F459321

General Info

Members Datasets Scaffolds Average Seq Length
525 272 1050 332

Family's Representative Sequence

Representative Sequence 3300046518|Ga0495631_0089951|Ga0495631_0089951_230_1264
Length 333
Sequence MARERGGNEASVPSAGRGVARRPYDLFTSVSLLRDPGASESLTTVLVAFGANVLVAVAKSVAATVTGSASLVAEAAHSWADTGNETFLLIAKRRSRHAPDAAHPLGYGRETYVWSLFAAIGLFVAGAAVSVTHGIQELMHPEPASHFAVGYVVLGQSVRQAKPEAESVQRDLIEYVLAAWDPTLRAVFAEDSAALIGLVIAAVGLAAHQVTGSVVPDAAGSILVGVLLAIIAVVLINCNRLFLVGQEAGPLVRKAALQTLLDTPEVARVTYLRLEIVGPRMIFVIGDVDLTGDDTESHVAIRLRALEAKISESPAVADAVLSLSAPDEPSITA

Samples

Sample ID Description Type Environment
1 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
160 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
161 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
162 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
163 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
164 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
165 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
166 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
168 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
169 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
170 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
171 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
172 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
173 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
174 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
175 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
176 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
177 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
178 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
179 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
183 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
186 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
187 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
188 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
189 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
190 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
191 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
192 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
193 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
194 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
195 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
196 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
197 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
198 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
199 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
200 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
201 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
202 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
203 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
204 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
205 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
206 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
207 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
208 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
209 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
210 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
211 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
212 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
213 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
214 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
215 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
216 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
217 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
218 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
219 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
220 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
221 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
222 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
223 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
224 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
225 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
226 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
227 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
228 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
229 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
230 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
231 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
232 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
233 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
234 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
237 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
238 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
242 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
243 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
244 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
245 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
246 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
247 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
248 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
249 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
250 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
253 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
254 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
255 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
256 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
257 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
258 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
259 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
