F458815

General Info

Members Datasets Scaffolds Average Seq Length
522 218 1044 265

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100143949|Ga0070697_1001439492
Length 282
Sequence MAADPGAVRVKADPAKASLFALRLAPPPNTRRLIGAMGIGVVVLVWWLATLGRPEDRLISPVILPSPAEVIRSFPSLWRERALLESIAATLRRVLIGFGLAAVVGVPLGIMAGSWRVLESAGAPLALFGRNLPVAALIPLTILWFGIDETQKVMFIFIACVPFVYSDAVAAVASVPDRYVETAQTLGASSWQIVTKVLVGLALPGIVDSLRHLFGLAFGYIMLAELINAQHGLGYLLMTSQRRGLSEHIVLILIIIGLLAYGIDRLLVWFQRGLFPYRVVED

Samples

Sample ID Description Type Environment
1 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
155 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
156 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
165 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
166 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
167 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
168 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
169 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
170 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
171 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
172 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
173 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
174 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
175 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
176 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
177 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
178 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
179 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
180 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
181 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
182 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
183 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
186 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
187 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
188 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
189 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
200 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
201 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
202 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
203 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
204 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
205 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
206 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
209 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
210 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
214 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
216 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
217 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
218 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.45
Nodule 0
Rhizoplane 4.02
Rhizosphere 92.15
Stem 0
Stem Tuber 0
Unclassified 3.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070697_100143949 3300005536 Bacteria 2006
2 Ga0065712_10005423 3300005290 Bacteria 4300
3 Ga0065712_10068319 3300005290 Bacteria 11734
4 Ga0065712_10070239 3300005290 Bacteria 6189
5 Ga0065715_10004564 3300005293 Bacteria 7576
6 Ga0065715_10020448 3300005293 Bacteria 1877
7 Ga0065715_10053854 3300005293 Bacteria 1085
8 Ga0065707_10087575 3300005295 Bacteria 4975
9 Ga0070676_10200207 3300005328 Bacteria 1309
10 Ga0070676_10209134 3300005328 Bacteria 1283
11 Ga0070676_10315684 3300005328 Bacteria 1064
12 Ga0070683_100014957 3300005329 Bacteria 6805
13 Ga0070690_100008824 3300005330 Bacteria 5823
14 Ga0070670_100270244 3300005331 Bacteria 1483
15 Ga0070666_10083288 3300005335 Bacteria 2188
16 Ga0070682_100086989 3300005337 Bacteria 2036
17 Ga0068868_100013803 3300005338 Bacteria 5937
18 Ga0068868_100302029 3300005338 Bacteria 1360
19 Ga0070660_100385069 3300005339 Unclassified 1158
20 Ga0070689_100031516 3300005340 Bacteria 4029
21 Ga0070687_100026429 3300005343 Bacteria 2795
22 Ga0070687_100133727 3300005343 Bacteria 1435
23 Ga0070661_100040847 3300005344 Bacteria 3385
24 Ga0070668_100019740 3300005347 Bacteria 5075
25 Ga0070668_100072160 3300005347 Bacteria 2690
26 Ga0070668_100263967 3300005347 Bacteria 1433
27 Ga0070669_100006274 3300005353 Bacteria 8580
28 Ga0070669_100053222 3300005353 Bacteria 2963
29 Ga0070669_100060153 3300005353 Bacteria 2790
30 Ga0070669_100087812 3300005353 Bacteria 2326
31 Ga0070669_100327884 3300005353 Bacteria 1238
32 Ga0070675_100019501 3300005354 Bacteria 5407
33 Ga0070675_100029165 3300005354 Bacteria 4448
34 Ga0070675_100107559 3300005354 Bacteria 2355
35 Ga0070675_100117355 3300005354 Bacteria 2258
36 Ga0070675_100182748 3300005354 Bacteria 1814
37 Ga0070675_100354308 3300005354 Bacteria 1302
38 Ga0070675_100517659 3300005354 Unclassified 1076
39 Ga0070674_100003279 3300005356 Bacteria 9052
