_10093677
787 Ga0268265_10404909
788 Ga0268264_10044163
789 Ga0265337_1178107
790 Ga0265319_1013332
791 Ga0265334_10024129
792 Ga0265334_10024527
793 Ga0265334_10043879
794 Ga0265318_10020022
795 Ga0265318_10145403
796 Ga0265322_10011350
797 Ga0265322_10047250
798 Ga0265338_10035823
799 Ga0265338_10233666
800 Ga0265338_11007178
801 Ga0265324_10104804
802 Ga0265330_10257899
803 Ga0265330_10296889
804 Ga0265332_10166300
805 Ga0265320_10001970
806 Ga0265320_10067564
807 Ga0265320_10261671
808 Ga0265325_10027497
809 Ga0265325_10070435
810 Ga0265329_10010475
811 Ga0265340_10001907
812 Ga0265340_10168128
813 Ga0265339_10029874
814 Ga0265339_10094130
815 Ga0265331_10068267
816 Ga0265331_10148740
817 Ga0265316_10033522
818 Ga0265316_10160004
819 Ga0265316_10183005
820 Ga0265316_10336746
821 Ga0265316_10466749
822 Ga0265316_11259967
823 Ga0307408_100127901
824 Ga0307408_101361132
825 Ga0265313_10025219
826 Ga0265313_10083564
827 Ga0265314_10046673
828 Ga0265314_10389185
829 Ga0307405_10030358
830 Ga0316577_10030098
831 Ga0307406_10054425
832 Ga0307409_100678389
833 Ga0307409_102011694
834 Ga0307416_100013372
835 Ga0307416_100285308
836 Ga0307416_101284630
837 Ga0307416_102384363
838 Ga0307416_103128786
839 Ga0307411_10550948
840 Ga0307415_100007795
841 Ga0373952_0214698
842 Ga0373941_0022448
843 Ga0373962_0047444
844 Ga0373931_0073116
845 Ga0373937_0443372
846 Ga0373937_0586564
847 Ga0316584_0062934
848 Ga0316581_0032265
849 Ga0451798_0573668
850 Ga0451800_1370156
851 Ga0451807_0382051
852 Ga0439463_101823
853 Ga0450916_019296
854 Ga0453683_0289611
855 Ga0451576_1646328
856 Ga0451576_1744376
857 Ga0495603_0050324
858 Ga0495603_0228177
859 Ga0495651_0432452
860 Ga0495653_0557955
861 Ga0495605_0482670
862 Ga0495584_0413933
863 Ga0495584_0570802
864 Ga0495596_0228825
865 Ga0495607_0510238
866 Ga0495618_0615734
867 Ga0495630_1375539
868 Ga0495644_0115926
869 Ga0495644_0394884
870 Ga0495656_0310884
871 Ga0495635_0211373
872 Ga0495658_0261857
873 Ga0495658_1008205
874 Ga0495613_0860421
875 Ga0495624_0237686
876 Ga0495624_0246082
877 Ga0495604_0334467
878 Ga0495636_0225816
879 Ga0495676_1004132
880 Ga0495680_0331600
881 Ga0495680_0733341
882 Ga0495680_0876571
883 Ga0496100_0008826
884 Ga0496100_0574180
885 Ga0496101_0008214
886 Ga0496101_0094469
887 Ga0496101_0138014
888 Ga0496102_0155712
889 Ga0496102_0167456
890 Ga0496102_0821389
891 Ga0496103_0320457
892 Ga0496103_0411903
893 Ga0496104_0002688
894 Ga0496104_0071993
895 Ga0496104_0096235
896 Ga0496105_0038046
897 Ga0496105_0054619
898 Ga0496105_0674184
899 Ga0496106_0155012
900 Ga0496106_0203703
901 Ga0496107_0079208
902 Ga0496107_0674643
903 Ga0496108_0004551
904 Ga0496108_0011250
905 Ga0496108_0167972
906 Ga0496108_0981055
907 Ga0496109_0005601
908 Ga0496109_0027751
909 Ga0496109_0044994
910 Ga0496109_0530397
911 Ga0496110_0215842
912 Ga0496110_0272358
913 Ga0496110_0401461
914 Ga0496110_0479117
915 Ga0496111_0083745
916 Ga0496111_0169703
917 Ga0496112_0000007
918 Ga0496112_0006712
919 Ga0496112_0410232
920 Ga0496113_0024928
921 Ga0496113_0050149
922 Ga0496113_0065463
923 Ga0496113_0454133
