F459280

General Info

Members Datasets Scaffolds Average Seq Length
525 179 1050 112

Family's Representative Sequence

Representative Sequence 3300026035|Ga0207703_10000564|Ga0207703_100005643
Length 109
Sequence MRLTYAIKYVADMERAVAFHRDTLGLTLSFQSREFATGETRLALHAASDENPAGTVQLGFGCDDLAALYAARAINGLDFTMPPKREHGVLLARFRDGDGAECSISEGRG

Samples

Sample ID Description Type Environment
1 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
138 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
139 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
142 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
143 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
144 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
145 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
146 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
147 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
148 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
149 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
150 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
157 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
158 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
159 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
162 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
163 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
176 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
177 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
178 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
179 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.14
Nodule 0
Rhizoplane 3.43
Rhizosphere 95.24
Stem 0
Stem Tuber 0
Unclassified 13.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207703_10000564 3300026035 Bacteria 38136
2 JGI24740J21852_10004133 3300001979 Bacteria 6271
3 JGI24740J21852_10027543 3300001979 Bacteria 1890
4 JGI24740J21852_10056775 3300001979 Bacteria 1096
5 JGI24740J21852_10066039 3300001979 Bacteria 983
6 JGI24739J22299_10003250 3300001989 Bacteria 6198
7 JGI24739J22299_10010314 3300001989 Bacteria 3469
8 JGI24737J22298_10001034 3300001990 Bacteria 9851
9 JGI24737J22298_10005752 3300001990 Bacteria 4269
10 JGI24735J21928_10001276 3300002067 Bacteria 8942
11 JGI24735J21928_10172883 3300002067 Bacteria 625
12 JGI24738J21930_10002408 3300002075 Bacteria 4901
13 JGI25165J46597_1000053 3300003214 Bacteria 235857
14 Ga0070658_10002369 3300005327 Bacteria 15811
15 Ga0070658_10023629 3300005327 Bacteria 4931
16 Ga0070658_10033623 3300005327 Bacteria 4126
17 Ga0070658_10051691 3300005327 Bacteria 3330
18 Ga0070658_10605860 3300005327 Bacteria 949
19 Ga0070658_10756969 3300005327 Unclassified 843
20 Ga0070658_11259835 3300005327 Bacteria 642
21 Ga0070658_11681294 3300005327 Bacteria 549
22 Ga0070676_10293328 3300005328 Bacteria 1100
23 Ga0070683_100002263 3300005329 Bacteria 15247
24 Ga0070683_100019489 3300005329 Bacteria 6026
25 Ga0070683_100142061 3300005329 Unclassified 2274
26 Ga0070683_100203041 3300005329 Bacteria 1882
27 Ga0070690_100190473 3300005330 Bacteria 1422
28 Ga0070670_100024519 3300005331 Bacteria 5187
29 Ga0070670_100690884 3300005331 Bacteria 917
30 Ga0070670_101424279 3300005331 Unclassified 635
31 Ga0070670_101940680 3300005331 Bacteria 542
32 Ga0068869_100215677 3300005334 Bacteria 1519
33 Ga0070666_10001518 3300005335 Bacteria 14090
34 Ga0070666_10114952 3300005335 Bacteria 1863
35 Ga0070666_10380166 3300005335 Bacteria 1013
36 Ga0070680_100106503 3300005336 Unclassified 2331
37 Ga0070680_100218220 3300005336 Bacteria 1609
38 Ga0070680_100588454 3300005336 Bacteria 955
39 Ga0070682_100006410 3300005337 Bacteria 6610
40 Ga0070682_100016614 3300005337 Bacteria 4283
41 Ga0070682_100621149 3300005337 Bacteria 856
42 Ga0070682_100750412 3300005337 Bacteria 788
43 Ga0070682_100933104 3300005337 Unclassified 716
44 Ga0070660_100022106 3300005339 Bacteria 4699
45 Ga0070660_100023131 3300005339 Bacteria 4602
46 Ga0070660_100063493 3300005339 Bacteria 2871
47 Ga0070660_100069406 3300005339 Bacteria 2748
48 Ga0070660_100100574 3300005339 Bacteria 2290
49 Ga0070660_100251745 3300005339 Bacteria 1441
50 Ga0070660_100282874 3300005339 Bacteria 1357
51 Ga0070660_100669273 3300005339 Unclassified 870
52 Ga0070660_100924063 3300005339 Bacteria 736
53 Ga0070689_101013991 3300005340 Bacteria 739
54 Ga0070691_10741480 3300005341 Bacteria 593
55 Ga0070661_100001131 3300005344 Bacteria 18746
56 Ga0070661_100022986 3300005344 Bacteria 4466
57 Ga0070661_100032607 3300005344 Bacteria 3770
58 Ga0070661_100049425 3300005344 Bacteria 3078
59 Ga0070661_100056366 3300005344 Bacteria 2879
60 Ga0070661_100092840 3300005344 Bacteria 2237
61 Ga0070661_100211593 3300005344 Bacteria 1484
62 Ga0070661_100433505 3300005344 Bacteria 1043
63 Ga0070661_100458775 3300005344 Unclassified 1015
64 Ga0070661_101092062 3300005344 Bacteria 664
65 Ga0070692_10014718 3300005345 Bacteria 3683
66 Ga0070692_10208937 3300005345 Bacteria 1147
67 Ga0070668_100447981 3300005347 Bacteria 1109
68 Ga0070669_100840354 3300005353 Bacteria 782
69 Ga0070675_100129418 3300005354 Bacteria 2150
70 Ga0070671_100013403 3300005355 Bacteria 6609
