F458994

General Info

Members Datasets Scaffolds Average Seq Length
523 313 1046 293

Family's Representative Sequence

Representative Sequence 3300028379|Ga0268266_10155226|Ga0268266_101552262
Length 362
Sequence VQRLFGDAPQSRDLPHGWTPDQQRTTPRCGALRSIRGTPPTNVVGAFHILTAITPSTPRAFISDAAKRKRARLSVRDEIGRAKTAFVFAGGGSFGAVQVGMLHSLAAHGVAADMVVGSSVGALNGAFYAGDPTLDGVRRLADIWRGLQRHDVFPMDWRTVLSFLWRRDFLIPHDGIRKLIDDHIPYRNLEDAKLPVHIVTTDIISGDSVVLSEGSTAEAIVASTAIPGAFTPIRYRDYYLADGAISSNTPIQVAVQKGAKRLIILPTGHACATQSPPVGAVANALHALTLLIARQLVSELEALGPDIEYFVVPPLCPLVGSPYDFSRTADHIDRAIATTDAWLAQHGLQQGRIPHEMRPHSH

Samples

Sample ID Description Type Environment
1 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
52 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
91 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
147 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
148 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
149 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
153 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
154 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
156 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
157 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
158 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
159 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
160 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
169 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
170 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
171 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
172 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
173 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
174 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
175 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
176 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
177 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
178 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
179 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
180 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
181 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
182 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
183 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
184 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
185 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
186 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
187 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
188 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
189 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
190 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
191 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
192 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
193 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
194 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
195 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
196 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
197 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
198 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
199 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
200 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
201 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
202 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
203 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
204 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
205 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
206 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
207 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
208 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
209 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
210 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
211 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
212 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
213 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
214 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
215 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
216 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
217 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
218 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
219 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
220 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
221 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
222 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
223 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
224 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
225 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
226 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
227 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
228 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
229 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
230 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
231 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
232 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
233 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
234 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
235 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
236 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
237 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
238 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
239 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
242 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
243 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
244 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
245 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
246 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
247 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
248 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
249 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
250 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