260 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
261 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
262 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
263 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
264 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
265 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
266 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
267 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
268 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
269 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
270 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
271 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
272 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.29
Metatranscriptomes 0.19
Isolates 1.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.57
Nodule 0
Rhizoplane 14.1
Rhizosphere 84.19
Stem 0
Stem Tuber 0
Unclassified 7.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495631_0089951 3300046518 Bacteria 1322
2 JGI24746J21847_1013332 3300001977 Bacteria 1196
3 Ga0055542_1002226 3300003762 Bacteria 6834
4 Ga0070658_10337454 3300005327 Bacteria 1289
5 Ga0070676_10063463 3300005328 Bacteria 2200
6 Ga0068869_100003397 3300005334 Bacteria 9721
7 Ga0068869_100013908 3300005334 Bacteria 5366
8 Ga0070680_100141424 3300005336 Bacteria 2018
9 Ga0070682_100001094 3300005337 Bacteria 15563
10 Ga0070682_100028610 3300005337 Bacteria 3353
11 Ga0070682_100090892 3300005337 Bacteria 1997
12 Ga0068868_100003449 3300005338 Bacteria 11011
13 Ga0068868_100028224 3300005338 Unclassified 4288
14 Ga0070660_100102686 3300005339 Bacteria 2266
15 Ga0070689_100003919 3300005340 Bacteria 9978
16 Ga0070691_10006262 3300005341 Bacteria 5435
17 Ga0070661_100010988 3300005344 Bacteria 6310
18 Ga0070692_10004986 3300005345 Bacteria 5606
19 Ga0070668_100022513 3300005347 Unclassified 4764
20 Ga0070675_100010145 3300005354 Bacteria 7346
21 Ga0070671_100027019 3300005355 Bacteria 4722
22 Ga0070671_100038191 3300005355 Bacteria 3986
23 Ga0070674_100159325 3300005356 Bacteria 1711
24 Ga0070674_100236818 3300005356 Unclassified 1427
25 Ga0070673_100417907 3300005364 Bacteria 1202
26 Ga0070688_100059111 3300005365 Bacteria 2416
27 Ga0070667_100240421 3300005367 Bacteria 1616
28 Ga0070667_100286313 3300005367 Bacteria 1481
29 Ga0070709_10005832 3300005434 Bacteria 6675
30 Ga0070709_10090489 3300005434 Bacteria 2017
31 Ga0070709_10116840 3300005434 Bacteria 1801
32 Ga0070709_10124699 3300005434 Unclassified 1750
33 Ga0070709_10139842 3300005434 Bacteria 1662
34 Ga0070709_10290191 3300005434 Bacteria 1192
35 Ga0070714_100103269 3300005435 Bacteria 2514
36 Ga0070713_100009023 3300005436 Bacteria 7109
37 Ga0070713_100038394 3300005436 Bacteria 3880
38 Ga0070713_100183108 3300005436 Bacteria 1883
39 Ga0070713_100243186 3300005436 Bacteria 1639
40 Ga0070713_100246749 3300005436 Bacteria 1627
41 Ga0070710_10032869 3300005437 Bacteria 2813
42 Ga0070710_10084954 3300005437 Bacteria 1855
43 Ga0070701_10017482 3300005438 Bacteria 3352
44 Ga0070711_100029709 3300005439 Bacteria 3610
45 Ga0070705_100054068 3300005440 Unclassified 2353
46 Ga0070700_100038133 3300005441 Bacteria 2927
47 Ga0070700_100053643 3300005441 Bacteria 2517
48 Ga0070663_100012475 3300005455 Bacteria 5378
49 Ga0070663_100157329 3300005455 Bacteria 1747
50 Ga0070678_100035027 3300005456 Unclassified 3501
51 Ga0070678_100036184 3300005456 Bacteria 3453
52 Ga0070678_100187899 3300005456 Bacteria 1696
53 Ga0070662_100015327 3300005457 Bacteria 5131
54 Ga0070662_100018947 3300005457 Bacteria 4664
55 Ga0070662_100050120 3300005457 Bacteria 3012
56 Ga0070662_100220233 3300005457 Bacteria 1514
57 Ga0070681_10168890 3300005458 Bacteria 2109
58 Ga0070706_100007331 3300005467 Bacteria 10347
59 Ga0070706_100017661 3300005467 Bacteria 6583
60 Ga0070698_100045553 3300005471 Bacteria 4489
61 Ga0070679_100024526 3300005530 Bacteria 5910
62 Ga0070684_100008801 3300005535 Bacteria 7914
63 Ga0068853_100171425 3300005539 Bacteria 1963
64 Ga0070672_100043241 3300005543 Bacteria 3473
65 Ga0070672_100133671 3300005543 Bacteria 2041
66 Ga0070672_100295334 3300005543 Bacteria 1372
67 Ga0070686_100163658 3300005544 Bacteria 1568
68 Ga0070695_100018276 3300005545 Unclassified 4256
69 Ga0070696_100050796 3300005546 Bacteria 2882
70 Ga0070696_100068899 3300005546 Bacteria 2485
71 Ga0070693_100001721 3300005547 Bacteria 9948
72 Ga0070693_100002153 3300005547 Bacteria 9032
73 Ga0070665_100004127 3300005548 Bacteria 15284
74 Ga0068855_100038737 3300005563 Bacteria 5663
75 Ga0070664_100008311 3300005564 Bacteria 8396
76 Ga0070664_100272635 3300005564 Bacteria 1524
77 Ga0068857_100016808 3300005577 Bacteria 6410
78 Ga0068857_100030732 3300005577 Unclassified 4744
79 Ga0068854_100035683 3300005578 Bacteria 3482
80 Ga0068856_100005325 3300005614 Bacteria 12700
81 Ga0068856_100015263 3300005614 Bacteria 7421
82 Ga0068856_100076238 3300005614 Bacteria 3322
83 Ga0068856_100119608 3300005614 Bacteria 2635
84 Ga0068856_100164049 3300005614 Bacteria 2233
85 Ga0070702_100006782 3300005615 Bacteria 5444
86 Ga0070702_100070892 3300005615 Unclassified 2058
87 Ga0070702_100288522 3300005615 Bacteria 1130
88 Ga0068852_100009655 3300005616 Bacteria 7169
89 Ga0068852_100070102 3300005616 Unclassified 3074
90 Ga0068859_100052484 3300005617 Bacteria 4099
91 Ga0068864_100011626 3300005618 Bacteria 7269
92 Ga0068864_100053146 3300005618 Bacteria 3493
93 Ga0068866_10025932 3300005718 Unclassified 2762
94 Ga0068861_100004792 3300005719 Bacteria 9092
95 Ga0068861_100039379 3300005719 Unclassified 3527
96 Ga0068870_10002431 3300005840 Bacteria 7751
97 Ga0068863_100005938 3300005841 Bacteria 11975
98 Ga0068863_100123708 3300005841 Bacteria 2468
99 Ga0068863_100185783 3300005841 Unclassified 1996