71 Ga0070671_100026647 3300005355 Bacteria 4753
72 Ga0070671_100421849 3300005355 Bacteria 1143
73 Ga0070659_100000165 3300005366 Bacteria 51041
74 Ga0070659_100023598 3300005366 Bacteria 4709
75 Ga0070659_100026595 3300005366 Bacteria 4453
76 Ga0070659_100026993 3300005366 Bacteria 4422
77 Ga0070659_100048391 3300005366 Unclassified 3340
78 Ga0070659_100069697 3300005366 Bacteria 2792
79 Ga0070659_101353045 3300005366 Bacteria 632
80 Ga0070667_100012545 3300005367 Bacteria 7008
81 Ga0070667_100012796 3300005367 Bacteria 6933
82 Ga0070667_100022324 3300005367 Bacteria 5249
83 Ga0070667_100200072 3300005367 Bacteria 1772
84 Ga0070667_100906997 3300005367 Bacteria 820
85 Ga0070713_100629015 3300005436 Bacteria 1021
86 Ga0070701_10664355 3300005438 Unclassified 697
87 Ga0070663_100010927 3300005455 Bacteria 5674
88 Ga0070663_100014761 3300005455 Bacteria 5022
89 Ga0070663_100017691 3300005455 Bacteria 4657
90 Ga0070663_100035865 3300005455 Bacteria 3443
91 Ga0070663_100067151 3300005455 Bacteria 2600
92 Ga0070678_100245181 3300005456 Bacteria 1500
93 Ga0070662_100000171 3300005457 Bacteria 37981
94 Ga0070662_100019996 3300005457 Bacteria 4556
95 Ga0070662_100071143 3300005457 Bacteria 2564
96 Ga0070662_100513459 3300005457 Unclassified 1000
97 Ga0070662_100674267 3300005457 Unclassified 873
98 Ga0070681_10022802 3300005458 Bacteria 6292
99 Ga0070681_10041004 3300005458 Bacteria 4639
100 Ga0070681_10172232 3300005458 Bacteria 2087
101 Ga0070681_11014348 3300005458 Bacteria 750
102 Ga0070681_11041359 3300005458 Bacteria 739
103 Ga0068867_100452046 3300005459 Bacteria 1095
104 Ga0070679_100028135 3300005530 Bacteria 5539
105 Ga0070679_100137829 3300005530 Bacteria 2421
106 Ga0070679_100164620 3300005530 Bacteria 2192
107 Ga0070679_100168790 3300005530 Unclassified 2161
108 Ga0070679_101243436 3300005530 Bacteria 690
109 Ga0070684_100051030 3300005535 Bacteria 3594
110 Ga0070684_100056440 3300005535 Bacteria 3427
111 Ga0070684_100134185 3300005535 Bacteria 2235
112 Ga0068853_100009057 3300005539 Bacteria 8015
113 Ga0068853_100035333 3300005539 Bacteria 4245
114 Ga0068853_100082244 3300005539 Bacteria 2820
115 Ga0068853_100397714 3300005539 Bacteria 1289
116 Ga0068853_100638659 3300005539 Bacteria 1013
117 Ga0068853_101203410 3300005539 Bacteria 731
118 Ga0068853_101616183 3300005539 Bacteria 628
119 Ga0068853_101922452 3300005539 Bacteria 574
120 Ga0070672_100277271 3300005543 Unclassified 1417
121 Ga0070672_100550304 3300005543 Bacteria 1002
122 Ga0070672_100875948 3300005543 Unclassified 792
123 Ga0070672_101586343 3300005543 Unclassified 587
124 Ga0070686_101012638 3300005544 Bacteria 682
125 Ga0070696_100075946 3300005546 Unclassified 2371
126 Ga0070693_100000563 3300005547 Bacteria 16421
127 Ga0070693_100025664 3300005547 Bacteria 3173
128 Ga0070693_100627984 3300005547 Bacteria 779
129 Ga0070693_101052650 3300005547 Unclassified 618
130 Ga0070665_100008159 3300005548 Bacteria 10602
131 Ga0070665_100191073 3300005548 Bacteria 2048
132 Ga0070665_101053272 3300005548 Unclassified 825
133 Ga0070704_100510075 3300005549 Bacteria 1045
134 Ga0068855_100000447 3300005563 Bacteria 51000
135 Ga0068855_100008283 3300005563 Bacteria 12566
136 Ga0068855_100040664 3300005563 Bacteria 5517
137 Ga0068855_100173644 3300005563 Bacteria 2440
138 Ga0068855_100522509 3300005563 Bacteria 1288
139 Ga0068855_100972685 3300005563 Bacteria 893
140 Ga0068855_101430764 3300005563 Bacteria 712
141 Ga0070664_100000311 3300005564 Bacteria 35468
142 Ga0070664_100006564 3300005564 Bacteria 9383
143 Ga0070664_100018152 3300005564 Bacteria 5774
144 Ga0070664_100022170 3300005564 Bacteria 5239
145 Ga0070664_100037090 3300005564 Bacteria 4096
146 Ga0070664_100077435 3300005564 Bacteria 2859
147 Ga0070664_100850837 3300005564 Unclassified 854
148 Ga0068857_100011483 3300005577 Bacteria 7704
149 Ga0068857_100115455 3300005577 Bacteria 2415
150 Ga0068857_100222757 3300005577 Unclassified 1723
151 Ga0068857_100345321 3300005577 Bacteria 1377
152 Ga0068854_100008604 3300005578 Bacteria 6570
153 Ga0068854_100025363 3300005578 Bacteria 4067
154 Ga0068854_100394549 3300005578 Bacteria 1143
155 Ga0068854_100492891 3300005578 Bacteria 1030
156 Ga0068854_100727156 3300005578 Bacteria 859
157 Ga0068854_100729127 3300005578 Bacteria 858
158 Ga0068856_100000979 3300005614 Bacteria 30480
159 Ga0068856_100012320 3300005614 Bacteria 8280
160 Ga0068856_100079352 3300005614 Bacteria 3254
161 Ga0068856_100278271 3300005614 Bacteria 1690
162 Ga0068856_100286792 3300005614 Bacteria 1663
163 Ga0068856_100360887 3300005614 Bacteria 1472
164 Ga0068856_100612192 3300005614 Bacteria 1110
165 Ga0068856_100912979 3300005614 Bacteria 897
166 Ga0068856_101903758 3300005614 Bacteria 606
167 Ga0068856_102243960 3300005614 Unclassified 554
168 Ga0068856_102340507 3300005614 Bacteria 542
169 Ga0068852_100000844 3300005616 Bacteria 20329
170 Ga0068852_100001639 3300005616 Bacteria 15286
171 Ga0068852_100003556 3300005616 Bacteria 10908
172 Ga0068852_100284729 3300005616 Bacteria 1594
173 Ga0068852_100419189 3300005616 Bacteria 1320
174 Ga0068859_102475128 3300005617 Bacteria 572
175 Ga0068864_100012904 3300005618 Bacteria 6913