251 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
252 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
257 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
258 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
259 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
260 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
261 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
262 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
263 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
265 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
266 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
267 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
268 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
269 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
270 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
271 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
272 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
273 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
274 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
275 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
276 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
277 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
278 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
279 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
280 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
281 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
282 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
283 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
284 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
285 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
286 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
287 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
288 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
289 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
290 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
291 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
292 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
293 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
294 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
295 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
296 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
297 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
298 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
299 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
300 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
301 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
302 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
303 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
304 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
305 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
306 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
307 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
308 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
309 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
310 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
311 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
312 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
313 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.28
Metatranscriptomes 0
Isolates 1.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.05
Nodule 1.72
Rhizoplane 9.56
Rhizosphere 71.89
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0268266_10155226 3300028379 Bacteria 2067
2 JGI25406J46586_10007137 3300003203 Bacteria 5116
3 rootH2_10181162 3300003320 Bacteria 1423
4 rootL2_10081990 3300003322 Bacteria 1618
5 rootH1_10191497 3300003323 Bacteria 1323
6 JGI25404J52841_10007354 3300003659 Bacteria 2327
7 JGI25404J52841_10010679 3300003659 Bacteria 1975
8 JGI25404J52841_10016057 3300003659 Bacteria 1624
9 JGI25404J52841_10026468 3300003659 Bacteria 1248
10 Ga0070658_10500359 3300005327 Bacteria 1050
11 Ga0070690_100182781 3300005330 Bacteria 1450
12 Ga0070680_100091824 3300005336 Bacteria 2514
13 Ga0070692_10229351 3300005345 Bacteria 1102
14 Ga0070668_100106342 3300005347 Bacteria 2229
15 Ga0070669_100228174 3300005353 Bacteria 1475
16 Ga0070671_100026447 3300005355 Bacteria 4768
17 Ga0070671_100151178 3300005355 Bacteria 1960
18 Ga0070673_100036774 3300005364 Bacteria 3726
19 Ga0070673_100426432 3300005364 Bacteria 1190
20 Ga0070688_100347747 3300005365 Bacteria 1085
21 Ga0070667_100156318 3300005367 Bacteria 2006
22 Ga0070667_100396579 3300005367 Bacteria 1255
23 Ga0070709_10003250 3300005434 Bacteria 8722
24 Ga0070714_100005009 3300005435 Bacteria 10069
25 Ga0070713_100017553 3300005436 Bacteria 5415
26 Ga0070713_100124690 3300005436 Bacteria 2264
27 Ga0070710_10000455 3300005437 Bacteria 19180
28 Ga0070710_10008362 3300005437 Bacteria 5037
29 Ga0070710_10047821 3300005437 Bacteria 2387
30 Ga0070711_100009942 3300005439 Bacteria 5868
31 Ga0070711_100019340 3300005439 Bacteria 4368
32 Ga0070711_100299430 3300005439 Bacteria 1278
33 Ga0070700_100074013 3300005441 Bacteria 2182
34 Ga0070663_100003276 3300005455 Bacteria 9322
35 Ga0070663_100060069 3300005455 Bacteria 2733
36 Ga0070663_100264218 3300005455 Bacteria 1366
37 Ga0070663_100448022 3300005455 Bacteria 1063
38 Ga0070678_100037459 3300005456 Bacteria 3406
39 Ga0070678_100106277 3300005456 Bacteria 2187
40 Ga0070678_100422256 3300005456 Bacteria 1162
41 Ga0070681_10044119 3300005458 Bacteria 4463
42 Ga0068867_100224394 3300005459 Bacteria 1516
43 Ga0070685_10013399 3300005466 Bacteria 4323
44 Ga0070707_100040149 3300005468 Bacteria 4477
45 Ga0070698_100006758 3300005471 Bacteria 12437
46 Ga0068853_100075044 3300005539 Bacteria 2950
47 Ga0068853_100080780 3300005539 Bacteria 2846
48 Ga0068853_100370480 3300005539 Bacteria 1336
49 Ga0070672_100026972 3300005543 Bacteria 4282
50 Ga0070672_100296154 3300005543 Bacteria 1371
51 Ga0070672_100413822 3300005543 Bacteria 1157
52 Ga0070693_100262744 3300005547 Bacteria 1149