100 Ga0068860_100013652 3300005843 Bacteria 7962
101 Ga0068860_100174902 3300005843 Bacteria 2075
102 Ga0081455_10021847 3300005937 Bacteria 5994
103 Ga0081540_1000176 3300005983 Bacteria 67057
104 Ga0070717_10022906 3300006028 Unclassified 4942
105 Ga0070717_10082032 3300006028 Bacteria 2708
106 Ga0075432_10005688 3300006058 Bacteria 4244
107 Ga0070715_10026014 3300006163 Bacteria 2323
108 Ga0070716_100002045 3300006173 Bacteria 9227
109 Ga0070716_100104780 3300006173 Bacteria 1741
110 Ga0070712_100018950 3300006175 Bacteria 4479
111 Ga0070712_100057707 3300006175 Bacteria 2728
112 Ga0070712_100218087 3300006175 Bacteria 1509
113 Ga0097621_100066143 3300006237 Bacteria 2976
114 Ga0097621_100073687 3300006237 Bacteria 2827
115 Ga0068871_100043751 3300006358 Bacteria 3598
116 Ga0068871_100064850 3300006358 Unclassified 2991
117 Ga0068871_100182902 3300006358 Bacteria 1802
118 Ga0075428_100098626 3300006844 Bacteria 3185
119 Ga0075431_100236279 3300006847 Bacteria 1861
120 Ga0075431_100240976 3300006847 Bacteria 1840
121 Ga0075433_10002153 3300006852 Bacteria 14919
122 Ga0075433_10014396 3300006852 Bacteria 6460
123 Ga0075433_10029041 3300006852 Bacteria 4708
124 Ga0075433_10036600 3300006852 Bacteria 4229
125 Ga0075433_10055623 3300006852 Unclassified 3454
126 Ga0075433_10124700 3300006852 Bacteria 2287
127 Ga0075434_100004744 3300006871 Bacteria 12296
128 Ga0075434_100009517 3300006871 Bacteria 9066
129 Ga0075434_100025752 3300006871 Bacteria 5758
130 Ga0075434_100066405 3300006871 Bacteria 3593
131 Ga0075434_100069752 3300006871 Bacteria 3504
132 Ga0075434_100155493 3300006871 Unclassified 2306
133 Ga0075429_100212274 3300006880 Bacteria 1696
134 Ga0068865_100049029 3300006881 Bacteria 2909
135 Ga0068865_100292197 3300006881 Bacteria 1301
136 Ga0075436_100002226 3300006914 Bacteria 13397
137 Ga0075436_100023897 3300006914 Bacteria 4200
138 Ga0075436_100046661 3300006914 Bacteria 2988
139 Ga0075436_100069342 3300006914 Bacteria 2436
140 Ga0075436_100114969 3300006914 Bacteria 1879
141 Ga0097620_100052479 3300006931 Bacteria 4099
142 Ga0075435_100002756 3300007076 Bacteria 11733
143 Ga0075435_100005988 3300007076 Bacteria 8557
144 Ga0075435_100031221 3300007076 Bacteria 4194
145 Ga0075435_100042128 3300007076 Bacteria 3651
146 Ga0075435_100084396 3300007076 Bacteria 2613
147 Ga0075435_100179214 3300007076 Bacteria 1790
148 Ga0105251_10042705 3300009011 Unclassified 2198
149 Ga0111539_10086548 3300009094 Bacteria 3682
150 Ga0105245_10026740 3300009098 Bacteria 5081
151 Ga0105247_10022074 3300009101 Bacteria 3831
152 Ga0105247_10040107 3300009101 Bacteria 2861
153 Ga0105247_10109405 3300009101 Bacteria 1776
154 Ga0114129_10005103 3300009147 Bacteria 18490
155 Ga0114129_10208500 3300009147 Bacteria 2643
156 Ga0105243_10001801 3300009148 Bacteria 18399
157 Ga0105241_10176626 3300009174 Bacteria 1768
158 Ga0105242_10028509 3300009176 Bacteria 4447
159 Ga0105242_10159058 3300009176 Bacteria 1976
160 Ga0105237_10138865 3300009545 Bacteria 2424
161 Ga0105238_10035612 3300009551 Bacteria 5060
162 Ga0105249_10013038 3300009553 Bacteria 7336
163 Ga0105249_10087219 3300009553 Bacteria 2911
164 Ga0105239_10017758 3300010375 Bacteria 7870
165 Ga0105239_10143207 3300010375 Unclassified 2665
166 Ga0105246_10000885 3300011119 Bacteria 17178
167 Ga0105246_10051411 3300011119 Bacteria 2830
168 Ga0157373_10014822 3300013100 Bacteria 5710
169 Ga0157370_10072064 3300013104 Bacteria 3260
170 Ga0157369_10000103 3300013105 Bacteria 118273
171 Ga0157369_10135239 3300013105 Bacteria 2610
172 Ga0157374_10038883 3300013296 Bacteria 4376
173 Ga0157374_10041671 3300013296 Bacteria 4232
174 Ga0157374_10150846 3300013296 Bacteria 2260
175 Ga0157374_10191732 3300013296 Unclassified 1999
176 Ga0157378_10053118 3300013297 Bacteria 3607
177 Ga0163162_10148099 3300013306 Bacteria 2464
178 Ga0157372_10016447 3300013307 Bacteria 7938
179 Ga0157372_10318944 3300013307 Bacteria 1809
180 Ga0157372_10587350 3300013307 Bacteria 1298
181 Ga0157375_10021369 3300013308 Bacteria 5932
182 Ga0157375_10041730 3300013308 Bacteria 4433
183 Ga0157375_10050053 3300013308 Bacteria 4097
184 Ga0157375_10186412 3300013308 Bacteria 2228
185 Ga0157380_10353648 3300014326 Bacteria 1376
186 Ga0157377_10003289 3300014745 Bacteria 7295
187 Ga0157377_10007357 3300014745 Bacteria 5313
188 Ga0157377_10049895 3300014745 Unclassified 2354
189 Ga0157379_10094347 3300014968 Bacteria 2685
190 Ga0163161_10024549 3300017792 Unclassified 4260
191 Ga0206356_10150727 3300020070 Bacteria 1508
192 Ga0209563_100894 3300025230 Bacteria 8828
193 Ga0207692_10003277 3300025898 Bacteria 6308
194 Ga0207692_10010762 3300025898 Bacteria 3870
195 Ga0207642_10037242 3300025899 Unclassified 2094
196 Ga0207710_10019403 3300025900 Bacteria 2901
197 Ga0207710_10085038 3300025900 Bacteria 1473
198 Ga0207688_10001472 3300025901 Bacteria 12335
199 Ga0207688_10001800 3300025901 Bacteria 11401
200 Ga0207647_10081632 3300025904 Bacteria 1937
201 Ga0207699_10012573 3300025906 Bacteria 4309
202 Ga0207699_10020509 3300025906 Bacteria 3544
203 Ga0207699_10046831 3300025906 Bacteria 2532
204 Ga0207699_10234108 3300025906 Bacteria 1259
205 Ga0207645_10014649 3300025907 Bacteria 5237
206 Ga0207645_10070604 3300025907 Bacteria 2234
207 Ga0207643_10000204 3300025908 Bacteria 41257
208 Ga0207705_10005372 3300025909 Bacteria 9580
209 Ga0207684_10049180 3300025910 Bacteria 3577
210 Ga0207654_10016738 3300025911 Bacteria 3821
211 Ga0207654_10017206 3300025911 Bacteria 3776
212 Ga0207707_10011023 3300025912 Bacteria 7864
213 Ga0207671_10196101 3300025914 Bacteria 1576
214 Ga0207693_10001820 3300025915 Bacteria 18703
215 Ga0207693_10041256 3300025915 Bacteria 3633
216 Ga0207693_10052562 3300025915 Bacteria 3196