176 Ga0068864_100158060 3300005618 Bacteria 2059
177 Ga0068861_100349074 3300005719 Bacteria 1297
178 Ga0068851_10007579 3300005834 Bacteria 4989
179 Ga0068851_10016424 3300005834 Bacteria 3542
180 Ga0068851_10195006 3300005834 Unclassified 1128
181 Ga0068863_100638390 3300005841 Bacteria 1055
182 Ga0068863_101010219 3300005841 Bacteria 835
183 Ga0068858_100002601 3300005842 Bacteria 18179
184 Ga0068858_100036921 3300005842 Bacteria 4530
185 Ga0068858_100102439 3300005842 Bacteria 2670
186 Ga0068862_100473764 3300005844 Bacteria 1184
187 Ga0070712_100025716 3300006175 Bacteria 3915
188 Ga0070712_100164688 3300006175 Bacteria 1715
189 Ga0097621_100354341 3300006237 Bacteria 1306
190 Ga0097621_100989024 3300006237 Bacteria 786
191 Ga0068871_100091494 3300006358 Bacteria 2535
192 Ga0068871_100518164 3300006358 Unclassified 1076
193 Ga0068871_102279936 3300006358 Unclassified 516
194 Ga0068865_100753657 3300006881 Bacteria 836
195 Ga0068865_101297876 3300006881 Unclassified 647
196 Ga0097620_102475497 3300006931 Bacteria 572
197 Ga0105251_10049648 3300009011 Bacteria 2007
198 Ga0105240_10214856 3300009093 Unclassified 2244
199 Ga0105245_10004049 3300009098 Bacteria 13025
200 Ga0105243_10212659 3300009148 Bacteria 1704
201 Ga0105241_10097624 3300009174 Bacteria 2330
202 Ga0105241_11096442 3300009174 Unclassified 749
203 Ga0105241_11357910 3300009174 Bacteria 679
204 Ga0105242_10136735 3300009176 Bacteria 2122
205 Ga0105248_10000117 3300009177 Bacteria 90169
206 Ga0105248_10345618 3300009177 Bacteria 1675
207 Ga0105237_10081152 3300009545 Bacteria 3233
208 Ga0105237_10645703 3300009545 Bacteria 1065
209 Ga0105238_10058937 3300009551 Bacteria 3848
210 Ga0105238_10166857 3300009551 Unclassified 2177
211 Ga0105238_10661778 3300009551 Bacteria 1055
212 Ga0105238_10772258 3300009551 Bacteria 976
213 Ga0105249_11282880 3300009553 Bacteria 804
214 Ga0157373_10002817 3300013100 Bacteria 13149
215 Ga0157373_10041216 3300013100 Bacteria 3303
216 Ga0157373_10108758 3300013100 Bacteria 1949
217 Ga0157373_10168132 3300013100 Bacteria 1543
218 Ga0157373_10239810 3300013100 Bacteria 1281
219 Ga0157373_10441801 3300013100 Bacteria 935
220 Ga0157373_10854685 3300013100 Unclassified 673
221 Ga0157371_10004240 3300013102 Bacteria 12603
222 Ga0157371_10065371 3300013102 Unclassified 2576
223 Ga0157371_10076572 3300013102 Bacteria 2369
224 Ga0157371_10168688 3300013102 Bacteria 1564
225 Ga0157371_10175097 3300013102 Bacteria 1534
226 Ga0157371_10647928 3300013102 Bacteria 788
227 Ga0157370_10120910 3300013104 Bacteria 2445
228 Ga0157370_10128864 3300013104 Bacteria 2361
229 Ga0157370_10131030 3300013104 Bacteria 2339
230 Ga0157370_10146151 3300013104 Bacteria 2202
231 Ga0157370_10670118 3300013104 Bacteria 948
232 Ga0157370_11999429 3300013104 Unclassified 520
233 Ga0157369_10000741 3300013105 Bacteria 42087
234 Ga0157369_10047094 3300013105 Bacteria 4684
235 Ga0157369_10186268 3300013105 Unclassified 2183
236 Ga0157369_11195473 3300013105 Bacteria 776
237 Ga0157369_11812123 3300013105 Bacteria 620
238 Ga0157369_12019806 3300013105 Unclassified 585
239 Ga0157374_10144763 3300013296 Bacteria 2308
240 Ga0157374_10632812 3300013296 Bacteria 1081
241 Ga0157374_11346575 3300013296 Bacteria 736
242 Ga0157378_10127777 3300013297 Bacteria 2350
243 Ga0157378_12332033 3300013297 Bacteria 587
244 Ga0163162_10108190 3300013306 Bacteria 2876
245 Ga0157372_10051443 3300013307 Bacteria 4585
246 Ga0157372_10133595 3300013307 Unclassified 2857
247 Ga0157372_10182874 3300013307 Bacteria 2427
248 Ga0157372_10410694 3300013307 Bacteria 1578
249 Ga0157372_10559319 3300013307 Bacteria 1333
250 Ga0157372_10948129 3300013307 Bacteria 997
251 Ga0157372_11197010 3300013307 Bacteria 878
252 Ga0157372_12393848 3300013307 Bacteria 606
253 Ga0157375_13185458 3300013308 Unclassified 547
254 Ga0163163_10000380 3300014325 Bacteria 42243
255 Ga0163163_11369122 3300014325 Bacteria 769
256 Ga0157380_10085750 3300014326 Bacteria 2586
257 Ga0157380_10089428 3300014326 Bacteria 2537
258 Ga0157380_12574412 3300014326 Bacteria 575
259 Ga0182008_10287924 3300014497 Bacteria 856
260 Ga0157379_10009530 3300014968 Bacteria 8455
261 Ga0157379_10082101 3300014968 Bacteria 2888
262 Ga0163161_10248989 3300017792 Bacteria 1384
263 Ga0206353_11254309 3300020082 Bacteria 1188
264 Ga0209233_1000119 3300025261 Bacteria 235924
265 Ga0207656_10374397 3300025321 Bacteria 713
266 Ga0207680_10019651 3300025903 Bacteria 3617
267 Ga0207680_10135147 3300025903 Bacteria 1629
268 Ga0207680_10166788 3300025903 Bacteria 1480
269 Ga0207647_10040578 3300025904 Bacteria 2930
270 Ga0207647_10170297 3300025904 Bacteria 1268
271 Ga0207647_10338598 3300025904 Bacteria 853
272 Ga0207647_10531013 3300025904 Bacteria 654
273 Ga0207645_10084285 3300025907 Unclassified 2040
274 Ga0207705_10000222 3300025909 Bacteria 56707
275 Ga0207705_10005796 3300025909 Bacteria 9203
276 Ga0207705_10010271 3300025909 Bacteria 6813
277 Ga0207705_10023345 3300025909 Bacteria 4412
278 Ga0207705_10125180 3300025909 Bacteria 1910
279 Ga0207705_10304312 3300025909 Bacteria 1223
280 Ga0207705_10876919 3300025909 Bacteria 695