53 Ga0070665_100021065 3300005548 Bacteria 6555
54 Ga0070665_100031802 3300005548 Bacteria 5311
55 Ga0070665_100074456 3300005548 Bacteria 3402
56 Ga0070665_100082763 3300005548 Bacteria 3214
57 Ga0070665_100568432 3300005548 Bacteria 1146
58 Ga0068855_100021476 3300005563 Bacteria 7741
59 Ga0068857_100216992 3300005577 Bacteria 1747
60 Ga0068856_100147121 3300005614 Bacteria 2363
61 Ga0068856_100374357 3300005614 Bacteria 1443
62 Ga0070702_100066217 3300005615 Bacteria 2118
63 Ga0068852_100027440 3300005616 Bacteria 4641
64 Ga0068852_100453556 3300005616 Bacteria 1270
65 Ga0068852_100585763 3300005616 Bacteria 1119
66 Ga0068864_100042776 3300005618 Bacteria 3877
67 Ga0068866_10102765 3300005718 Bacteria 1580
68 Ga0068861_100149930 3300005719 Bacteria 1912
69 Ga0068858_100039217 3300005842 Bacteria 4393
70 Ga0068858_100283086 3300005842 Bacteria 1579
71 Ga0068860_100223514 3300005843 Bacteria 1828
72 Ga0068862_100117620 3300005844 Bacteria 2339
73 Ga0081455_10029991 3300005937 Bacteria 4950
74 Ga0081455_10061419 3300005937 Bacteria 3162
75 Ga0081455_10070520 3300005937 Bacteria 2901
76 Ga0081538_10098730 3300005981 Bacteria 1478
77 Ga0081540_1000646 3300005983 Bacteria 33092
78 Ga0081540_1003398 3300005983 Bacteria 12614
79 Ga0081540_1005456 3300005983 Bacteria 9490
80 Ga0081540_1009831 3300005983 Bacteria 6543
81 Ga0081540_1012715 3300005983 Bacteria 5518
82 Ga0081540_1026609 3300005983 Bacteria 3297
83 Ga0081540_1026628 3300005983 Bacteria 3295
84 Ga0081539_10000629 3300005985 Bacteria 71410
85 Ga0081539_10017485 3300005985 Bacteria 5031
86 Ga0081539_10020905 3300005985 Bacteria 4397
87 Ga0081539_10044554 3300005985 Bacteria 2560
88 Ga0070717_10244705 3300006028 Bacteria 1583
89 Ga0075365_10003483 3300006038 Bacteria 8121
90 Ga0075365_10081052 3300006038 Bacteria 2198
91 Ga0075365_10086924 3300006038 Bacteria 2125
92 Ga0075365_10132871 3300006038 Bacteria 1723
93 Ga0075368_10017147 3300006042 Bacteria 2708
94 Ga0075363_100079913 3300006048 Bacteria 1787
95 Ga0070715_10010389 3300006163 Bacteria 3316
96 Ga0070716_100016193 3300006173 Bacteria 3843
97 Ga0070716_100033026 3300006173 Bacteria 2828
98 Ga0070716_100095263 3300006173 Bacteria 1812
99 Ga0070712_100008406 3300006175 Bacteria 6491
100 Ga0070712_100055335 3300006175 Bacteria 2778
101 Ga0070712_100235858 3300006175 Bacteria 1455
102 Ga0070712_100316509 3300006175 Bacteria 1268
103 Ga0075362_10030612 3300006177 Bacteria 2324
104 Ga0075367_10017451 3300006178 Bacteria 3940
105 Ga0075367_10110699 3300006178 Bacteria 1685
106 Ga0075369_10025631 3300006186 Bacteria 2453
107 Ga0075369_10033793 3300006186 Bacteria 2169
108 Ga0075366_10124050 3300006195 Bacteria 1557
109 Ga0075370_10033076 3300006353 Bacteria 2893
110 Ga0075370_10177041 3300006353 Bacteria 1255
111 Ga0075370_10220178 3300006353 Bacteria 1122
112 Ga0068871_100206582 3300006358 Bacteria 1697
113 Ga0075428_100108030 3300006844 Bacteria 3032
114 Ga0068865_100202512 3300006881 Bacteria 1542
115 Ga0099795_10006937 3300007788 Bacteria 3125
116 Ga0099795_10028976 3300007788 Bacteria 1889
117 Ga0105240_10027700 3300009093 Bacteria 7415
118 Ga0105240_10188552 3300009093 Bacteria 2427
119 Ga0111539_10087596 3300009094 Bacteria 3657
120 Ga0105245_10010179 3300009098 Bacteria 8188
121 Ga0105245_10141379 3300009098 Bacteria 2267
122 Ga0105245_10188786 3300009098 Bacteria 1973
123 Ga0105247_10201598 3300009101 Bacteria 1337
124 Ga0105243_10212017 3300009148 Bacteria 1706
125 Ga0105243_10300279 3300009148 Bacteria 1455
126 Ga0105243_10607913 3300009148 Bacteria 1053
127 Ga0105241_10009967 3300009174 Bacteria 6981
128 Ga0105242_10118767 3300009176 Bacteria 2265
129 Ga0105242_10407995 3300009176 Bacteria 1270
130 Ga0105248_10038110 3300009177 Bacteria 5379
131 Ga0105248_10162830 3300009177 Bacteria 2515
132 Ga0105248_10415082 3300009177 Bacteria 1516
133 Ga0105248_10637447 3300009177 Bacteria 1202
134 Ga0105237_10018096 3300009545 Bacteria 7297
135 Ga0105237_10289273 3300009545 Bacteria 1641
136 Ga0105238_10392270 3300009551 Bacteria 1380
137 Ga0105249_10479562 3300009553 Bacteria 1286
138 Ga0099796_10010966 3300010159 Bacteria 2512
139 Ga0105239_10032474 3300010375 Bacteria 5735
140 Ga0105239_10056672 3300010375 Bacteria 4298
141 Ga0105239_10313440 3300010375 Bacteria 1768
142 Ga0105239_10516814 3300010375 Bacteria 1358
143 Ga0105246_10035797 3300011119 Bacteria 3320
144 Ga0105246_10174222 3300011119 Bacteria 1650
145 Ga0157370_10049034 3300013104 Bacteria 4044
146 Ga0157369_10384147 3300013105 Bacteria 1457
147 Ga0157374_10028038 3300013296 Bacteria 5085
148 Ga0157374_10048170 3300013296 Bacteria 3954
149 Ga0157378_10029541 3300013297 Bacteria 4841
150 Ga0163162_10028507 3300013306 Bacteria 5525
151 Ga0157375_10010521 3300013308 Bacteria 8143
152 Ga0157375_10151736 3300013308 Bacteria 2453
153 Ga0163163_10024663 3300014325 Bacteria 5725
154 Ga0163163_10182859 3300014325 Bacteria 2144
155 Ga0157380_10197303 3300014326 Bacteria 1783
156 Ga0157380_10365011 3300014326 Bacteria 1356
157 Ga0157377_10099114 3300014745 Bacteria 1733
158 Ga0157379_10408573 3300014968 Bacteria 1249
159 Ga0157379_10521805 3300014968 Bacteria 1103
160 Ga0157376_10042714 3300014969 Bacteria 3716
161 Ga0157376_10233293 3300014969 Bacteria 1710
162 Ga0157376_10297616 3300014969 Bacteria 1526
163 Ga0157376_10622507 3300014969 Bacteria 1077
164 Ga0209758_1001045 3300025297 Bacteria 36271
165 Ga0209758_1013582 3300025297 Bacteria 4424
166 Ga0209758_1028388 3300025297 Bacteria 2368
167 Ga0207426_1002198 3300025302 Bacteria 13123
168 Ga0207692_10000213 3300025898 Bacteria 19497
169 Ga0207692_10027905 3300025898 Bacteria 2664
170 Ga0207642_10010122 3300025899 Bacteria 3308
171 Ga0207680_10089843 3300025903 Bacteria 1951
172 Ga0207647_10209313 3300025904 Bacteria 1126
173 Ga0207685_10013315 3300025905 Bacteria 2540
174 Ga0207643_10074180 3300025908 Bacteria 1962
175 Ga0207705_10120681 3300025909 Bacteria 1945
176 Ga0207654_10121972 3300025911 Bacteria 1638
177 Ga0207707_10001124 3300025912 Bacteria 25352
178 Ga0207707_10011025 3300025912 Bacteria 7864
179 Ga0207707_10075733 3300025912 Bacteria 2936