217 Ga0207693_10211200 3300025915 Bacteria 1526
218 Ga0207663_10008161 3300025916 Bacteria 5459
219 Ga0207663_10037872 3300025916 Bacteria 2910
220 Ga0207663_10142240 3300025916 Bacteria 1672
221 Ga0207660_10008053 3300025917 Bacteria 6817
222 Ga0207662_10211007 3300025918 Bacteria 1260
223 Ga0207657_10012821 3300025919 Bacteria 8250
224 Ga0207657_10041137 3300025919 Bacteria 4088
225 Ga0207649_10009766 3300025920 Bacteria 5256
226 Ga0207649_10316072 3300025920 Bacteria 1146
227 Ga0207652_10056481 3300025921 Bacteria 3379
228 Ga0207681_10449771 3300025923 Bacteria 1048
229 Ga0207650_10000859 3300025925 Bacteria 23092
230 Ga0207659_10033159 3300025926 Bacteria 3551
231 Ga0207687_10009882 3300025927 Bacteria 6246
232 Ga0207687_10042937 3300025927 Bacteria 3114
233 Ga0207700_10018988 3300025928 Bacteria 4634
234 Ga0207700_10039715 3300025928 Bacteria 3428
235 Ga0207700_10082395 3300025928 Bacteria 2515
236 Ga0207700_10347344 3300025928 Bacteria 1291
237 Ga0207700_10382144 3300025928 Bacteria 1232
238 Ga0207664_10016462 3300025929 Bacteria 5394
239 Ga0207664_10041677 3300025929 Bacteria 3578
240 Ga0207664_10120907 3300025929 Bacteria 2191
241 Ga0207644_10004724 3300025931 Bacteria 8850
242 Ga0207706_10003729 3300025933 Bacteria 14532
243 Ga0207706_10039546 3300025933 Unclassified 4182
244 Ga0207706_10201223 3300025933 Bacteria 1747
245 Ga0207706_10260354 3300025933 Bacteria 1514
246 Ga0207709_10230319 3300025935 Bacteria 1342
247 Ga0207709_10265670 3300025935 Bacteria 1260
248 Ga0207670_10010858 3300025936 Bacteria 5256
249 Ga0207670_10045292 3300025936 Bacteria 2915
250 Ga0207665_10000295 3300025939 Bacteria 34463
251 Ga0207665_10006076 3300025939 Bacteria 8016
252 Ga0207665_10029331 3300025939 Bacteria 3637
253 Ga0207665_10038134 3300025939 Bacteria 3199
254 Ga0207665_10209010 3300025939 Bacteria 1425
255 Ga0207691_10073026 3300025940 Bacteria 3094
256 Ga0207691_10098217 3300025940 Bacteria 2616
257 Ga0207711_10230084 3300025941 Bacteria 1698
258 Ga0207689_10000223 3300025942 Bacteria 50338
259 Ga0207689_10104347 3300025942 Bacteria 2329
260 Ga0207661_10015234 3300025944 Bacteria 5653
261 Ga0207661_10052648 3300025944 Bacteria 3253
262 Ga0207679_10012813 3300025945 Bacteria 5481
263 Ga0207667_10157966 3300025949 Bacteria 2333
264 Ga0207651_10028765 3300025960 Bacteria 3511
265 Ga0207668_10030902 3300025972 Unclassified 3523
266 Ga0207668_10037265 3300025972 Bacteria 3253
267 Ga0207677_10013206 3300026023 Bacteria 4778
268 Ga0207703_10052954 3300026035 Bacteria 3298
269 Ga0207639_10065129 3300026041 Unclassified 2828
270 Ga0207639_10148605 3300026041 Bacteria 1960
271 Ga0207678_10000183 3300026067 Bacteria 53634
272 Ga0207678_10009936 3300026067 Bacteria 8349
273 Ga0207678_10012330 3300026067 Bacteria 7506
274 Ga0207678_10148080 3300026067 Bacteria 2004
275 Ga0207678_10185852 3300026067 Bacteria 1775
276 Ga0207708_10017766 3300026075 Bacteria 5354
277 Ga0207708_10018111 3300026075 Bacteria 5300
278 Ga0207708_10020050 3300026075 Bacteria 5042
279 Ga0207708_10081179 3300026075 Unclassified 2492
280 Ga0207702_10003008 3300026078 Bacteria 15672
281 Ga0207702_10154039 3300026078 Bacteria 2093
282 Ga0207702_10171771 3300026078 Bacteria 1988
283 Ga0207641_10005837 3300026088 Bacteria 10449
284 Ga0207676_10001332 3300026095 Bacteria 18376
285 Ga0207676_10319611 3300026095 Bacteria 1424
286 Ga0207674_10138300 3300026116 Bacteria 2396
287 Ga0207674_10155849 3300026116 Bacteria 2239
288 Ga0207675_100008017 3300026118 Bacteria 9952
289 Ga0207675_100008806 3300026118 Bacteria 9472
290 Ga0207683_10000233 3300026121 Bacteria 49324
291 Ga0207683_10008872 3300026121 Bacteria 8574
292 Ga0207683_10012330 3300026121 Bacteria 7296
293 Ga0207683_10076945 3300026121 Bacteria 2955
294 Ga0207698_10001923 3300026142 Bacteria 12178
295 Ga0207698_10506184 3300026142 Bacteria 1176
296 Ga0207428_10015565 3300027907 Bacteria 6574
297 Ga0207428_10066224 3300027907 Bacteria 2847
298 Ga0268266_10157293 3300028379 Unclassified 2054
299 Ga0268265_10148823 3300028380 Bacteria 1972
300 Ga0268264_10060447 3300028381 Bacteria 3176
301 Ga0265338_10008473 3300028800 Bacteria 12480
302 Ga0373958_0001658 3300034819 Bacteria 3024
303 Ga0373958_0018534 3300034819 Bacteria 1263
304 Ga0373959_0004677 3300034820 Bacteria 2218
305 Ga0373928_0044421 3300035084 Bacteria 1031
306 Ga0373940_0008187 3300035088 Unclassified 2391
307 Ga0373940_0018937 3300035088 Bacteria 1733
308 Ga0373949_0048312 3300035090 Bacteria 1065
309 Ga0373951_0004105 3300035091 Unclassified 3482
310 Ga0373951_0009772 3300035091 Bacteria 2157
311 Ga0373936_0024260 3300035113 Bacteria 2367
312 Ga0373945_0008825 3300035116 Bacteria 3293
313 Ga0373953_0000777 3300035117 Bacteria 8891
314 Ga0373953_0026589 3300035117 Bacteria 2217
315 Ga0373954_0038913 3300035118 Bacteria 2213
316 Ga0373957_0013591 3300035120 Bacteria 2765
317 Ga0373957_0038873 3300035120 Bacteria 1783
318 Ga0373960_0002476 3300035121 Unclassified 4149
319 Ga0373960_0056558 3300035121 Bacteria 1178
320 Ga0373943_0017817 3300035170 Bacteria 3254
321 Ga0373955_0002816 3300035172 Bacteria 7639
322 Ga0373942_0006147 3300035207 Bacteria 2771
323 Ga0373962_0015998 3300035242 Bacteria 1929
324 Ga0373924_0011477 3300035410 Bacteria 3291
325 Ga0373924_0047762 3300035410 Bacteria 1766
326 Ga0373931_0004648 3300035691 Bacteria 6280
327 Ga0373931_0035288 3300035691 Bacteria 2599
328 Ga0373933_0001900 3300035724 Bacteria 12056
329 Ga0373947_0017280 3300035725 Bacteria 4149
330 Ga0373947_0031720 3300035725 Bacteria 3111
331 Ga0373937_0001005 3300036401 Bacteria 23881
332 Ga0373925_0062321 3300037068 Bacteria 2804
333 Ga0373925_0153906 3300037068 Bacteria 1807
334 Ga0395900_0043005 3300037418 Bacteria 4654
335 Ga0395898_0103289 3300037466 Bacteria 2735