281 Ga0207705_11486756 3300025909 Bacteria 513
282 Ga0207654_11052248 3300025911 Bacteria 592
283 Ga0207707_10026827 3300025912 Bacteria 5034
284 Ga0207707_10028496 3300025912 Bacteria 4881
285 Ga0207707_10031771 3300025912 Bacteria 4621
286 Ga0207707_10034363 3300025912 Bacteria 4436
287 Ga0207707_10254348 3300025912 Bacteria 1525
288 Ga0207707_10936753 3300025912 Bacteria 714
289 Ga0207695_10043565 3300025913 Bacteria 4782
290 Ga0207671_10629400 3300025914 Bacteria 855
291 Ga0207671_11116755 3300025914 Bacteria 619
292 Ga0207693_10032736 3300025915 Bacteria 4103
293 Ga0207693_11026492 3300025915 Unclassified 629
294 Ga0207660_10001636 3300025917 Bacteria 15026
295 Ga0207660_10013128 3300025917 Bacteria 5425
296 Ga0207660_10102044 3300025917 Bacteria 2144
297 Ga0207660_10129816 3300025917 Bacteria 1917
298 Ga0207660_10210395 3300025917 Bacteria 1523
299 Ga0207657_10000378 3300025919 Bacteria 47118
300 Ga0207657_10004476 3300025919 Bacteria 14778
301 Ga0207657_10004813 3300025919 Bacteria 14228
302 Ga0207657_10033688 3300025919 Bacteria 4614
303 Ga0207657_10048342 3300025919 Bacteria 3715
304 Ga0207657_10049238 3300025919 Bacteria 3674
305 Ga0207657_10166208 3300025919 Bacteria 1789
306 Ga0207657_10333710 3300025919 Bacteria 1197
307 Ga0207657_10553195 3300025919 Bacteria 900
308 Ga0207657_10830482 3300025919 Unclassified 713
309 Ga0207649_10000862 3300025920 Bacteria 19306
310 Ga0207649_10011038 3300025920 Bacteria 4971
311 Ga0207649_10023280 3300025920 Bacteria 3585
312 Ga0207649_10076067 3300025920 Bacteria 2159
313 Ga0207649_10108570 3300025920 Bacteria 1850
314 Ga0207649_10347272 3300025920 Bacteria 1097
315 Ga0207652_10021417 3300025921 Bacteria 5335
316 Ga0207652_10150077 3300025921 Bacteria 2087
317 Ga0207652_10186410 3300025921 Unclassified 1866
318 Ga0207652_10482579 3300025921 Bacteria 1116
319 Ga0207652_10738634 3300025921 Bacteria 877
320 Ga0207652_10748736 3300025921 Bacteria 870
321 Ga0207652_11053150 3300025921 Bacteria 713
322 Ga0207652_11306498 3300025921 Bacteria 628
323 Ga0207681_10162473 3300025923 Bacteria 1685
324 Ga0207694_10680975 3300025924 Bacteria 867
325 Ga0207650_10085888 3300025925 Bacteria 2394
326 Ga0207650_10466783 3300025925 Bacteria 1052
327 Ga0207650_10651286 3300025925 Unclassified 888
328 Ga0207650_11699181 3300025925 Unclassified 535
329 Ga0207687_10004338 3300025927 Bacteria 9468
330 Ga0207664_10022705 3300025929 Bacteria 4690
331 Ga0207664_10212049 3300025929 Bacteria 1676
332 Ga0207644_10047529 3300025931 Bacteria 3063
333 Ga0207690_10000509 3300025932 Bacteria 25193
334 Ga0207690_10004603 3300025932 Bacteria 8155
335 Ga0207690_10011990 3300025932 Bacteria 5183
336 Ga0207690_10042672 3300025932 Bacteria 2981
337 Ga0207690_10060512 3300025932 Bacteria 2570
338 Ga0207690_10072181 3300025932 Bacteria 2383
339 Ga0207690_10087259 3300025932 Bacteria 2195
340 Ga0207690_10124815 3300025932 Bacteria 1875
341 Ga0207690_10172962 3300025932 Bacteria 1620
342 Ga0207690_10290964 3300025932 Bacteria 1275
343 Ga0207690_10620149 3300025932 Bacteria 884
344 Ga0207706_10000513 3300025933 Bacteria 41181
345 Ga0207706_10001823 3300025933 Bacteria 20928
346 Ga0207706_10013832 3300025933 Bacteria 7321
347 Ga0207706_10050152 3300025933 Unclassified 3689
348 Ga0207706_10499079 3300025933 Unclassified 1050
349 Ga0207686_10127520 3300025934 Bacteria 1741
350 Ga0207709_10033117 3300025935 Bacteria 3031
351 Ga0207709_11216935 3300025935 Bacteria 621
352 Ga0207704_11046341 3300025938 Bacteria 692
353 Ga0207691_10316573 3300025940 Bacteria 1338
354 Ga0207691_11073981 3300025940 Unclassified 670
355 Ga0207711_10000558 3300025941 Bacteria 37953
356 Ga0207711_10984734 3300025941 Bacteria 782
357 Ga0207689_10397985 3300025942 Bacteria 1148
358 Ga0207661_10096945 3300025944 Bacteria 2468
359 Ga0207661_10150172 3300025944 Bacteria 2013
360 Ga0207661_10261851 3300025944 Bacteria 1541
361 Ga0207661_10356570 3300025944 Bacteria 1320
362 Ga0207661_10524328 3300025944 Bacteria 1084
363 Ga0207661_11430463 3300025944 Bacteria 634
364 Ga0207661_11514145 3300025944 Bacteria 615
365 Ga0207679_10000460 3300025945 Bacteria 28726
366 Ga0207679_10025256 3300025945 Bacteria 4083
367 Ga0207679_10033904 3300025945 Bacteria 3597
368 Ga0207679_10101328 3300025945 Bacteria 2252
369 Ga0207679_10186795 3300025945 Bacteria 1719
370 Ga0207679_10243336 3300025945 Bacteria 1525
371 Ga0207679_10422964 3300025945 Bacteria 1176
372 Ga0207667_10003620 3300025949 Bacteria 19067
373 Ga0207667_10107583 3300025949 Unclassified 2877
374 Ga0207667_10153538 3300025949 Bacteria 2369
375 Ga0207667_10216308 3300025949 Bacteria 1963
376 Ga0207667_10332659 3300025949 Bacteria 1551
377 Ga0207667_10688727 3300025949 Bacteria 1025
378 Ga0207667_11125395 3300025949 Bacteria 767
379 Ga0207651_10389744 3300025960 Bacteria 1183
380 Ga0207712_10147731 3300025961 Bacteria 1812
381 Ga0207668_10348177 3300025972 Bacteria 1238
382 Ga0207640_10015528 3300025981 Bacteria 4410
383 Ga0207640_10034261 3300025981 Unclassified 3167
384 Ga0207640_10060317 3300025981 Bacteria 2507
385 Ga0207640_10564884 3300025981 Bacteria 958
386 Ga0207640_11782226 3300025981 Bacteria 556