180 Ga0207695_10026151 3300025913 Bacteria 6515
181 Ga0207671_10002266 3300025914 Bacteria 20809
182 Ga0207671_10157021 3300025914 Bacteria 1760
183 Ga0207693_10000982 3300025915 Bacteria 25565
184 Ga0207693_10009753 3300025915 Bacteria 7817
185 Ga0207663_10000809 3300025916 Bacteria 14086
186 Ga0207663_10015023 3300025916 Bacteria 4260
187 Ga0207660_10031412 3300025917 Bacteria 3657
188 Ga0207662_10293481 3300025918 Bacteria 1079
189 Ga0207649_10092569 3300025920 Bacteria 1982
190 Ga0207646_10282625 3300025922 Bacteria 1500
191 Ga0207694_10251586 3300025924 Bacteria 1446
192 Ga0207659_10130928 3300025926 Bacteria 1936
193 Ga0207687_10029157 3300025927 Bacteria 3710
194 Ga0207687_10041198 3300025927 Bacteria 3169
195 Ga0207700_10270716 3300025928 Bacteria 1458
196 Ga0207664_10036042 3300025929 Bacteria 3822
197 Ga0207664_10453526 3300025929 Bacteria 1145
198 Ga0207644_10299068 3300025931 Bacteria 1296
199 Ga0207690_10388941 3300025932 Bacteria 1110
200 Ga0207706_10174681 3300025933 Bacteria 1887
201 Ga0207706_10271926 3300025933 Bacteria 1478
202 Ga0207686_10176995 3300025934 Bacteria 1510
203 Ga0207709_10030705 3300025935 Bacteria 3129
204 Ga0207709_10114993 3300025935 Bacteria 1806
205 Ga0207669_10052386 3300025937 Bacteria 2451
206 Ga0207704_10117979 3300025938 Bacteria 1809
207 Ga0207665_10001098 3300025939 Bacteria 18235
208 Ga0207665_10030018 3300025939 Bacteria 3593
209 Ga0207691_10058976 3300025940 Bacteria 3491
210 Ga0207691_10408355 3300025940 Bacteria 1158
211 Ga0207711_10144227 3300025941 Bacteria 2144
212 Ga0207689_10186078 3300025942 Bacteria 1713
213 Ga0207689_10201253 3300025942 Bacteria 1644
214 Ga0207689_10310283 3300025942 Bacteria 1308
215 Ga0207661_10001033 3300025944 Bacteria 18464
216 Ga0207679_10384184 3300025945 Bacteria 1232
217 Ga0207667_10012020 3300025949 Bacteria 10018
218 Ga0207668_10014298 3300025972 Bacteria 4911
219 Ga0207668_10046759 3300025972 Bacteria 2959
220 Ga0207658_10228873 3300025986 Bacteria 1568
221 Ga0207658_10298530 3300025986 Bacteria 1387
222 Ga0207677_10010334 3300026023 Bacteria 5278
223 Ga0207677_10069987 3300026023 Bacteria 2470
224 Ga0207677_10373043 3300026023 Bacteria 1202
225 Ga0207703_10007282 3300026035 Bacteria 8796
226 Ga0207703_10503191 3300026035 Bacteria 1137
227 Ga0207639_10212668 3300026041 Bacteria 1665
228 Ga0207678_10005107 3300026067 Bacteria 11771
229 Ga0207678_10008129 3300026067 Bacteria 9248
230 Ga0207678_10021813 3300026067 Bacteria 5617
231 Ga0207678_10025798 3300026067 Bacteria 5129
232 Ga0207678_10100795 3300026067 Bacteria 2467
233 Ga0207678_10123901 3300026067 Bacteria 2206
234 Ga0207708_10246520 3300026075 Bacteria 1438
235 Ga0207702_10033281 3300026078 Bacteria 4305
236 Ga0207641_10315902 3300026088 Bacteria 1480
237 Ga0207648_10037476 3300026089 Bacteria 4271
238 Ga0207648_10329637 3300026089 Bacteria 1373
239 Ga0207676_10019182 3300026095 Bacteria 4984
240 Ga0207676_10033712 3300026095 Bacteria 3871
241 Ga0207674_10016067 3300026116 Bacteria 8199
242 Ga0207675_100100500 3300026118 Bacteria 2725
243 Ga0207683_10028552 3300026121 Bacteria 4824
244 Ga0207683_10032774 3300026121 Bacteria 4513
245 Ga0207683_10128172 3300026121 Bacteria 2282
246 Ga0207683_10128964 3300026121 Bacteria 2274
247 Ga0207683_10183395 3300026121 Bacteria 1898
248 Ga0207698_10148360 3300026142 Bacteria 2032
249 Ga0207698_10242388 3300026142 Bacteria 1644
250 Ga0207698_10648878 3300026142 Bacteria 1045
251 Ga0209813_10021425 3300027866 Bacteria 1817
252 Ga0268266_10003251 3300028379 Bacteria 16379
253 Ga0268266_10005752 3300028379 Bacteria 11478
254 Ga0268266_10006678 3300028379 Bacteria 10524
255 Ga0268266_10335654 3300028379 Bacteria 1418
256 Ga0268265_10114283 3300028380 Bacteria 2210
257 Ga0268265_10269410 3300028380 Bacteria 1518
258 Ga0268264_10214315 3300028381 Bacteria 1770
259 Ga0307517_10001780 3300028786 Bacteria 35475
260 Ga0307515_10098392 3300028794 Bacteria 3563
261 Ga0307509_10354447 3300031507 Bacteria 1189
262 Ga0307508_10000088 3300031616 Bacteria 107883
263 Ga0307410_10238578 3300031852 Bacteria 1408
264 Ga0307415_100042442 3300032126 Bacteria 3027
265 Ga0307415_100177360 3300032126 Bacteria 1668
266 Ga0307415_100204190 3300032126 Bacteria 1571
267 Ga0307510_10008629 3300033180 Bacteria 12145
268 Ga0307510_10011556 3300033180 Bacteria 10479
269 Ga0307510_10049921 3300033180 Bacteria 4445
270 Ga0373938_0006367 3300034957 Bacteria 2038
271 Ga0373923_0100736 3300035111 Bacteria 1273
272 Ga0373945_0073087 3300035116 Bacteria 1301
273 Ga0373953_0033781 3300035117 Bacteria 2002
274 Ga0373954_0039098 3300035118 Bacteria 2208
275 Ga0373943_0005915 3300035170 Bacteria 5489
276 Ga0373955_0049616 3300035172 Bacteria 2279
277 Ga0373924_0032769 3300035410 Bacteria 2094
278 Ga0373935_0009211 3300035692 Bacteria 5909
279 Ga0373927_0009634 3300035695 Bacteria 6479
280 Ga0373927_0317050 3300035695 Bacteria 1026
281 Ga0373933_0000160 3300035724 Bacteria 43896
282 Ga0373933_0029864 3300035724 Bacteria 3154
283 Ga0373947_0120780 3300035725 Bacteria 1664
284 Ga0373937_0008081 3300036401 Bacteria 9131
285 Ga0373925_0074710 3300037068 Bacteria 2567
286 Ga0436365_0207361 3300039437 Bacteria 1442
287 Ga0436360_0562244 3300039438 Bacteria 1287
288 Ga0436363_1486472 3300039450 Bacteria 1213
289 Ga0495592_0109316 3300046454 Bacteria 1959
290 Ga0495603_0014591 3300046455 Bacteria 4751
291 Ga0495603_0038241 3300046455 Bacteria 2878
292 Ga0495603_0179546 3300046455 Bacteria 1225
293 Ga0495590_0008746 3300046457 Bacteria 3852
294 Ga0495590_0031051 3300046457 Bacteria 1871
295 Ga0495629_0155633 3300046459 Bacteria 1588
296 Ga0495629_0194282 3300046459 Bacteria 1404
297 Ga0495638_0215954 3300046460 Bacteria 1075
298 Ga0495638_0243908 3300046460 Bacteria 993
299 Ga0495651_0000667 3300046462 Bacteria 26661
300 Ga0495651_0020459 3300046462 Bacteria 5138
301 Ga0495650_0027885 3300046471 Bacteria 2602
302 Ga0495580_0038497 3300046472 Bacteria 3425
303 Ga0495639_0015628 3300046475 Bacteria 3292
304 Ga0495639_0017739 3300046475 Bacteria 3093
305 Ga0495639_0119606 3300046475 Bacteria 1256