336 Ga0395898_0240017 3300037466 Bacteria 1728
337 Ga0395905_0214206 3300037471 Bacteria 1804
338 Ga0395901_0015805 3300038443 Bacteria 7691
339 Ga0395901_0162097 3300038443 Bacteria 2348
340 Ga0451789_0639453 3300041443 Bacteria 2715
341 Ga0451791_0960907 3300041451 Bacteria 10393
342 Ga0451793_0900112 3300041452 Bacteria 3720
343 Ga0451797_1023860 3300041453 Bacteria 6209
344 Ga0466965_0033011 3300044683 Bacteria 2529
345 Ga0466961_0021444 3300044693 Bacteria 4158
346 Ga0466963_0043876 3300044694 Bacteria 2941
347 Ga0466957_0029059 3300044842 Bacteria 3294
348 Ga0466958_0047848 3300045836 Bacteria 2582
349 Ga0466967_0506246 3300045976 Bacteria 1185
350 Ga0495592_0038658 3300046454 Bacteria 3588
351 Ga0495651_0013064 3300046462 Bacteria 6415
352 Ga0495651_0019437 3300046462 Bacteria 5266
353 Ga0495651_0128968 3300046462 Bacteria 1848
354 Ga0495653_0087463 3300046463 Bacteria 2288
355 Ga0495582_0008661 3300046473 Bacteria 5611
356 Ga0495582_0024802 3300046473 Bacteria 3283
357 Ga0495582_0165134 3300046473 Bacteria 1260
358 Ga0495639_0014337 3300046475 Bacteria 3431
359 Ga0495662_0071235 3300046476 Bacteria 1684
360 Ga0495662_0109227 3300046476 Bacteria 1355
361 Ga0495664_0003004 3300046477 Bacteria 9122
362 Ga0495584_0114623 3300046491 Bacteria 1364
363 Ga0495594_0025152 3300046499 Bacteria 3200
364 Ga0495608_0007565 3300046511 Bacteria 7663
365 Ga0495608_0018867 3300046511 Bacteria 4752
366 Ga0495618_0088472 3300046514 Bacteria 1980
367 Ga0495630_0043778 3300046517 Bacteria 3345
368 Ga0495630_0184347 3300046517 Bacteria 1592
369 Ga0495642_0056777 3300046528 Bacteria 1618
370 Ga0495652_0140982 3300046529 Bacteria 1895
371 Ga0495665_0021322 3300046531 Bacteria 3481
372 Ga0495665_0033342 3300046531 Bacteria 2755
373 Ga0495640_0128490 3300046533 Bacteria 1642
374 Ga0495586_0002153 3300046535 Bacteria 10698
375 Ga0495587_0016515 3300046536 Bacteria 4591
376 Ga0495587_0053240 3300046536 Bacteria 2386
377 Ga0495667_0014009 3300046559 Bacteria 5413
378 Ga0495659_0034729 3300046664 Bacteria 1775
379 Ga0495588_0000478 3300046674 Bacteria 19854
380 Ga0495657_0111717 3300046675 Bacteria 1730
381 Ga0495599_0023465 3300046678 Bacteria 3857
382 Ga0495599_0089799 3300046678 Bacteria 1917
383 Ga0495646_0009646 3300046680 Bacteria 6128
384 Ga0495613_0059004 3300046689 Bacteria 2814
385 Ga0495624_0116319 3300046690 Bacteria 1643
386 Ga0495600_0027075 3300046809 Bacteria 3704
387 Ga0495600_0027356 3300046809 Bacteria 3684
388 Ga0495581_0002430 3300047315 Bacteria 10524
389 Ga0495581_0005512 3300047315 Bacteria 7328
390 Ga0495604_0054993 3300047317 Bacteria 3069
391 Ga0495674_0092576 3300047319 Bacteria 2580
392 Ga0495674_0130723 3300047319 Bacteria 2115
393 Ga0495674_0195566 3300047319 Bacteria 1679
394 Ga0495676_0003437 3300047321 Bacteria 14323
395 Ga0495676_0110498 3300047321 Unclassified 2018
396 Ga0495680_0028588 3300047322 Bacteria 4570
397 Ga0495680_0272020 3300047322 Bacteria 1196
398 Ga0495675_0072272 3300047444 Bacteria 2176
399 Ga0495684_0029876 3300047471 Bacteria 4183
400 Ga0495602_0017080 3300048088 Bacteria 7280
401 Ga0495602_0113298 3300048088 Bacteria 2198
402 Ga0495602_0244077 3300048088 Bacteria 1342
403 Ga0496100_0025912 3300048903 Bacteria 3589
404 Ga0496100_0076021 3300048903 Bacteria 2254
405 Ga0496100_0190829 3300048903 Bacteria 1487
406 Ga0496101_0018383 3300048904 Bacteria 4753
407 Ga0496101_0276168 3300048904 Bacteria 1312
408 Ga0496101_0318460 3300048904 Bacteria 1220
409 Ga0496102_0002291 3300048905 Bacteria 16357
410 Ga0496102_0002755 3300048905 Bacteria 14988
411 Ga0496102_0026844 3300048905 Bacteria 5140
412 Ga0496102_0144849 3300048905 Bacteria 2229
413 Ga0496102_0263206 3300048905 Bacteria 1626
414 Ga0496102_0549608 3300048905 Bacteria 1077
415 Ga0496103_0060956 3300048906 Bacteria 2345
416 Ga0496104_0005242 3300048907 Bacteria 11331
417 Ga0496104_0005403 3300048907 Bacteria 11179
418 Ga0496104_0120535 3300048907 Bacteria 2518
419 Ga0496104_0252405 3300048907 Bacteria 1677
420 Ga0496105_0000303 3300048908 Bacteria 32387
421 Ga0496105_0000691 3300048908 Bacteria 22703
422 Ga0496105_0020327 3300048908 Bacteria 5364
423 Ga0496105_0032088 3300048908 Unclassified 4308
424 Ga0496105_0296292 3300048908 Bacteria 1301
425 Ga0496106_0001744 3300048909 Bacteria 16241
426 Ga0496106_0022275 3300048909 Bacteria 4706
427 Ga0496106_0022279 3300048909 Bacteria 4706
428 Ga0496106_0036839 3300048909 Bacteria 3659
429 Ga0496106_0042617 3300048909 Bacteria 3403
430 Ga0496106_0153819 3300048909 Unclassified 1815
431 Ga0496107_0027959 3300048910 Bacteria 4006
432 Ga0496108_0007872 3300048911 Bacteria 8639
433 Ga0496108_0062199 3300048911 Bacteria 3143
434 Ga0496108_0132802 3300048911 Bacteria 2140
435 Ga0496108_0188605 3300048911 Bacteria 1787
436 Ga0496108_0238875 3300048911 Bacteria 1580
437 Ga0496108_0253674 3300048911 Bacteria 1530
438 Ga0496109_0012118 3300048912 Bacteria 7435
439 Ga0496109_0041415 3300048912 Bacteria 4171
440 Ga0496109_0064917 3300048912 Bacteria 3341
441 Ga0496109_0073923 3300048912 Bacteria 3132
442 Ga0496109_0124632 3300048912 Bacteria 2401
443 Ga0496109_0145911 3300048912 Bacteria 2214
444 Ga0496109_0171543 3300048912 Bacteria 2035
445 Ga0496110_0001017 3300048913 Bacteria 19745
446 Ga0496110_0002598 3300048913 Bacteria 13589
447 Ga0496110_0023314 3300048913 Bacteria 5262
448 Ga0496110_0073192 3300048913 Bacteria 3041
449 Ga0496110_0081305 3300048913 Bacteria 2888
450 Ga0496111_0002974 3300048914 Bacteria 10385
451 Ga0496111_0035806 3300048914 Bacteria 3548
452 Ga0496111_0095411 3300048914 Unclassified 2182
453 Ga0496112_0011025 3300048915 Bacteria 8236
454 Ga0496112_0116436 3300048915 Bacteria 2643
455 Ga0496112_0169407 3300048915 Unclassified 2149
456 Ga0496112_0415111 3300048915 Bacteria 1285