387 Ga0207658_10052769 3300025986 Bacteria 3001
388 Ga0207658_10081447 3300025986 Bacteria 2482
389 Ga0207658_10193474 3300025986 Bacteria 1693
390 Ga0207658_10368179 3300025986 Unclassified 1256
391 Ga0207658_10806791 3300025986 Bacteria 852
392 Ga0207677_10234279 3300026023 Bacteria 1481
393 Ga0207677_11184692 3300026023 Unclassified 699
394 Ga0207703_10042194 3300026035 Bacteria 3659
395 Ga0207703_10136557 3300026035 Bacteria 2123
396 Ga0207639_10001416 3300026041 Bacteria 16213
397 Ga0207639_10041548 3300026041 Bacteria 3441
398 Ga0207639_10291503 3300026041 Bacteria 1439
399 Ga0207639_12150831 3300026041 Bacteria 519
400 Ga0207678_10000989 3300026067 Bacteria 25886
401 Ga0207678_10001723 3300026067 Bacteria 20030
402 Ga0207678_10002442 3300026067 Bacteria 16892
403 Ga0207678_10005696 3300026067 Bacteria 11123
404 Ga0207678_10007682 3300026067 Bacteria 9524
405 Ga0207702_10001066 3300026078 Bacteria 28071
406 Ga0207702_10005325 3300026078 Bacteria 11284
407 Ga0207702_10019185 3300026078 Bacteria 5657
408 Ga0207702_10135305 3300026078 Unclassified 2223
409 Ga0207702_10230946 3300026078 Bacteria 1729
410 Ga0207702_10249466 3300026078 Bacteria 1666
411 Ga0207702_10269397 3300026078 Bacteria 1606
412 Ga0207641_10077799 3300026088 Bacteria 2871
413 Ga0207641_10841460 3300026088 Bacteria 909
414 Ga0207648_10443328 3300026089 Bacteria 1181
415 Ga0207648_10856909 3300026089 Bacteria 847
416 Ga0207648_11150469 3300026089 Unclassified 728
417 Ga0207676_10072532 3300026095 Bacteria 2768
418 Ga0207676_10095198 3300026095 Bacteria 2455
419 Ga0207674_10000185 3300026116 Bacteria 76519
420 Ga0207674_10009588 3300026116 Bacteria 11045
421 Ga0207674_10010563 3300026116 Bacteria 10449
422 Ga0207674_10027472 3300026116 Bacteria 6019
423 Ga0207674_10461208 3300026116 Bacteria 1228
424 Ga0207674_10478430 3300026116 Bacteria 1204
425 Ga0207674_10572497 3300026116 Bacteria 1091
426 Ga0207683_10828758 3300026121 Bacteria 859
427 Ga0207698_10000675 3300026142 Bacteria 19796
428 Ga0207698_10004241 3300026142 Bacteria 8724
429 Ga0207698_10038728 3300026142 Bacteria 3525
430 Ga0207698_10087944 3300026142 Bacteria 2532
431 Ga0207698_10505287 3300026142 Bacteria 1177
432 Ga0207698_10710883 3300026142 Bacteria 1001
433 Ga0207698_11686391 3300026142 Bacteria 649
434 Ga0207698_12380004 3300026142 Unclassified 541
435 Ga0268266_10003320 3300028379 Bacteria 16145
436 Ga0268266_10796828 3300028379 Bacteria 912
437 Ga0268265_10616754 3300028380 Bacteria 1039
438 Ga0268264_10970544 3300028381 Bacteria 855
439 Ga0307508_10002906 3300031616 Bacteria 17711
440 Ga0307413_11494439 3300031824 Unclassified 597
441 Ga0307407_11581432 3300031903 Unclassified 520
442 Ga0307415_100559439 3300032126 Bacteria 1011
443 Ga0373930_0023860 3300034816 Bacteria 1219
444 Ga0373958_0026573 3300034819 Unclassified 1109
445 Ga0373928_0148915 3300035084 Unclassified 647
446 Ga0373952_0021970 3300035092 Bacteria 1351
447 Ga0373932_0168119 3300035112 Bacteria 762
448 Ga0373939_0116151 3300035114 Bacteria 938
449 Ga0373941_0072646 3300035115 Bacteria 1145
450 Ga0373960_0005315 3300035121 Bacteria 2977
451 Ga0373962_0312195 3300035242 Bacteria 560
452 Ga0373931_0028613 3300035691 Bacteria 2855
453 Ga0395899_0020913 3300037312 Bacteria 4963
454 Ga0395899_0071051 3300037312 Bacteria 2547
455 Ga0395899_0212780 3300037312 Bacteria 1342
456 Ga0395899_0412418 3300037312 Bacteria 891
457 Ga0395899_0448345 3300037312 Bacteria 845
458 Ga0395900_0038452 3300037418 Bacteria 4931
459 Ga0395900_0044151 3300037418 Bacteria 4593
460 Ga0395900_0160541 3300037418 Bacteria 2293
461 Ga0395900_0224528 3300037418 Bacteria 1891
462 Ga0395900_0293811 3300037418 Bacteria 1613
463 Ga0395900_0355058 3300037418 Unclassified 1439
464 Ga0395900_0685309 3300037418 Bacteria 959
465 Ga0395900_0843149 3300037418 Bacteria 842
466 Ga0395898_0053183 3300037466 Bacteria 3954
467 Ga0395898_0295547 3300037466 Bacteria 1545
468 Ga0395898_0533737 3300037466 Unclassified 1115
469 Ga0395898_1884697 3300037466 Bacteria 518
470 Ga0395905_0005952 3300037471 Bacteria 12352
471 Ga0395905_0007559 3300037471 Bacteria 10797
472 Ga0395905_0011136 3300037471 Bacteria 8698
473 Ga0395905_0012554 3300037471 Bacteria 8149
474 Ga0395905_0059294 3300037471 Bacteria 3578
475 Ga0395905_0200167 3300037471 Bacteria 1872
476 Ga0395905_0239517 3300037471 Bacteria 1696
477 Ga0395905_0647709 3300037471 Bacteria 958
478 Ga0395905_0805369 3300037471 Bacteria 842
479 Ga0395905_1170463 3300037471 Unclassified 672
480 Ga0395901_0014538 3300038443 Bacteria 8002
481 Ga0395901_0029478 3300038443 Bacteria 5651
482 Ga0395901_0294126 3300038443 Bacteria 1684
483 Ga0395901_0336681 3300038443 Unclassified 1559
484 Ga0395901_0433365 3300038443 Bacteria 1346
485 Ga0395901_0510168 3300038443 Bacteria 1223
486 Ga0395901_0577301 3300038443 Unclassified 1136
487 Ga0395901_0859863 3300038443 Bacteria 891
488 Ga0466963_0174976 3300044694 Unclassified 1497
489 Ga0466971_0055446 3300044719 Unclassified 1787
490 Ga0466970_0681405 3300044765 Unclassified 599
491 Ga0466957_0004081 3300044842 Bacteria 8087
492 Ga0466967_0000915 3300045976 Bacteria 15845
493 Ga0466967_0023831 3300045976 Bacteria 5022