306 Ga0495664_0008262 3300046477 Bacteria 5801
307 Ga0495664_0056504 3300046477 Bacteria 2335
308 Ga0495664_0130648 3300046477 Bacteria 1520
309 Ga0495584_0059451 3300046491 Bacteria 1922
310 Ga0495585_0043966 3300046492 Bacteria 2496
311 Ga0495585_0051165 3300046492 Bacteria 2290
312 Ga0495594_0175039 3300046499 Bacteria 1221
313 Ga0495607_0175673 3300046501 Bacteria 1078
314 Ga0495606_0035536 3300046507 Bacteria 3404
315 Ga0495608_0053454 3300046511 Bacteria 2672
316 Ga0495608_0135856 3300046511 Bacteria 1571
317 Ga0495616_0010901 3300046513 Bacteria 5234
318 Ga0495616_0160139 3300046513 Bacteria 1013
319 Ga0495618_0033963 3300046514 Bacteria 3198
320 Ga0495620_0073961 3300046515 Bacteria 1389
321 Ga0495630_0093023 3300046517 Bacteria 2279
322 Ga0495630_0143644 3300046517 Bacteria 1814
323 Ga0495631_0041257 3300046518 Bacteria 2043
324 Ga0495631_0076941 3300046518 Bacteria 1440
325 Ga0495632_0142540 3300046519 Bacteria 1111
326 Ga0495648_0006901 3300046524 Bacteria 9160
327 Ga0495648_0137634 3300046524 Bacteria 1289
328 Ga0495652_0156642 3300046529 Bacteria 1773
329 Ga0495652_0178453 3300046529 Bacteria 1632
330 Ga0495654_0144144 3300046530 Bacteria 1059
331 Ga0495665_0097304 3300046531 Bacteria 1545
332 Ga0495640_0069405 3300046533 Bacteria 2370
333 Ga0495587_0047065 3300046536 Bacteria 2558
334 Ga0495609_0074631 3300046538 Bacteria 1487
335 Ga0495621_0054875 3300046539 Bacteria 1433
336 Ga0495645_0005954 3300046543 Bacteria 8427
337 Ga0495645_0023280 3300046543 Bacteria 4485
338 Ga0495622_0008230 3300046557 Bacteria 4830
339 Ga0495622_0011711 3300046557 Bacteria 4055
340 Ga0495622_0105613 3300046557 Bacteria 1290
341 Ga0495633_0069169 3300046558 Bacteria 1648
342 Ga0495667_0141198 3300046559 Bacteria 1552
343 Ga0495656_0010495 3300046615 Bacteria 3370
344 Ga0495656_0020568 3300046615 Bacteria 2561
345 Ga0495668_0091387 3300046616 Bacteria 1668
346 Ga0495668_0178730 3300046616 Bacteria 1162
347 Ga0495625_0092480 3300046660 Bacteria 2090
348 Ga0495635_0035703 3300046663 Bacteria 3446
349 Ga0495635_0245054 3300046663 Bacteria 1209
350 Ga0495588_0033473 3300046674 Bacteria 2595
351 Ga0495657_0004969 3300046675 Bacteria 10574
352 Ga0495599_0039836 3300046678 Bacteria 2952
353 Ga0495623_0015865 3300046679 Bacteria 4870
354 Ga0495623_0124123 3300046679 Bacteria 1552
355 Ga0495646_0065686 3300046680 Bacteria 2148
356 Ga0495646_0168801 3300046680 Bacteria 1207
357 Ga0495658_0003633 3300046683 Bacteria 7635
358 Ga0495658_0136647 3300046683 Bacteria 1496
359 Ga0495613_0061718 3300046689 Bacteria 2744
360 Ga0495613_0143688 3300046689 Bacteria 1704
361 Ga0495613_0144224 3300046689 Bacteria 1700
362 Ga0495624_0100493 3300046690 Bacteria 1781
363 Ga0495671_0050916 3300046692 Bacteria 2061
364 Ga0495671_0086755 3300046692 Bacteria 1533
365 Ga0495649_0006278 3300046694 Bacteria 7397
366 Ga0495589_0125141 3300046794 Bacteria 1236
367 Ga0495600_0002629 3300046809 Bacteria 10366
368 Ga0495600_0138039 3300046809 Bacteria 1583
369 Ga0495581_0061849 3300047315 Bacteria 2164
370 Ga0495604_0005311 3300047317 Bacteria 10226
371 Ga0495604_0053078 3300047317 Bacteria 3136
372 Ga0495604_0138839 3300047317 Bacteria 1739
373 Ga0495604_0180340 3300047317 Bacteria 1478
374 Ga0495674_0022517 3300047319 Bacteria 5812
375 Ga0495672_0067367 3300047320 Bacteria 2039
376 Ga0495676_0246326 3300047321 Bacteria 1221
377 Ga0495680_0010342 3300047322 Bacteria 8328
378 Ga0495593_0002475 3300047673 Bacteria 11110
379 Ga0495602_0023680 3300048088 Bacteria 5977
380 Ga0495602_0197983 3300048088 Bacteria 1535
381 Ga0495602_0286230 3300048088 Bacteria 1212
382 Ga0496100_0038782 3300048903 Bacteria 3021
383 Ga0496100_0092880 3300048903 Bacteria 2063
384 Ga0496100_0135509 3300048903 Bacteria 1739
385 Ga0496100_0331214 3300048903 Bacteria 1146
386 Ga0496101_0010968 3300048904 Bacteria 6002
387 Ga0496101_0292429 3300048904 Bacteria 1275
388 Ga0496102_0001177 3300048905 Bacteria 23840
389 Ga0496102_0114873 3300048905 Bacteria 2512
390 Ga0496102_0120020 3300048905 Bacteria 2455
391 Ga0496102_0394619 3300048905 Bacteria 1301
392 Ga0496103_0097435 3300048906 Bacteria 1859
393 Ga0496103_0155368 3300048906 Bacteria 1466
394 Ga0496103_0228725 3300048906 Bacteria 1196
395 Ga0496104_0030785 3300048907 Bacteria 4988
396 Ga0496104_0194836 3300048907 Bacteria 1938
397 Ga0496104_0279225 3300048907 Bacteria 1583
398 Ga0496105_0020805 3300048908 Bacteria 5305
399 Ga0496105_0055390 3300048908 Bacteria 3274
400 Ga0496106_0003264 3300048909 Bacteria 12132
401 Ga0496106_0012784 3300048909 Bacteria 6196
402 Ga0496106_0124736 3300048909 Bacteria 2015
403 Ga0496107_0002363 3300048910 Bacteria 12204
404 Ga0496107_0032851 3300048910 Bacteria 3710
405 Ga0496108_0000507 3300048911 Bacteria 30629
406 Ga0496108_0019141 3300048911 Bacteria 5619
407 Ga0496108_0019336 3300048911 Bacteria 5592
408 Ga0496108_0076832 3300048911 Bacteria 2823
409 Ga0496109_0005693 3300048912 Bacteria 10431
410 Ga0496110_0017107 3300048913 Bacteria 6062
411 Ga0496110_0024145 3300048913 Bacteria 5178
412 Ga0496110_0039501 3300048913 Bacteria 4109
413 Ga0496110_0116989 3300048913 Bacteria 2400
414 Ga0496111_0013399 3300048914 Bacteria 5578
415 Ga0496112_0081177 3300048915 Bacteria 3206
416 Ga0496112_0098993 3300048915 Bacteria 2885
417 Ga0496112_0168463 3300048915 Bacteria 2156
418 Ga0496112_0235810 3300048915 Bacteria 1783
419 Ga0496112_0555744 3300048915 Bacteria 1081
420 Ga0496113_0012935 3300048916 Bacteria 5629
421 Ga0496113_0141421 3300048916 Bacteria 1894
422 Ga0496113_0178617 3300048916 Bacteria 1682
423 Ga0496113_0275927 3300048916 Bacteria 1344
424 Ga0496113_0411201 3300048916 Bacteria 1086
425 Ga0496114_0004374 3300048917 Bacteria 10944
426 Ga0496114_0105812 3300048917 Bacteria 2407
427 Ga0496114_0144083 3300048917 Bacteria 2064
428 Ga0496115_0009012 3300048918 Bacteria 7401
429 Ga0496115_0175357 3300048918 Bacteria 1773
430 Ga0496115_0287010 3300048918 Bacteria 1350
431 Ga0496115_0306803 3300048918 Bacteria 1300
432 Ga0496117_0027010 3300048920 Bacteria 4480
433 Ga0496118_0061303 3300048921 Bacteria 2786