924 Ga0496114_0034009
925 Ga0496114_0162962
926 Ga0496114_0246737
927 Ga0496114_0384897
928 Ga0501031_0058943
929 Ga0501031_0119854
930 Ga0501031_0282688
931 Ga0501031_0673395
932 Ga0501031_0754463
933 Ga0501033_0744524
934 Ga0501036_0161791
935 Ga0501036_0265310
936 Ga0501036_1661527
937 Ga0501037_0117610
938 Ga0501037_0968609
939 Ga0501038_0365602
940 Ga0501038_0521333
941 Ga0501039_0254654
942 Ga0501039_0339304
943 Ga0501039_0404978
944 Ga0501039_1334187
945 Ga0501040_0025628
946 Ga0501040_0060221
947 Ga0501040_0203272
948 Ga0501040_0231841
949 Ga0501040_0420620
950 Ga0501041_0035945
951 Ga0501041_0160209
952 Ga0501041_0687742
953 Ga0501042_0155083
954 Ga0501042_0453869
955 Ga0501042_1100746
956 Ga0501043_0408804
957 Ga0501043_0471165
958 Ga0501046_0033988
959 Ga0501048_0137742
960 Ga0501048_0244482
961 Ga0501048_0824128
962 Ga0501067_0042037
963 Ga0501068_0054087
964 Ga0501068_0511481
965 Ga0501068_0529189
966 Ga0501068_1050482
967 Ga0501069_0013876
968 Ga0501070_0407679
969 Ga0501070_0812192
970 Ga0501071_0063541
971 Ga0501071_0080496
972 Ga0501071_0240164
973 Ga0501071_0260966
974 Ga0501071_0343329
975 Ga0501072_0056948
976 Ga0501072_0285057
977 Ga0501072_0373329
978 Ga0501072_0691004
979 Ga0501072_1328634
980 Ga0501073_0076375
981 Ga0501074_0056868
982 Ga0501074_0086061
983 Ga0501074_0457015
984 Ga0501074_0856483
985 Ga0501075_0076222
986 Ga0501075_0077041
987 Ga0501075_0094895
988 Ga0501075_0216934
989 Ga0501075_0317015
990 Ga0501075_1102378
991 Ga0501075_1131833
992 Ga0501075_1248630
993 Ga0501076_0020830
994 Ga0501076_0180833
995 Ga0501076_0423619
996 Ga0501076_0445096
997 Ga0501076_0816216
998 Ga0501076_0990042
999 Ga0501077_0157305
1000 Ga0501077_0457755
1001 Ga0501077_0561064
1002 Ga0501077_0833317
1003 Ga0501079_0010478
1004 Ga0501079_0115957
1005 Ga0501079_0164668
1006 Ga0501079_0362711
1007 Ga0501080_0153711
1008 Ga0501080_0373115
1009 Ga0501080_1070664
1010 Ga0501080_1374927
1011 Ga0501081_0068065
1012 Ga0501081_0187995
1013 Ga0501081_0304985
1014 Ga0501081_0359766
1015 Ga0501081_0459794
1016 Ga0501083_0255004
1017 Ga0501035_0175461
1018 Ga0501035_0665005
1019 Ga0501044_0305480
1020 Ga0501045_0031601
1021 Ga0501045_0133049
1022 Ga0501045_0376139
1023 nmdc:mga0yw44_636711_c1
1024 nmdc:mga05p37_111318_c1
1025 nmdc:mga06r32_1006491_c1
1026 nmdc:mga08y16_35056_c1
1027 nmdc:mga08y16_62470_c1
1028 nmdc:mga0n895_80648_c1
1029 nmdc:mga0a205_1085153_c1
1030 nmdc:mga0a205_197243_c1
1031 Ga0495595_0437049
1032 Ga0501084_0113064
1033 Ga0501084_0125983
1034 Ga0501084_0255216
1035 Ga0501084_0262376
1036 Ga0501084_0525437
1037 Ga0501084_0644009
1038 Ga0501084_0847611
1039 Ga0501084_0982438
1040 Ga0501084_1230506
1041 Ga0501082_0159954
1042 Ga0501082_0244457
1043 Ga0501082_0339291
1044 Ga0501082_0546858
1045 Ga0501082_1804662
1046 Ga0530510_0023693
1047 Ga0530510_0056309
1048 Ga0530510_0058068
1049 Ga0530510_0339625
1050 Ga0530510_0447633
1051 Ga0530510_0459916
1052 Ga0530510_0727337

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02686

GatC

Glu-tRNAGln amidotransferase C subunit

38

109

0.96

Map