457 Ga0496113_0002887 3300048916 Bacteria 10117
458 Ga0496113_0003329 3300048916 Bacteria 9597
459 Ga0496113_0048098 3300048916 Bacteria 3172
460 Ga0496113_0063574 3300048916 Bacteria 2789
461 Ga0496113_0106004 3300048916 Bacteria 2183
462 Ga0496114_0031046 3300048917 Bacteria 4395
463 Ga0496114_0041092 3300048917 Bacteria 3832
464 Ga0496114_0079406 3300048917 Bacteria 2769
465 Ga0496114_0165570 3300048917 Bacteria 1924
466 Ga0496114_0236652 3300048917 Bacteria 1605
467 Ga0496114_0423348 3300048917 Bacteria 1179
468 Ga0496115_0015549 3300048918 Bacteria 5774
469 Ga0496115_0036630 3300048918 Bacteria 3885
470 Ga0496115_0065925 3300048918 Bacteria 2925
471 Ga0496115_0074729 3300048918 Bacteria 2752
472 Ga0496115_0105993 3300048918 Unclassified 2307
473 Ga0496117_0187400 3300048920 Bacteria 1182
474 Ga0496124_0148877 3300048927 Bacteria 1839
475 Ga0496126_0089671 3300048929 Bacteria 2706
476 Ga0501037_0010222 3300049573 Bacteria 6885
477 Ga0501047_0150096 3300049581 Bacteria 2207
478 Ga0501044_0004902 3300049823 Bacteria 14961
479 nmdc:mga05p37_31016_c1 3300050507 Bacteria 6528
480 nmdc:mga05p37_465583_c1 3300050507 Bacteria 1460
481 nmdc:mga05p37_544489_c1 3300050507 Bacteria 1323
482 nmdc:mga08y16_15125_c1 3300050511 Bacteria 8111
483 nmdc:mga08y16_197831_c1 3300050511 Bacteria 2083
484 nmdc:mga08y16_62551_c1 3300050511 Bacteria 3887
485 nmdc:mga0n895_100073_c1 3300050512 Unclassified 2908
486 nmdc:mga0n895_151474_c1 3300050512 Bacteria 2350
487 nmdc:mga0n895_21092_c1 3300050512 Bacteria 6089
488 nmdc:mga0n895_21500_c1 3300050512 Bacteria 6036
489 nmdc:mga0n895_50021_c1 3300050512 Bacteria 4097
490 nmdc:mga0n895_6028_c1 3300050512 Bacteria 10217
491 nmdc:mga0n895_77203_c1 3300050512 Bacteria 3313
492 nmdc:mga0n895_85539_c1 3300050512 Bacteria 3149
493 nmdc:mga0rr50_175733_c1 3300050513 Bacteria 1748
494 nmdc:mga0rr50_195772_c1 3300050513 Bacteria 1659
495 nmdc:mga0rr50_3209_c1 3300050513 Bacteria 9361
496 nmdc:mga0rr50_4916_c1 3300050513 Bacteria 7910
497 nmdc:mga0rr50_56827_c1 3300050513 Bacteria 2925
498 nmdc:mga08x19_14727_c1 3300050514 Bacteria 4749
499 nmdc:mga08x19_319560_c1 3300050514 Bacteria 1080
500 nmdc:mga08x19_42373_c1 3300050514 Bacteria 2902
501 nmdc:mga08x19_43819_c1 3300050514 Bacteria 2855
502 nmdc:mga08x19_65954_c1 3300050514 Bacteria 2352
503 nmdc:mga08x19_86370_c1 3300050514 Bacteria 2066
504 nmdc:mga08x19_8783_c1 3300050514 Bacteria 6028
505 nmdc:mga0a205_110636_c1 3300050515 Bacteria 2646
506 nmdc:mga0a205_2062_c1 3300050515 Bacteria 17571
507 nmdc:mga0a205_27195_c1 3300050515 Bacteria 5463
508 nmdc:mga0a205_433546_c1 3300050515 Bacteria 1175
509 nmdc:mga0a205_6088_c1 3300050515 Bacteria 10880
510 nmdc:mga0a205_63105_c1 3300050515 Bacteria 3580
511 nmdc:mga0a205_71534_c1 3300050515 Bacteria 3350
512 Ga0495601_0030474 3300053077 Bacteria 3350
513 Ga0495595_0145207 3300053084 Bacteria 1165
514 Ga0495619_0134166 3300053085 Bacteria 1702
515 Ga0500616_0000131 3300053153 Bacteria 131881
516 Ga0466962_0029798 3300061719 Bacteria 2612
517 Ga0530510_0144762 3300061734 Bacteria 1753
518 2644523900 2643221694 Bacteria 4392972
519 2644667997 2643221722 Bacteria 4247614
520 2819664471 2818991458 Bacteria 4794049
521 2839986456 2839986021 Bacteria 3685650
522 2889304846 2889300758 Bacteria 5690814
523 2932431412 2932431166 Bacteria 4215299
524 2939746555 2939743619 Bacteria 5762299
525 8001783148 8001781756 Bacteria 9586736
526 Ga0495631_0089951
527 JGI24746J21847_1013332
528 Ga0055542_1002226
529 Ga0070658_10337454
530 Ga0070676_10063463
531 Ga0068869_100003397
532 Ga0068869_100013908
533 Ga0070680_100141424
534 Ga0070682_100001094
535 Ga0070682_100028610
536 Ga0070682_100090892
537 Ga0068868_100003449
538 Ga0068868_100028224
539 Ga0070660_100102686
540 Ga0070689_100003919
541 Ga0070691_10006262
542 Ga0070661_100010988
543 Ga0070692_10004986
544 Ga0070668_100022513
545 Ga0070675_100010145
546 Ga0070671_100027019
547 Ga0070671_100038191
548 Ga0070674_100159325
549 Ga0070674_100236818
550 Ga0070673_100417907
551 Ga0070688_100059111
552 Ga0070667_100240421
553 Ga0070667_100286313
554 Ga0070709_10005832
555 Ga0070709_10090489
556 Ga0070709_10116840
557 Ga0070709_10124699
558 Ga0070709_10139842
559 Ga0070709_10290191
560 Ga0070714_100103269
561 Ga0070713_100009023
562 Ga0070713_100038394
563 Ga0070713_100183108
564 Ga0070713_100243186
565 Ga0070713_100246749
566 Ga0070710_10032869
567 Ga0070710_10084954
568 Ga0070701_10017482
569 Ga0070711_100029709
570 Ga0070705_100054068
571 Ga0070700_100038133
572 Ga0070700_100053643
573 Ga0070663_100012475
574 Ga0070663_100157329
575 Ga0070678_100035027
576 Ga0070678_100036184
577 Ga0070678_100187899
578 Ga0070662_100015327
579 Ga0070662_100018947
580 Ga0070662_100050120
581 Ga0070662_100220233
582 Ga0070681_10168890
583 Ga0070706_100007331
584 Ga0070706_100017661
585 Ga0070698_100045553
586 Ga0070679_100024526
587 Ga0070684_100008801
588 Ga0068853_100171425
589 Ga0070672_100043241
590 Ga0070672_100133671
591 Ga0070672_100295334
592 Ga0070686_100163658
593 Ga0070695_100018276
594 Ga0070696_100050796
595 Ga0070696_100068899
596 Ga0070693_100001721
597 Ga0070693_100002153
598 Ga0070665_100004127
599 Ga0068855_100038737
600 Ga0070664_100008311
601 Ga0070664_100272635
602 Ga0068857_100016808
603 Ga0068857_100030732
604 Ga0068854_100035683
605 Ga0068856_100005325
606 Ga0068856_100015263
607 Ga0068856_100076238
608 Ga0068856_100119608
609 Ga0068856_100164049
610 Ga0070702_100006782
611 Ga0070702_100070892
612 Ga0070702_100288522
613 Ga0068852_100009655
614 Ga0068852_100070102
615 Ga0068859_100052484
616 Ga0068864_100011626
617 Ga0068864_100053146
618 Ga0068866_10025932
619 Ga0068861_100004792
620 Ga0068861_100039379
621 Ga0068870_10002431
622 Ga0068863_100005938
623 Ga0068863_100123708