434 Ga0496120_0012118 3300048923 Bacteria 5884
435 Ga0496121_0020073 3300048924 Bacteria 6638
436 Ga0496121_0029564 3300048924 Bacteria 5062
437 Ga0496121_0038319 3300048924 Bacteria 4248
438 Ga0496121_0047083 3300048924 Bacteria 3682
439 Ga0496121_0051177 3300048924 Bacteria 3481
440 Ga0496121_0281740 3300048924 Bacteria 1136
441 Ga0496124_0096537 3300048927 Bacteria 2401
442 Ga0496125_0097891 3300048928 Bacteria 2172
443 Ga0496126_0021024 3300048929 Bacteria 6386
444 Ga0496126_0023803 3300048929 Bacteria 5928
445 Ga0495682_0086408 3300049460 Bacteria 1127
446 Ga0501039_0061375 3300049575 Bacteria 2911
447 Ga0501039_0297574 3300049575 Bacteria 1269
448 Ga0501041_0081265 3300049577 Bacteria 1996
449 Ga0501042_0138166 3300049578 Bacteria 1756
450 Ga0501046_0278546 3300049580 Bacteria 1225
451 Ga0501068_0247069 3300049584 Bacteria 1136
452 Ga0501070_0136100 3300049586 Bacteria 2028
453 Ga0501073_0032647 3300049589 Bacteria 3711
454 Ga0501074_0049831 3300049590 Bacteria 3023
455 Ga0501076_0189211 3300049592 Bacteria 1679
456 Ga0501077_0062969 3300049593 Bacteria 2353
457 Ga0501080_0188028 3300049742 Bacteria 1898
458 Ga0501035_0287307 3300049822 Bacteria 1388
459 Ga0501045_0035204 3300049824 Bacteria 3634
460 nmdc:mga03n38_7485_c1 3300050490 Bacteria 3868
461 nmdc:mga00v17_55524_c1 3300050491 Bacteria 2419
462 nmdc:mga0yw44_90309_c1 3300050492 Bacteria 1935
463 nmdc:mga0k408_185556_c1 3300050493 Bacteria 1241
464 nmdc:mga06z11_85672_c1 3300050494 Bacteria 1700
465 nmdc:mga07m45_13499_c1 3300050496 Bacteria 4336
466 nmdc:mga0n895_223341_c1 3300050512 Bacteria 1912
467 nmdc:mga0rr50_188688_c1 3300050513 Bacteria 1688
468 nmdc:mga0a205_373527_c1 3300050515 Bacteria 1291
469 Ga0495601_0011572 3300053077 Bacteria 5286
470 Ga0495601_0072373 3300053077 Bacteria 2202
471 Ga0500635_0016279 3300053080 Bacteria 2209
472 Ga0495655_0018886 3300053083 Bacteria 1522
473 Ga0495655_0053914 3300053083 Bacteria 1074
474 Ga0495595_0033457 3300053084 Bacteria 2320
475 Ga0495619_0074770 3300053085 Bacteria 2273
476 Ga0495619_0333654 3300053085 Bacteria 1050
477 Ga0500644_0102837 3300053088 Bacteria 1088
478 Ga0500581_164103 3300053089 Bacteria 1028
479 Ga0500646_0047169 3300053090 Bacteria 1231
480 Ga0500583_0029876 3300053092 Bacteria 2381
481 Ga0500651_0024798 3300053093 Bacteria 3761
482 Ga0500651_0110448 3300053093 Bacteria 1678
483 Ga0500641_0024404 3300053096 Bacteria 2331
484 Ga0500554_001358 3300053102 Bacteria 4735
485 Ga0500554_015257 3300053102 Bacteria 2002
486 Ga0500556_0026563 3300053104 Bacteria 1924
487 Ga0500595_000766 3300053119 Bacteria 18852
488 Ga0500595_001845 3300053119 Bacteria 10967
489 Ga0500595_043161 3300053119 Bacteria 1437
490 Ga0500642_0025891 3300053130 Bacteria 2388
491 Ga0500642_0043490 3300053130 Bacteria 1951
492 Ga0500564_030209 3300053138 Bacteria 2495
493 Ga0500568_0027196 3300053139 Bacteria 2394
494 Ga0500568_0108869 3300053139 Bacteria 1036
495 Ga0500588_0007511 3300053146 Bacteria 2515
496 Ga0500603_001392 3300053150 Bacteria 5520
497 Ga0500603_017657 3300053150 Bacteria 1708
498 Ga0500616_0037237 3300053153 Bacteria 2634
499 Ga0500620_012621 3300053155 Bacteria 2308
500 Ga0500622_0080326 3300053156 Bacteria 1633
501 Ga0500633_0049239 3300053160 Bacteria 1448
502 Ga0500638_001560 3300053162 Bacteria 7323
503 Ga0500638_032308 3300053162 Bacteria 2527
504 Ga0500638_070136 3300053162 Bacteria 1676
505 Ga0500636_0007167 3300053177 Bacteria 6442
506 Ga0500637_0000134 3300053178 Bacteria 27110
507 Ga0500637_0000884 3300053178 Bacteria 12045
508 Ga0500637_0059010 3300053178 Bacteria 2195
509 Ga0500637_0164570 3300053178 Bacteria 1277
510 Ga0500609_000982 3300053731 Bacteria 4272
511 Ga0500601_000190 3300053737 Bacteria 12544
512 Ga0501084_0122018 3300054114 Bacteria 2191
513 Ga0500661_000037 3300055283 Bacteria 19843
514 Ga0501082_0312387 3300060353 Bacteria 1369
515 2932789142 2932784394 Bacteria 9704911
516 2932834391 2932828146 Bacteria 9745859
517 2935818149 2935810662 Bacteria 9401221
518 2935841269 2935837841 Bacteria 9454360
519 2936007937 2936002035 Bacteria 9362176
520 2936044759 2936037263 Bacteria 9446081
521 8016517655 8016511872 Bacteria 9921665
522 8017058971 8017057580 Bacteria 10023680
523 8019594724 8019586578 Bacteria 10212056
524 Ga0268266_10155226
525 JGI25406J46586_10007137
526 rootH2_10181162
527 rootL2_10081990
528 rootH1_10191497
529 JGI25404J52841_10007354
530 JGI25404J52841_10010679
531 JGI25404J52841_10016057
532 JGI25404J52841_10026468
533 Ga0070658_10500359
534 Ga0070690_100182781
535 Ga0070680_100091824
536 Ga0070692_10229351
537 Ga0070668_100106342
538 Ga0070669_100228174
539 Ga0070671_100026447
540 Ga0070671_100151178
541 Ga0070673_100036774
542 Ga0070673_100426432
543 Ga0070688_100347747
544 Ga0070667_100156318
545 Ga0070667_100396579
546 Ga0070709_10003250
547 Ga0070714_100005009
548 Ga0070713_100017553
549 Ga0070713_100124690
550 Ga0070710_10000455
551 Ga0070710_10008362
552 Ga0070710_10047821
553 Ga0070711_100009942
554 Ga0070711_100019340
555 Ga0070711_100299430
556 Ga0070700_100074013
557 Ga0070663_100003276
558 Ga0070663_100060069
559 Ga0070663_100264218
560 Ga0070663_100448022
561 Ga0070678_100037459
562 Ga0070678_100106277
563 Ga0070678_100422256
564 Ga0070681_10044119
565 Ga0068867_100224394
566 Ga0070685_10013399
567 Ga0070707_100040149
568 Ga0070698_100006758
569 Ga0068853_100075044
570 Ga0068853_100080780
571 Ga0068853_100370480
572 Ga0070672_100026972
573 Ga0070672_100296154
574 Ga0070672_100413822
575 Ga0070693_100262744
576 Ga0070665_100021065
577 Ga0070665_100031802
578 Ga0070665_100074456
579 Ga0070665_100082763
580 Ga0070665_100568432
581 Ga0068855_100021476
582 Ga0068857_100216992
583 Ga0068856_100147121
584 Ga0068856_100374357
585 Ga0070702_100066217
586 Ga0068852_100027440
587 Ga0068852_100453556
588 Ga0068852_100585763
589 Ga0068864_100042776
590 Ga0068866_10102765
591 Ga0068861_100149930
592 Ga0068858_100039217
593 Ga0068858_100283086
594 Ga0068860_100223514
595 Ga0068862_100117620
596 Ga0081455_10029991
597 Ga0081455_10061419
598 Ga0081455_10070520