494 Ga0466967_0038789 3300045976 Bacteria 4089
495 Ga0466967_0610558 3300045976 Unclassified 1077
496 Ga0466967_0811270 3300045976 Archaea 929
497 Ga0466967_2011327 3300045976 Bacteria 574
498 Ga0495648_0397867 3300046524 Bacteria 616
499 Ga0495622_0403187 3300046557 Unclassified 589
500 Ga0496101_0344996 3300048904 Bacteria 1170
501 Ga0496102_0011038 3300048905 Bacteria 7782
502 Ga0496102_0029006 3300048905 Bacteria 4947
503 Ga0496104_0054571 3300048907 Bacteria 3777
504 Ga0496105_0233453 3300048908 Bacteria 1494
505 Ga0496106_0107053 3300048909 Bacteria 2174
506 Ga0496107_0191098 3300048910 Bacteria 1521
507 Ga0496107_0341218 3300048910 Bacteria 1115
508 Ga0496108_0018980 3300048911 Bacteria 5638
509 Ga0496108_0871152 3300048911 Unclassified 774
510 Ga0496109_0969997 3300048912 Unclassified 788
511 Ga0496110_0001496 3300048913 Bacteria 16949
512 Ga0496110_0112597 3300048913 Bacteria 2447
513 Ga0496111_0014078 3300048914 Bacteria 5455
514 Ga0496111_0766941 3300048914 Bacteria 699
515 Ga0496112_0006100 3300048915 Bacteria 10536
516 Ga0496112_0430651 3300048915 Bacteria 1257
517 Ga0496113_0001623 3300048916 Bacteria 12663
518 Ga0501070_1385994 3300049586 Bacteria 535
519 nmdc:mga0rr50_1419776_c1 3300050513 Unclassified 587
520 Ga0500559_0006898 3300053136 Bacteria 5084
521 Ga0500559_0090908 3300053136 Bacteria 1397
522 Ga0500559_0281866 3300053136 Unclassified 781
523 Ga0500601_018421 3300053737 Unclassified 802
524 Ga0466962_0040621 3300061719 Unclassified 2226
525 Ga0466962_0243662 3300061719 Unclassified 883
526 Ga0207703_10000564
527 JGI24740J21852_10004133
528 JGI24740J21852_10027543
529 JGI24740J21852_10056775
530 JGI24740J21852_10066039
531 JGI24739J22299_10003250
532 JGI24739J22299_10010314
533 JGI24737J22298_10001034
534 JGI24737J22298_10005752
535 JGI24735J21928_10001276
536 JGI24735J21928_10172883
537 JGI24738J21930_10002408
538 JGI25165J46597_1000053
539 Ga0070658_10002369
540 Ga0070658_10023629
541 Ga0070658_10033623
542 Ga0070658_10051691
543 Ga0070658_10605860
544 Ga0070658_10756969
545 Ga0070658_11259835
546 Ga0070658_11681294
547 Ga0070676_10293328
548 Ga0070683_100002263
549 Ga0070683_100019489
550 Ga0070683_100142061
551 Ga0070683_100203041
552 Ga0070690_100190473
553 Ga0070670_100024519
554 Ga0070670_100690884
555 Ga0070670_101424279
556 Ga0070670_101940680
557 Ga0068869_100215677
558 Ga0070666_10001518
559 Ga0070666_10114952
560 Ga0070666_10380166
561 Ga0070680_100106503
562 Ga0070680_100218220
563 Ga0070680_100588454
564 Ga0070682_100006410
565 Ga0070682_100016614
566 Ga0070682_100621149
567 Ga0070682_100750412
568 Ga0070682_100933104
569 Ga0070660_100022106
570 Ga0070660_100023131
571 Ga0070660_100063493
572 Ga0070660_100069406
573 Ga0070660_100100574
574 Ga0070660_100251745
575 Ga0070660_100282874
576 Ga0070660_100669273
577 Ga0070660_100924063
578 Ga0070689_101013991
579 Ga0070691_10741480
580 Ga0070661_100001131
581 Ga0070661_100022986
582 Ga0070661_100032607
583 Ga0070661_100049425
584 Ga0070661_100056366
585 Ga0070661_100092840
586 Ga0070661_100211593
587 Ga0070661_100433505
588 Ga0070661_100458775
589 Ga0070661_101092062
590 Ga0070692_10014718
591 Ga0070692_10208937
592 Ga0070668_100447981
593 Ga0070669_100840354
594 Ga0070675_100129418
595 Ga0070671_100013403
596 Ga0070671_100026647
597 Ga0070671_100421849
598 Ga0070659_100000165
599 Ga0070659_100023598
600 Ga0070659_100026595
601 Ga0070659_100026993
602 Ga0070659_100048391
603 Ga0070659_100069697
604 Ga0070659_101353045
605 Ga0070667_100012545
606 Ga0070667_100012796
607 Ga0070667_100022324
608 Ga0070667_100200072
609 Ga0070667_100906997
610 Ga0070713_100629015
611 Ga0070701_10664355
612 Ga0070663_100010927
613 Ga0070663_100014761
614 Ga0070663_100017691
615 Ga0070663_100035865
616 Ga0070663_100067151
617 Ga0070678_100245181
618 Ga0070662_100000171
619 Ga0070662_100019996
620 Ga0070662_100071143
621 Ga0070662_100513459
622 Ga0070662_100674267
623 Ga0070681_10022802
624 Ga0070681_10041004
625 Ga0070681_10172232
626 Ga0070681_11014348
627 Ga0070681_11041359
628 Ga0068867_100452046
629 Ga0070679_100028135
630 Ga0070679_100137829
631 Ga0070679_100164620
632 Ga0070679_100168790
633 Ga0070679_101243436
634 Ga0070684_100051030
635 Ga0070684_100056440
636 Ga0070684_100134185
637 Ga0068853_100009057
638 Ga0068853_100035333
639 Ga0068853_100082244
640 Ga0068853_100397714
641 Ga0068853_100638659
642 Ga0068853_101203410
643 Ga0068853_101616183
644 Ga0068853_101922452
645 Ga0070672_100277271
646 Ga0070672_100550304
647 Ga0070672_100875948
648 Ga0070672_101586343
649 Ga0070686_101012638
650 Ga0070696_100075946
651 Ga0070693_100000563
652 Ga0070693_100025664
653 Ga0070693_100627984
654 Ga0070693_101052650
655 Ga0070665_100008159
656 Ga0070665_100191073
657 Ga0070665_101053272
658 Ga0070704_100510075
659 Ga0068855_100000447
660 Ga0068855_100008283
661 Ga0068855_100040664
662 Ga0068855_100173644
663 Ga0068855_100522509
664 Ga0068855_100972685
665 Ga0068855_101430764
666 Ga0070664_100000311
667 Ga0070664_100006564
668 Ga0070664_100018152
669 Ga0070664_100022170
670 Ga0070664_100037090
671 Ga0070664_100077435
672 Ga0070664_100850837
673 Ga0068857_100011483