624 Ga0068863_100185783
625 Ga0068860_100013652
626 Ga0068860_100174902
627 Ga0081455_10021847
628 Ga0081540_1000176
629 Ga0070717_10022906
630 Ga0070717_10082032
631 Ga0075432_10005688
632 Ga0070715_10026014
633 Ga0070716_100002045
634 Ga0070716_100104780
635 Ga0070712_100018950
636 Ga0070712_100057707
637 Ga0070712_100218087
638 Ga0097621_100066143
639 Ga0097621_100073687
640 Ga0068871_100043751
641 Ga0068871_100064850
642 Ga0068871_100182902
643 Ga0075428_100098626
644 Ga0075431_100236279
645 Ga0075431_100240976
646 Ga0075433_10002153
647 Ga0075433_10014396
648 Ga0075433_10029041
649 Ga0075433_10036600
650 Ga0075433_10055623
651 Ga0075433_10124700
652 Ga0075434_100004744
653 Ga0075434_100009517
654 Ga0075434_100025752
655 Ga0075434_100066405
656 Ga0075434_100069752
657 Ga0075434_100155493
658 Ga0075429_100212274
659 Ga0068865_100049029
660 Ga0068865_100292197
661 Ga0075436_100002226
662 Ga0075436_100023897
663 Ga0075436_100046661
664 Ga0075436_100069342
665 Ga0075436_100114969
666 Ga0097620_100052479
667 Ga0075435_100002756
668 Ga0075435_100005988
669 Ga0075435_100031221
670 Ga0075435_100042128
671 Ga0075435_100084396
672 Ga0075435_100179214
673 Ga0105251_10042705
674 Ga0111539_10086548
675 Ga0105245_10026740
676 Ga0105247_10022074
677 Ga0105247_10040107
678 Ga0105247_10109405
679 Ga0114129_10005103
680 Ga0114129_10208500
681 Ga0105243_10001801
682 Ga0105241_10176626
683 Ga0105242_10028509
684 Ga0105242_10159058
685 Ga0105237_10138865
686 Ga0105238_10035612
687 Ga0105249_10013038
688 Ga0105249_10087219
689 Ga0105239_10017758
690 Ga0105239_10143207
691 Ga0105246_10000885
692 Ga0105246_10051411
693 Ga0157373_10014822
694 Ga0157370_10072064
695 Ga0157369_10000103
696 Ga0157369_10135239
697 Ga0157374_10038883
698 Ga0157374_10041671
699 Ga0157374_10150846
700 Ga0157374_10191732
701 Ga0157378_10053118
702 Ga0163162_10148099
703 Ga0157372_10016447
704 Ga0157372_10318944
705 Ga0157372_10587350
706 Ga0157375_10021369
707 Ga0157375_10041730
708 Ga0157375_10050053
709 Ga0157375_10186412
710 Ga0157380_10353648
711 Ga0157377_10003289
712 Ga0157377_10007357
713 Ga0157377_10049895
714 Ga0157379_10094347
715 Ga0163161_10024549
716 Ga0206356_10150727
717 Ga0209563_100894
718 Ga0207692_10003277
719 Ga0207692_10010762
720 Ga0207642_10037242
721 Ga0207710_10019403
722 Ga0207710_10085038
723 Ga0207688_10001472
724 Ga0207688_10001800
725 Ga0207647_10081632
726 Ga0207699_10012573
727 Ga0207699_10020509
728 Ga0207699_10046831
729 Ga0207699_10234108
730 Ga0207645_10014649
731 Ga0207645_10070604
732 Ga0207643_10000204
733 Ga0207705_10005372
734 Ga0207684_10049180
735 Ga0207654_10016738
736 Ga0207654_10017206
737 Ga0207707_10011023
738 Ga0207671_10196101
739 Ga0207693_10001820
740 Ga0207693_10041256
741 Ga0207693_10052562
742 Ga0207693_10211200
743 Ga0207663_10008161
744 Ga0207663_10037872
745 Ga0207663_10142240
746 Ga0207660_10008053
747 Ga0207662_10211007
748 Ga0207657_10012821
749 Ga0207657_10041137
750 Ga0207649_10009766
751 Ga0207649_10316072
752 Ga0207652_10056481
753 Ga0207681_10449771
754 Ga0207650_10000859
755 Ga0207659_10033159
756 Ga0207687_10009882
757 Ga0207687_10042937
758 Ga0207700_10018988
759 Ga0207700_10039715
760 Ga0207700_10082395
761 Ga0207700_10347344
762 Ga0207700_10382144
763 Ga0207664_10016462
764 Ga0207664_10041677
765 Ga0207664_10120907
766 Ga0207644_10004724
767 Ga0207706_10003729
768 Ga0207706_10039546
769 Ga0207706_10201223
770 Ga0207706_10260354
771 Ga0207709_10230319
772 Ga0207709_10265670
773 Ga0207670_10010858
774 Ga0207670_10045292
775 Ga0207665_10000295
776 Ga0207665_10006076
777 Ga0207665_10029331
778 Ga0207665_10038134
779 Ga0207665_10209010
780 Ga0207691_10073026
781 Ga0207691_10098217
782 Ga0207711_10230084
783 Ga0207689_10000223
784 Ga0207689_10104347
785 Ga0207661_10015234
786 Ga0207661_10052648
787 Ga0207679_10012813
788 Ga0207667_10157966
789 Ga0207651_10028765
790 Ga0207668_10030902
791 Ga0207668_10037265
792 Ga0207677_10013206
793 Ga0207703_10052954
794 Ga0207639_10065129
795 Ga0207639_10148605
796 Ga0207678_10000183
797 Ga0207678_10009936
798 Ga0207678_10012330
799 Ga0207678_10148080
800 Ga0207678_10185852
801 Ga0207708_10017766
802 Ga0207708_10018111
803 Ga0207708_10020050
804 Ga0207708_10081179
805 Ga0207702_10003008
806 Ga0207702_10154039
807 Ga0207702_10171771
808 Ga0207641_10005837
809 Ga0207676_10001332
810 Ga0207676_10319611
811 Ga0207674_10138300
812 Ga0207674_10155849
813 Ga0207675_100008017
814 Ga0207675_100008806
815 Ga0207683_10000233
816 Ga0207683_10008872
817 Ga0207683_10012330
818 Ga0207683_10076945
819 Ga0207698_10001923
820 Ga0207698_10506184
821 Ga0207428_10015565
822 Ga0207428_10066224
823 Ga0268266_10157293
824 Ga0268265_10148823
825 Ga0268264_10060447
826 Ga0265338_10008473
827 Ga0373958_0001658
828 Ga0373958_0018534
829 Ga0373959_0004677
830 Ga0373928_0044421
831 Ga0373940_0008187
832 Ga0373940_0018937
833 Ga0373949_0048312
834 Ga0373951_0004105
835 Ga0373951_0009772
836 Ga0373936_0024260
837 Ga0373945_0008825
838 Ga0373953_0000777
839 Ga0373953_0026589
840 Ga0373954_0038913
841 Ga0373957_0013591
842 Ga0373957_0038873
843 Ga0373960_0002476
844 Ga0373960_0056558
845 Ga0373943_0017817
846 Ga0373955_0002816
847 Ga0373942_0006147
848 Ga0373962_0015998
849 Ga0373924_0011477
850 Ga0373924_0047762
851 Ga0373931_0004648
852 Ga0373931_0035288
853 Ga0373933_0001900
854 Ga0373947_0017280
855 Ga0373947_0031720
856 Ga0373937_0001005
857 Ga0373925_0062321
858 Ga0373925_0153906
859 Ga0395900_0043005
860 Ga0395898_0103289
861 Ga0395898_0240017
862 Ga0395905_0214206
863 Ga0395901_0015805
864 Ga0395901_0162097
865 Ga0451789_0639453
866 Ga0451791_0960907
867 Ga0451793_0900112
868 Ga0451797_1023860
869 Ga0466965_0033011
870 Ga0466961_0021444
871 Ga0466963_0043876
872 Ga0466957_0029059
873 Ga0466958_0047848