599 Ga0081538_10098730
600 Ga0081540_1000646
601 Ga0081540_1003398
602 Ga0081540_1005456
603 Ga0081540_1009831
604 Ga0081540_1012715
605 Ga0081540_1026609
606 Ga0081540_1026628
607 Ga0081539_10000629
608 Ga0081539_10017485
609 Ga0081539_10020905
610 Ga0081539_10044554
611 Ga0070717_10244705
612 Ga0075365_10003483
613 Ga0075365_10081052
614 Ga0075365_10086924
615 Ga0075365_10132871
616 Ga0075368_10017147
617 Ga0075363_100079913
618 Ga0070715_10010389
619 Ga0070716_100016193
620 Ga0070716_100033026
621 Ga0070716_100095263
622 Ga0070712_100008406
623 Ga0070712_100055335
624 Ga0070712_100235858
625 Ga0070712_100316509
626 Ga0075362_10030612
627 Ga0075367_10017451
628 Ga0075367_10110699
629 Ga0075369_10025631
630 Ga0075369_10033793
631 Ga0075366_10124050
632 Ga0075370_10033076
633 Ga0075370_10177041
634 Ga0075370_10220178
635 Ga0068871_100206582
636 Ga0075428_100108030
637 Ga0068865_100202512
638 Ga0099795_10006937
639 Ga0099795_10028976
640 Ga0105240_10027700
641 Ga0105240_10188552
642 Ga0111539_10087596
643 Ga0105245_10010179
644 Ga0105245_10141379
645 Ga0105245_10188786
646 Ga0105247_10201598
647 Ga0105243_10212017
648 Ga0105243_10300279
649 Ga0105243_10607913
650 Ga0105241_10009967
651 Ga0105242_10118767
652 Ga0105242_10407995
653 Ga0105248_10038110
654 Ga0105248_10162830
655 Ga0105248_10415082
656 Ga0105248_10637447
657 Ga0105237_10018096
658 Ga0105237_10289273
659 Ga0105238_10392270
660 Ga0105249_10479562
661 Ga0099796_10010966
662 Ga0105239_10032474
663 Ga0105239_10056672
664 Ga0105239_10313440
665 Ga0105239_10516814
666 Ga0105246_10035797
667 Ga0105246_10174222
668 Ga0157370_10049034
669 Ga0157369_10384147
670 Ga0157374_10028038
671 Ga0157374_10048170
672 Ga0157378_10029541
673 Ga0163162_10028507
674 Ga0157375_10010521
675 Ga0157375_10151736
676 Ga0163163_10024663
677 Ga0163163_10182859
678 Ga0157380_10197303
679 Ga0157380_10365011
680 Ga0157377_10099114
681 Ga0157379_10408573
682 Ga0157379_10521805
683 Ga0157376_10042714
684 Ga0157376_10233293
685 Ga0157376_10297616
686 Ga0157376_10622507
687 Ga0209758_1001045
688 Ga0209758_1013582
689 Ga0209758_1028388
690 Ga0207426_1002198
691 Ga0207692_10000213
692 Ga0207692_10027905
693 Ga0207642_10010122
694 Ga0207680_10089843
695 Ga0207647_10209313
696 Ga0207685_10013315
697 Ga0207643_10074180
698 Ga0207705_10120681
699 Ga0207654_10121972
700 Ga0207707_10001124
701 Ga0207707_10011025
702 Ga0207707_10075733
703 Ga0207695_10026151
704 Ga0207671_10002266
705 Ga0207671_10157021
706 Ga0207693_10000982
707 Ga0207693_10009753
708 Ga0207663_10000809
709 Ga0207663_10015023
710 Ga0207660_10031412
711 Ga0207662_10293481
712 Ga0207649_10092569
713 Ga0207646_10282625
714 Ga0207694_10251586
715 Ga0207659_10130928
716 Ga0207687_10029157
717 Ga0207687_10041198
718 Ga0207700_10270716
719 Ga0207664_10036042
720 Ga0207664_10453526
721 Ga0207644_10299068
722 Ga0207690_10388941
723 Ga0207706_10174681
724 Ga0207706_10271926
725 Ga0207686_10176995
726 Ga0207709_10030705
727 Ga0207709_10114993
728 Ga0207669_10052386
729 Ga0207704_10117979
730 Ga0207665_10001098
731 Ga0207665_10030018
732 Ga0207691_10058976
733 Ga0207691_10408355
734 Ga0207711_10144227
735 Ga0207689_10186078
736 Ga0207689_10201253
737 Ga0207689_10310283
738 Ga0207661_10001033
739 Ga0207679_10384184
740 Ga0207667_10012020
741 Ga0207668_10014298
742 Ga0207668_10046759
743 Ga0207658_10228873
744 Ga0207658_10298530
745 Ga0207677_10010334
746 Ga0207677_10069987
747 Ga0207677_10373043
748 Ga0207703_10007282
749 Ga0207703_10503191
750 Ga0207639_10212668
751 Ga0207678_10005107
752 Ga0207678_10008129
753 Ga0207678_10021813
754 Ga0207678_10025798
755 Ga0207678_10100795
756 Ga0207678_10123901
757 Ga0207708_10246520
758 Ga0207702_10033281
759 Ga0207641_10315902
760 Ga0207648_10037476
761 Ga0207648_10329637
762 Ga0207676_10019182
763 Ga0207676_10033712
764 Ga0207674_10016067
765 Ga0207675_100100500
766 Ga0207683_10028552
767 Ga0207683_10032774
768 Ga0207683_10128172
769 Ga0207683_10128964
770 Ga0207683_10183395
771 Ga0207698_10148360
772 Ga0207698_10242388
773 Ga0207698_10648878
774 Ga0209813_10021425
775 Ga0268266_10003251
776 Ga0268266_10005752
777 Ga0268266_10006678
778 Ga0268266_10335654
779 Ga0268265_10114283
780 Ga0268265_10269410
781 Ga0268264_10214315
782 Ga0307517_10001780
783 Ga0307515_10098392
784 Ga0307509_10354447
785 Ga0307508_10000088
786 Ga0307410_10238578
787 Ga0307415_100042442
788 Ga0307415_100177360
789 Ga0307415_100204190
790 Ga0307510_10008629
791 Ga0307510_10011556
792 Ga0307510_10049921
793 Ga0373938_0006367
794 Ga0373923_0100736
795 Ga0373945_0073087
796 Ga0373953_0033781
797 Ga0373954_0039098
798 Ga0373943_0005915
799 Ga0373955_0049616
800 Ga0373924_0032769
801 Ga0373935_0009211
802 Ga0373927_0009634
803 Ga0373927_0317050
804 Ga0373933_0000160
805 Ga0373933_0029864
806 Ga0373947_0120780
807 Ga0373937_0008081
808 Ga0373925_0074710
809 Ga0436365_0207361
810 Ga0436360_0562244
811 Ga0436363_1486472
812 Ga0495592_0109316
813 Ga0495603_0014591
814 Ga0495603_0038241
815 Ga0495603_0179546
816 Ga0495590_0008746
817 Ga0495590_0031051
818 Ga0495629_0155633
819 Ga0495629_0194282
820 Ga0495638_0215954
821 Ga0495638_0243908
822 Ga0495651_0000667
823 Ga0495651_0020459
824 Ga0495650_0027885
825 Ga0495580_0038497
826 Ga0495639_0015628
827 Ga0495639_0017739
828 Ga0495639_0119606
829 Ga0495664_0008262
830 Ga0495664_0056504
831 Ga0495664_0130648
832 Ga0495584_0059451
833 Ga0495585_0043966
834 Ga0495585_0051165
835 Ga0495594_0175039
836 Ga0495607_0175673
837 Ga0495606_0035536
838 Ga0495608_0053454
839 Ga0495608_0135856
840 Ga0495616_0010901
841 Ga0495616_0160139
842 Ga0495618_0033963
843 Ga0495620_0073961
844 Ga0495630_0093023
845 Ga0495630_0143644
846 Ga0495631_0041257
847 Ga0495631_0076941
848 Ga0495632_0142540
849 Ga0495648_0006901
850 Ga0495648_0137634
851 Ga0495652_0156642
852 Ga0495652_0178453
853 Ga0495654_0144144
854 Ga0495665_0097304
855 Ga0495640_0069405
856 Ga0495587_0047065
857 Ga0495609_0074631
858 Ga0495621_0054875
859 Ga0495645_0005954
860 Ga0495645_0023280
861 Ga0495622_0008230
862 Ga0495622_0011711
863 Ga0495622_0105613