674 Ga0068857_100115455
675 Ga0068857_100222757
676 Ga0068857_100345321
677 Ga0068854_100008604
678 Ga0068854_100025363
679 Ga0068854_100394549
680 Ga0068854_100492891
681 Ga0068854_100727156
682 Ga0068854_100729127
683 Ga0068856_100000979
684 Ga0068856_100012320
685 Ga0068856_100079352
686 Ga0068856_100278271
687 Ga0068856_100286792
688 Ga0068856_100360887
689 Ga0068856_100612192
690 Ga0068856_100912979
691 Ga0068856_101903758
692 Ga0068856_102243960
693 Ga0068856_102340507
694 Ga0068852_100000844
695 Ga0068852_100001639
696 Ga0068852_100003556
697 Ga0068852_100284729
698 Ga0068852_100419189
699 Ga0068859_102475128
700 Ga0068864_100012904
701 Ga0068864_100158060
702 Ga0068861_100349074
703 Ga0068851_10007579
704 Ga0068851_10016424
705 Ga0068851_10195006
706 Ga0068863_100638390
707 Ga0068863_101010219
708 Ga0068858_100002601
709 Ga0068858_100036921
710 Ga0068858_100102439
711 Ga0068862_100473764
712 Ga0070712_100025716
713 Ga0070712_100164688
714 Ga0097621_100354341
715 Ga0097621_100989024
716 Ga0068871_100091494
717 Ga0068871_100518164
718 Ga0068871_102279936
719 Ga0068865_100753657
720 Ga0068865_101297876
721 Ga0097620_102475497
722 Ga0105251_10049648
723 Ga0105240_10214856
724 Ga0105245_10004049
725 Ga0105243_10212659
726 Ga0105241_10097624
727 Ga0105241_11096442
728 Ga0105241_11357910
729 Ga0105242_10136735
730 Ga0105248_10000117
731 Ga0105248_10345618
732 Ga0105237_10081152
733 Ga0105237_10645703
734 Ga0105238_10058937
735 Ga0105238_10166857
736 Ga0105238_10661778
737 Ga0105238_10772258
738 Ga0105249_11282880
739 Ga0157373_10002817
740 Ga0157373_10041216
741 Ga0157373_10108758
742 Ga0157373_10168132
743 Ga0157373_10239810
744 Ga0157373_10441801
745 Ga0157373_10854685
746 Ga0157371_10004240
747 Ga0157371_10065371
748 Ga0157371_10076572
749 Ga0157371_10168688
750 Ga0157371_10175097
751 Ga0157371_10647928
752 Ga0157370_10120910
753 Ga0157370_10128864
754 Ga0157370_10131030
755 Ga0157370_10146151
756 Ga0157370_10670118
757 Ga0157370_11999429
758 Ga0157369_10000741
759 Ga0157369_10047094
760 Ga0157369_10186268
761 Ga0157369_11195473
762 Ga0157369_11812123
763 Ga0157369_12019806
764 Ga0157374_10144763
765 Ga0157374_10632812
766 Ga0157374_11346575
767 Ga0157378_10127777
768 Ga0157378_12332033
769 Ga0163162_10108190
770 Ga0157372_10051443
771 Ga0157372_10133595
772 Ga0157372_10182874
773 Ga0157372_10410694
774 Ga0157372_10559319
775 Ga0157372_10948129
776 Ga0157372_11197010
777 Ga0157372_12393848
778 Ga0157375_13185458
779 Ga0163163_10000380
780 Ga0163163_11369122
781 Ga0157380_10085750
782 Ga0157380_10089428
783 Ga0157380_12574412
784 Ga0182008_10287924
785 Ga0157379_10009530
786 Ga0157379_10082101
787 Ga0163161_10248989
788 Ga0206353_11254309
789 Ga0209233_1000119
790 Ga0207656_10374397
791 Ga0207680_10019651
792 Ga0207680_10135147
793 Ga0207680_10166788
794 Ga0207647_10040578
795 Ga0207647_10170297
796 Ga0207647_10338598
797 Ga0207647_10531013
798 Ga0207645_10084285
799 Ga0207705_10000222
800 Ga0207705_10005796
801 Ga0207705_10010271
802 Ga0207705_10023345
803 Ga0207705_10125180
804 Ga0207705_10304312
805 Ga0207705_10876919
806 Ga0207705_11486756
807 Ga0207654_11052248
808 Ga0207707_10026827
809 Ga0207707_10028496
810 Ga0207707_10031771
811 Ga0207707_10034363
812 Ga0207707_10254348
813 Ga0207707_10936753
814 Ga0207695_10043565
815 Ga0207671_10629400
816 Ga0207671_11116755
817 Ga0207693_10032736
818 Ga0207693_11026492
819 Ga0207660_10001636
820 Ga0207660_10013128
821 Ga0207660_10102044
822 Ga0207660_10129816
823 Ga0207660_10210395
824 Ga0207657_10000378
825 Ga0207657_10004476
826 Ga0207657_10004813
827 Ga0207657_10033688
828 Ga0207657_10048342
829 Ga0207657_10049238
830 Ga0207657_10166208
831 Ga0207657_10333710
832 Ga0207657_10553195
833 Ga0207657_10830482
834 Ga0207649_10000862
835 Ga0207649_10011038
836 Ga0207649_10023280
837 Ga0207649_10076067
838 Ga0207649_10108570
839 Ga0207649_10347272
840 Ga0207652_10021417
841 Ga0207652_10150077
842 Ga0207652_10186410
843 Ga0207652_10482579
844 Ga0207652_10738634
845 Ga0207652_10748736
846 Ga0207652_11053150
847 Ga0207652_11306498
848 Ga0207681_10162473
849 Ga0207694_10680975
850 Ga0207650_10085888
851 Ga0207650_10466783
852 Ga0207650_10651286
853 Ga0207650_11699181
854 Ga0207687_10004338
855 Ga0207664_10022705
856 Ga0207664_10212049
857 Ga0207644_10047529
858 Ga0207690_10000509
859 Ga0207690_10004603
860 Ga0207690_10011990
861 Ga0207690_10042672
862 Ga0207690_10060512
863 Ga0207690_10072181
864 Ga0207690_10087259
865 Ga0207690_10124815
866 Ga0207690_10172962
867 Ga0207690_10290964
868 Ga0207690_10620149
869 Ga0207706_10000513
870 Ga0207706_10001823
871 Ga0207706_10013832
872 Ga0207706_10050152
873 Ga0207706_10499079
874 Ga0207686_10127520
875 Ga0207709_10033117
876 Ga0207709_11216935
877 Ga0207704_11046341
878 Ga0207691_10316573
879 Ga0207691_11073981
880 Ga0207711_10000558
881 Ga0207711_10984734
882 Ga0207689_10397985
883 Ga0207661_10096945
884 Ga0207661_10150172
885 Ga0207661_10261851
886 Ga0207661_10356570
887 Ga0207661_10524328
888 Ga0207661_11430463
889 Ga0207661_11514145
890 Ga0207679_10000460
891 Ga0207679_10025256
892 Ga0207679_10033904
893 Ga0207679_10101328
894 Ga0207679_10186795