874 Ga0466967_0506246
875 Ga0495592_0038658
876 Ga0495651_0013064
877 Ga0495651_0019437
878 Ga0495651_0128968
879 Ga0495653_0087463
880 Ga0495582_0008661
881 Ga0495582_0024802
882 Ga0495582_0165134
883 Ga0495639_0014337
884 Ga0495662_0071235
885 Ga0495662_0109227
886 Ga0495664_0003004
887 Ga0495584_0114623
888 Ga0495594_0025152
889 Ga0495608_0007565
890 Ga0495608_0018867
891 Ga0495618_0088472
892 Ga0495630_0043778
893 Ga0495630_0184347
894 Ga0495642_0056777
895 Ga0495652_0140982
896 Ga0495665_0021322
897 Ga0495665_0033342
898 Ga0495640_0128490
899 Ga0495586_0002153
900 Ga0495587_0016515
901 Ga0495587_0053240
902 Ga0495667_0014009
903 Ga0495659_0034729
904 Ga0495588_0000478
905 Ga0495657_0111717
906 Ga0495599_0023465
907 Ga0495599_0089799
908 Ga0495646_0009646
909 Ga0495613_0059004
910 Ga0495624_0116319
911 Ga0495600_0027075
912 Ga0495600_0027356
913 Ga0495581_0002430
914 Ga0495581_0005512
915 Ga0495604_0054993
916 Ga0495674_0092576
917 Ga0495674_0130723
918 Ga0495674_0195566
919 Ga0495676_0003437
920 Ga0495676_0110498
921 Ga0495680_0028588
922 Ga0495680_0272020
923 Ga0495675_0072272
924 Ga0495684_0029876
925 Ga0495602_0017080
926 Ga0495602_0113298
927 Ga0495602_0244077
928 Ga0496100_0025912
929 Ga0496100_0076021
930 Ga0496100_0190829
931 Ga0496101_0018383
932 Ga0496101_0276168
933 Ga0496101_0318460
934 Ga0496102_0002291
935 Ga0496102_0002755
936 Ga0496102_0026844
937 Ga0496102_0144849
938 Ga0496102_0263206
939 Ga0496102_0549608
940 Ga0496103_0060956
941 Ga0496104_0005242
942 Ga0496104_0005403
943 Ga0496104_0120535
944 Ga0496104_0252405
945 Ga0496105_0000303
946 Ga0496105_0000691
947 Ga0496105_0020327
948 Ga0496105_0032088
949 Ga0496105_0296292
950 Ga0496106_0001744
951 Ga0496106_0022275
952 Ga0496106_0022279
953 Ga0496106_0036839
954 Ga0496106_0042617
955 Ga0496106_0153819
956 Ga0496107_0027959
957 Ga0496108_0007872
958 Ga0496108_0062199
959 Ga0496108_0132802
960 Ga0496108_0188605
961 Ga0496108_0238875
962 Ga0496108_0253674
963 Ga0496109_0012118
964 Ga0496109_0041415
965 Ga0496109_0064917
966 Ga0496109_0073923
967 Ga0496109_0124632
968 Ga0496109_0145911
969 Ga0496109_0171543
970 Ga0496110_0001017
971 Ga0496110_0002598
972 Ga0496110_0023314
973 Ga0496110_0073192
974 Ga0496110_0081305
975 Ga0496111_0002974
976 Ga0496111_0035806
977 Ga0496111_0095411
978 Ga0496112_0011025
979 Ga0496112_0116436
980 Ga0496112_0169407
981 Ga0496112_0415111
982 Ga0496113_0002887
983 Ga0496113_0003329
984 Ga0496113_0048098
985 Ga0496113_0063574
986 Ga0496113_0106004
987 Ga0496114_0031046
988 Ga0496114_0041092
989 Ga0496114_0079406
990 Ga0496114_0165570
991 Ga0496114_0236652
992 Ga0496114_0423348
993 Ga0496115_0015549
994 Ga0496115_0036630
995 Ga0496115_0065925
996 Ga0496115_0074729
997 Ga0496115_0105993
998 Ga0496117_0187400
999 Ga0496124_0148877
1000 Ga0496126_0089671
1001 Ga0501037_0010222
1002 Ga0501047_0150096
1003 Ga0501044_0004902
1004 nmdc:mga05p37_31016_c1
1005 nmdc:mga05p37_465583_c1
1006 nmdc:mga05p37_544489_c1
1007 nmdc:mga08y16_15125_c1
1008 nmdc:mga08y16_197831_c1
1009 nmdc:mga08y16_62551_c1
1010 nmdc:mga0n895_100073_c1
1011 nmdc:mga0n895_151474_c1
1012 nmdc:mga0n895_21092_c1
1013 nmdc:mga0n895_21500_c1
1014 nmdc:mga0n895_50021_c1
1015 nmdc:mga0n895_6028_c1
1016 nmdc:mga0n895_77203_c1
1017 nmdc:mga0n895_85539_c1
1018 nmdc:mga0rr50_175733_c1
1019 nmdc:mga0rr50_195772_c1
1020 nmdc:mga0rr50_3209_c1
1021 nmdc:mga0rr50_4916_c1
1022 nmdc:mga0rr50_56827_c1
1023 nmdc:mga08x19_14727_c1
1024 nmdc:mga08x19_319560_c1
1025 nmdc:mga08x19_42373_c1
1026 nmdc:mga08x19_43819_c1
1027 nmdc:mga08x19_65954_c1
1028 nmdc:mga08x19_86370_c1
1029 nmdc:mga08x19_8783_c1
1030 nmdc:mga0a205_110636_c1
1031 nmdc:mga0a205_2062_c1
1032 nmdc:mga0a205_27195_c1
1033 nmdc:mga0a205_433546_c1
1034 nmdc:mga0a205_6088_c1
1035 nmdc:mga0a205_63105_c1
1036 nmdc:mga0a205_71534_c1
1037 Ga0495601_0030474
1038 Ga0495595_0145207
1039 Ga0495619_0134166
1040 Ga0500616_0000131
1041 Ga0466962_0029798
1042 Ga0530510_0144762
1043 2644523900
1044 2644667997
1045 2819664471
1046 2839986456
1047 2889304846
1048 2932431412
1049 2939746555
1050 8001783148

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01545

Cation_efflux

Cation efflux family

45

244

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6h5u-assembly2.cif.gz_B mamm ctd h264e - zinc form 2 0.787 251 332
6h9p-assembly2.cif.gz_B mamm ctd e289d - manganese form 0.7868 251 325
3w8p-assembly1.cif.gz_B mamm-ctd d249a&h28a mutant 0.7824 250 327
6h8d-assembly1.cif.gz_A-2 mamm ctd d249n - nickel form 0.7813 249 327
6h9p-assembly1.cif.gz_A mamm ctd e289d - manganese form 0.776 251 327
ID Description Score Start End Superfamily
af_Q3V5J4_162_375_1.20.1510.10 Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain 0.9511 30 241 1.20.1510.10
af_D3ZWW5_236_448_1.20.1510.10 Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain 0.9488 32 240 1.20.1510.10
af_Q3V5J4_162_375_1.20.1510.10 Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain 0.9382 30 241 1.20.1510.10
af_D3ZWW5_236_448_1.20.1510.10 Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain 0.9273 32 240 1.20.1510.10
af_Q9SI03_23_218_1.20.1510.10 Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain 0.8883 30 243 1.20.1510.10
ID Description Score Start End GO Terms
AF-A0A3B9XM73-F1-model_v4 Cation efflux family transporter 0.9547 26 219 GO:0006829
GO:0008324
GO:0016020
AF-X0WCQ7-F1-model_v4 Cation efflux protein cytoplasmic domain-containing protein 0.9543 28 228 GO:0006829
GO:0008324
GO:0016020
AF-A0A4Q7M6M5-F1-model_v4 Cation diffusion facilitator family transporter 0.95 1 332 GO:0006829
GO:0008324
GO:0016020
AF-A0A4Q7JBG6-F1-model_v4 Cation transporter 0.949 32 329 GO:0006829
GO:0008324
GO:0016020
AF-A0A7R8PDF5-F1-model_v4 deleted 0.9447 1 331

Map