864 Ga0495633_0069169
865 Ga0495667_0141198
866 Ga0495656_0010495
867 Ga0495656_0020568
868 Ga0495668_0091387
869 Ga0495668_0178730
870 Ga0495625_0092480
871 Ga0495635_0035703
872 Ga0495635_0245054
873 Ga0495588_0033473
874 Ga0495657_0004969
875 Ga0495599_0039836
876 Ga0495623_0015865
877 Ga0495623_0124123
878 Ga0495646_0065686
879 Ga0495646_0168801
880 Ga0495658_0003633
881 Ga0495658_0136647
882 Ga0495613_0061718
883 Ga0495613_0143688
884 Ga0495613_0144224
885 Ga0495624_0100493
886 Ga0495671_0050916
887 Ga0495671_0086755
888 Ga0495649_0006278
889 Ga0495589_0125141
890 Ga0495600_0002629
891 Ga0495600_0138039
892 Ga0495581_0061849
893 Ga0495604_0005311
894 Ga0495604_0053078
895 Ga0495604_0138839
896 Ga0495604_0180340
897 Ga0495674_0022517
898 Ga0495672_0067367
899 Ga0495676_0246326
900 Ga0495680_0010342
901 Ga0495593_0002475
902 Ga0495602_0023680
903 Ga0495602_0197983
904 Ga0495602_0286230
905 Ga0496100_0038782
906 Ga0496100_0092880
907 Ga0496100_0135509
908 Ga0496100_0331214
909 Ga0496101_0010968
910 Ga0496101_0292429
911 Ga0496102_0001177
912 Ga0496102_0114873
913 Ga0496102_0120020
914 Ga0496102_0394619
915 Ga0496103_0097435
916 Ga0496103_0155368
917 Ga0496103_0228725
918 Ga0496104_0030785
919 Ga0496104_0194836
920 Ga0496104_0279225
921 Ga0496105_0020805
922 Ga0496105_0055390
923 Ga0496106_0003264
924 Ga0496106_0012784
925 Ga0496106_0124736
926 Ga0496107_0002363
927 Ga0496107_0032851
928 Ga0496108_0000507
929 Ga0496108_0019141
930 Ga0496108_0019336
931 Ga0496108_0076832
932 Ga0496109_0005693
933 Ga0496110_0017107
934 Ga0496110_0024145
935 Ga0496110_0039501
936 Ga0496110_0116989
937 Ga0496111_0013399
938 Ga0496112_0081177
939 Ga0496112_0098993
940 Ga0496112_0168463
941 Ga0496112_0235810
942 Ga0496112_0555744
943 Ga0496113_0012935
944 Ga0496113_0141421
945 Ga0496113_0178617
946 Ga0496113_0275927
947 Ga0496113_0411201
948 Ga0496114_0004374
949 Ga0496114_0105812
950 Ga0496114_0144083
951 Ga0496115_0009012
952 Ga0496115_0175357
953 Ga0496115_0287010
954 Ga0496115_0306803
955 Ga0496117_0027010
956 Ga0496118_0061303
957 Ga0496120_0012118
958 Ga0496121_0020073
959 Ga0496121_0029564
960 Ga0496121_0038319
961 Ga0496121_0047083
962 Ga0496121_0051177
963 Ga0496121_0281740
964 Ga0496124_0096537
965 Ga0496125_0097891
966 Ga0496126_0021024
967 Ga0496126_0023803
968 Ga0495682_0086408
969 Ga0501039_0061375
970 Ga0501039_0297574
971 Ga0501041_0081265
972 Ga0501042_0138166
973 Ga0501046_0278546
974 Ga0501068_0247069
975 Ga0501070_0136100
976 Ga0501073_0032647
977 Ga0501074_0049831
978 Ga0501076_0189211
979 Ga0501077_0062969
980 Ga0501080_0188028
981 Ga0501035_0287307
982 Ga0501045_0035204
983 nmdc:mga03n38_7485_c1
984 nmdc:mga00v17_55524_c1
985 nmdc:mga0yw44_90309_c1
986 nmdc:mga0k408_185556_c1
987 nmdc:mga06z11_85672_c1
988 nmdc:mga07m45_13499_c1
989 nmdc:mga0n895_223341_c1
990 nmdc:mga0rr50_188688_c1
991 nmdc:mga0a205_373527_c1
992 Ga0495601_0011572
993 Ga0495601_0072373
994 Ga0500635_0016279
995 Ga0495655_0018886
996 Ga0495655_0053914
997 Ga0495595_0033457
998 Ga0495619_0074770
999 Ga0495619_0333654
1000 Ga0500644_0102837
1001 Ga0500581_164103
1002 Ga0500646_0047169
1003 Ga0500583_0029876
1004 Ga0500651_0024798
1005 Ga0500651_0110448
1006 Ga0500641_0024404
1007 Ga0500554_001358
1008 Ga0500554_015257
1009 Ga0500556_0026563
1010 Ga0500595_000766
1011 Ga0500595_001845
1012 Ga0500595_043161
1013 Ga0500642_0025891
1014 Ga0500642_0043490
1015 Ga0500564_030209
1016 Ga0500568_0027196
1017 Ga0500568_0108869
1018 Ga0500588_0007511
1019 Ga0500603_001392
1020 Ga0500603_017657
1021 Ga0500616_0037237
1022 Ga0500620_012621
1023 Ga0500622_0080326
1024 Ga0500633_0049239
1025 Ga0500638_001560
1026 Ga0500638_032308
1027 Ga0500638_070136
1028 Ga0500636_0007167
1029 Ga0500637_0000134
1030 Ga0500637_0000884
1031 Ga0500637_0059010
1032 Ga0500637_0164570
1033 Ga0500609_000982
1034 Ga0500601_000190
1035 Ga0501084_0122018
1036 Ga0500661_000037
1037 Ga0501082_0312387
1038 2932789142
1039 2932834391
1040 2935818149
1041 2935841269
1042 2936007937
1043 2936044759
1044 8016517655
1045 8017058971
1046 8019594724

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01734

Patatin

Patatin-like phospholipase

86

255

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5fya-assembly1.cif.gz_B cubic crystal of the native plpd 0.812 10 273
5fya-assembly1.cif.gz_A cubic crystal of the native plpd 0.8107 11 273
5fqu-assembly1.cif.gz_B orthorhombic crystal structure of of plpd (selenomethionine derivative) 0.8011 10 273
5fqu-assembly1.cif.gz_A orthorhombic crystal structure of of plpd (selenomethionine derivative) 0.7991 10 273
5fya-assembly1.cif.gz_A cubic crystal of the native plpd 0.7933 11 273
ID Description Score Start End Superfamily
af_P0AFR0_2_250_3.40.1090.10 Alpha Beta;3-Layer(aba) Sandwich;Cytosolic phospholipase A2 catalytic domain;Cytosolic phospholipase A2 catalytic domain 0.8889 11 190 3.40.1090.10
af_O69695_801_1044_3.40.1090.10 Alpha Beta;3-Layer(aba) Sandwich;Cytosolic phospholipase A2 catalytic domain;Cytosolic phospholipase A2 catalytic domain 0.7768 11 262 3.40.1090.10
af_Q54JJ8_18_280_3.40.1090.10 Alpha Beta;3-Layer(aba) Sandwich;Cytosolic phospholipase A2 catalytic domain;Cytosolic phospholipase A2 catalytic domain 0.7743 11 247 3.40.1090.10
af_Q9NP80_434_763_3.40.1090.10 Alpha Beta;3-Layer(aba) Sandwich;Cytosolic phospholipase A2 catalytic domain;Cytosolic phospholipase A2 catalytic domain 0.7658 10 274 3.40.1090.10
af_O69695_801_1044_3.40.1090.10 Alpha Beta;3-Layer(aba) Sandwich;Cytosolic phospholipase A2 catalytic domain;Cytosolic phospholipase A2 catalytic domain 0.7652 11 262 3.40.1090.10
ID Description Score Start End GO Terms
AF-A0A5C7W0B3-F1-model_v4 Patatin-like phospholipase family protein 0.9268 10 290 GO:0016042
GO:0016787
AF-A0A6P2KEL7-F1-model_v4 deleted 0.9221 11 290
AF-A0A3D0RU52-F1-model_v4 Alpha/beta hydrolase 0.9193 11 290 GO:0016042
GO:0016787
AF-A0A2H0A129-F1-model_v4 PNPLA domain-containing protein 0.919 6 290 GO:0016020
GO:0016042
GO:0016787
AF-A0A5E7FJ01-F1-model_v4 Putative NTE family protein 0.9176 8 290 GO:0016042
GO:0016787

Map