895 Ga0207679_10243336
896 Ga0207679_10422964
897 Ga0207667_10003620
898 Ga0207667_10107583
899 Ga0207667_10153538
900 Ga0207667_10216308
901 Ga0207667_10332659
902 Ga0207667_10688727
903 Ga0207667_11125395
904 Ga0207651_10389744
905 Ga0207712_10147731
906 Ga0207668_10348177
907 Ga0207640_10015528
908 Ga0207640_10034261
909 Ga0207640_10060317
910 Ga0207640_10564884
911 Ga0207640_11782226
912 Ga0207658_10052769
913 Ga0207658_10081447
914 Ga0207658_10193474
915 Ga0207658_10368179
916 Ga0207658_10806791
917 Ga0207677_10234279
918 Ga0207677_11184692
919 Ga0207703_10042194
920 Ga0207703_10136557
921 Ga0207639_10001416
922 Ga0207639_10041548
923 Ga0207639_10291503
924 Ga0207639_12150831
925 Ga0207678_10000989
926 Ga0207678_10001723
927 Ga0207678_10002442
928 Ga0207678_10005696
929 Ga0207678_10007682
930 Ga0207702_10001066
931 Ga0207702_10005325
932 Ga0207702_10019185
933 Ga0207702_10135305
934 Ga0207702_10230946
935 Ga0207702_10249466
936 Ga0207702_10269397
937 Ga0207641_10077799
938 Ga0207641_10841460
939 Ga0207648_10443328
940 Ga0207648_10856909
941 Ga0207648_11150469
942 Ga0207676_10072532
943 Ga0207676_10095198
944 Ga0207674_10000185
945 Ga0207674_10009588
946 Ga0207674_10010563
947 Ga0207674_10027472
948 Ga0207674_10461208
949 Ga0207674_10478430
950 Ga0207674_10572497
951 Ga0207683_10828758
952 Ga0207698_10000675
953 Ga0207698_10004241
954 Ga0207698_10038728
955 Ga0207698_10087944
956 Ga0207698_10505287
957 Ga0207698_10710883
958 Ga0207698_11686391
959 Ga0207698_12380004
960 Ga0268266_10003320
961 Ga0268266_10796828
962 Ga0268265_10616754
963 Ga0268264_10970544
964 Ga0307508_10002906
965 Ga0307413_11494439
966 Ga0307407_11581432
967 Ga0307415_100559439
968 Ga0373930_0023860
969 Ga0373958_0026573
970 Ga0373928_0148915
971 Ga0373952_0021970
972 Ga0373932_0168119
973 Ga0373939_0116151
974 Ga0373941_0072646
975 Ga0373960_0005315
976 Ga0373962_0312195
977 Ga0373931_0028613
978 Ga0395899_0020913
979 Ga0395899_0071051
980 Ga0395899_0212780
981 Ga0395899_0412418
982 Ga0395899_0448345
983 Ga0395900_0038452
984 Ga0395900_0044151
985 Ga0395900_0160541
986 Ga0395900_0224528
987 Ga0395900_0293811
988 Ga0395900_0355058
989 Ga0395900_0685309
990 Ga0395900_0843149
991 Ga0395898_0053183
992 Ga0395898_0295547
993 Ga0395898_0533737
994 Ga0395898_1884697
995 Ga0395905_0005952
996 Ga0395905_0007559
997 Ga0395905_0011136
998 Ga0395905_0012554
999 Ga0395905_0059294
1000 Ga0395905_0200167
1001 Ga0395905_0239517
1002 Ga0395905_0647709
1003 Ga0395905_0805369
1004 Ga0395905_1170463
1005 Ga0395901_0014538
1006 Ga0395901_0029478
1007 Ga0395901_0294126
1008 Ga0395901_0336681
1009 Ga0395901_0433365
1010 Ga0395901_0510168
1011 Ga0395901_0577301
1012 Ga0395901_0859863
1013 Ga0466963_0174976
1014 Ga0466971_0055446
1015 Ga0466970_0681405
1016 Ga0466957_0004081
1017 Ga0466967_0000915
1018 Ga0466967_0023831
1019 Ga0466967_0038789
1020 Ga0466967_0610558
1021 Ga0466967_0811270
1022 Ga0466967_2011327
1023 Ga0495648_0397867
1024 Ga0495622_0403187
1025 Ga0496101_0344996
1026 Ga0496102_0011038
1027 Ga0496102_0029006
1028 Ga0496104_0054571
1029 Ga0496105_0233453
1030 Ga0496106_0107053
1031 Ga0496107_0191098
1032 Ga0496107_0341218
1033 Ga0496108_0018980
1034 Ga0496108_0871152
1035 Ga0496109_0969997
1036 Ga0496110_0001496
1037 Ga0496110_0112597
1038 Ga0496111_0014078
1039 Ga0496111_0766941
1040 Ga0496112_0006100
1041 Ga0496112_0430651
1042 Ga0496113_0001623
1043 Ga0501070_1385994
1044 nmdc:mga0rr50_1419776_c1
1045 Ga0500559_0006898
1046 Ga0500559_0090908
1047 Ga0500559_0281866
1048 Ga0500601_018421
1049 Ga0466962_0040621
1050 Ga0466962_0243662

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

2

104

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rmu-assembly2.cif.gz_D crystal structure of human methylmalonyl-coa epimerase, mcee 0.8227 2 109
3rmu-assembly2.cif.gz_D crystal structure of human methylmalonyl-coa epimerase, mcee 0.7964 2 109
3hdp-assembly1.cif.gz_A crystal structure of the ni(ii)-bound glyoxalase-i from clostridium acetobutylicum 0.7846 2 109
3oa4-assembly1.cif.gz_A-2 crystal structure of hypothetical protein bh1468 from bacillus halodurans c-125 0.781 2 111
1kmz-assembly1.cif.gz_A molecular basis of mitomycin c resictance in streptomyces: crystal structures of the mrd protein with and without a drug derivative 0.7767 1 111
ID Description Score Start End Superfamily
3sk1C01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8784 4 48 3.30.720.120
2kjzB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8333 5 49 3.30.720.120
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8121 60 111 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8121 60 107 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7843 60 108 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A2V8STX3-F1-model_v4 VOC domain-containing protein 0.9662 1 91
AF-A0A2V9Y3G2-F1-model_v4 VOC domain-containing protein 0.9651 2 109
AF-A0A0E9MLF2-F1-model_v4 Glyoxalase/fosfomycin resistance/dioxygenase domain-containing protein 0.9519 2 109
AF-A0A521QS08-F1-model_v4 VOC domain-containing protein 0.9408 2 111
AF-A0A2V9Y3G2-F1-model_v4 VOC domain-containing protein 0.9315 2 109

Map