40 Ga0070674_100005542 3300005356 Bacteria 7299
41 Ga0070674_100024411 3300005356 Bacteria 3923
42 Ga0070673_100006100 3300005364 Bacteria 7809
43 Ga0070673_100035907 3300005364 Bacteria 3763
44 Ga0070673_100095141 3300005364 Bacteria 2443
45 Ga0070673_100169877 3300005364 Bacteria 1860
46 Ga0070673_100472464 3300005364 Bacteria 1131
47 Ga0070688_100016656 3300005365 Bacteria 4205
48 Ga0070688_100026170 3300005365 Bacteria 3463
49 Ga0070688_100122287 3300005365 Unclassified 1745
50 Ga0070667_100230649 3300005367 Bacteria 1651
51 Ga0070703_10156983 3300005406 Bacteria 860
52 Ga0070709_10115127 3300005434 Bacteria 1813
53 Ga0070701_10049401 3300005438 Bacteria 2175
54 Ga0070701_10094210 3300005438 Bacteria 1647
55 Ga0070701_10142366 3300005438 Bacteria 1373
56 Ga0070705_100033440 3300005440 Bacteria 2866
57 Ga0070705_100129000 3300005440 Bacteria 1646
58 Ga0070700_100040859 3300005441 Bacteria 2841
59 Ga0070700_100260796 3300005441 Bacteria 1248
60 Ga0070694_100075041 3300005444 Bacteria 2338
61 Ga0070694_100091260 3300005444 Bacteria 2138
62 Ga0070663_100005839 3300005455 Bacteria 7354
63 Ga0070678_100425264 3300005456 Bacteria 1159
64 Ga0070662_100027346 3300005457 Bacteria 3958
65 Ga0070662_100086750 3300005457 Bacteria 2341
66 Ga0068867_100121736 3300005459 Bacteria 2017
67 Ga0068867_100206034 3300005459 Bacteria 1577
68 Ga0068867_100440569 3300005459 Bacteria 1108
69 Ga0070685_10060642 3300005466 Bacteria 2213
70 Ga0070685_10154387 3300005466 Bacteria 1457
71 Ga0070706_100247409 3300005467 Bacteria 1665
72 Ga0070699_100001911 3300005518 Bacteria 18814
73 Ga0070699_100064864 3300005518 Bacteria 3168
74 Ga0070699_100512194 3300005518 Bacteria 1090
75 Ga0070699_100532253 3300005518 Bacteria 1069
76 Ga0070684_100000118 3300005535 Bacteria 51534
77 Ga0070684_100241394 3300005535 Bacteria 1651
78 Ga0070697_100064498 3300005536 Bacteria 2991
79 Ga0070697_100503819 3300005536 Bacteria 1059
80 Ga0068853_100616930 3300005539 Bacteria 1031
81 Ga0070672_100014343 3300005543 Bacteria 5615
82 Ga0070672_100042829 3300005543 Bacteria 3487
83 Ga0070672_100083709 3300005543 Bacteria 2561
84 Ga0070686_100015702 3300005544 Bacteria 4393
85 Ga0070686_100078379 3300005544 Bacteria 2181
86 Ga0070695_100002619 3300005545 Bacteria 10396
87 Ga0070695_100052293 3300005545 Bacteria 2624
88 Ga0070695_100066957 3300005545 Bacteria 2342
89 Ga0070695_100293717 3300005545 Bacteria 1199
90 Ga0070696_100139626 3300005546 Bacteria 1770
91 Ga0070696_100253795 3300005546 Bacteria 1331
92 Ga0070693_100143226 3300005547 Bacteria 1507
93 Ga0070665_100024097 3300005548 Bacteria 6128
94 Ga0070704_100034828 3300005549 Bacteria 3418
95 Ga0070704_100335809 3300005549 Bacteria 1271
96 Ga0070704_100458677 3300005549 Bacteria 1099
97 Ga0068855_100314214 3300005563 Bacteria 1733
98 Ga0070664_100003076 3300005564 Bacteria 13480
99 Ga0070664_100009768 3300005564 Bacteria 7775
100 Ga0070664_100546319 3300005564 Bacteria 1071
101 Ga0068854_100012955 3300005578 Bacteria 5463
102 Ga0068854_100080745 3300005578 Bacteria 2400
103 Ga0068854_100160110 3300005578 Bacteria 1742
104 Ga0070702_100323623 3300005615 Bacteria 1075
105 Ga0068852_100004653 3300005616 Bacteria 9729
106 Ga0068859_100028459 3300005617 Bacteria 5602
107 Ga0068859_100052529 3300005617 Bacteria 4098
108 Ga0068859_100262754 3300005617 Bacteria 1817
109 Ga0068859_100368962 3300005617 Bacteria 1531
110 Ga0068859_100575956 3300005617 Bacteria 1219
111 Ga0068864_100040059 3300005618 Bacteria 4007
112 Ga0068864_100061520 3300005618 Bacteria 3252
113 Ga0068864_100255038 3300005618 Bacteria 1630
114 Ga0068866_10035327 3300005718 Bacteria 2441
115 Ga0068866_10057642 3300005718 Bacteria 2003
116 Ga0068861_100098301 3300005719 Bacteria 2323
117 Ga0068861_100110068 3300005719 Bacteria 2206
118 Ga0068870_10090464 3300005840 Bacteria 1710
119 Ga0068870_10140383 3300005840 Bacteria 1413
120 Ga0068863_100193622 3300005841 Bacteria 1954
121 Ga0068863_100324397 3300005841 Bacteria 1496
122 Ga0068858_100001339 3300005842 Bacteria 25415
123 Ga0068858_100022553 3300005842 Bacteria 5874
124 Ga0068858_100024006 3300005842 Bacteria 5681
125 Ga0068858_100063200 3300005842 Bacteria 3425
126 Ga0068858_100173611 3300005842 Bacteria 2034
127 Ga0068860_100095623 3300005843 Bacteria 2832
128 Ga0068860_100167842 3300005843 Bacteria 2119
129 Ga0068862_100036814 3300005844 Bacteria 4148
130 Ga0068862_100057589 3300005844 Bacteria 3333
131 Ga0068862_100279164 3300005844 Bacteria 1530
132 Ga0068862_100515697 3300005844 Bacteria 1137
133 Ga0081539_10002472 3300005985 Bacteria 26008
134 Ga0075365_10010706 3300006038 Bacteria 5356
135 Ga0075365_10387450 3300006038 Bacteria 986
136 Ga0075368_10016039 3300006042 Bacteria 2787
137 Ga0075364_10005618 3300006051 Bacteria 7313
138 Ga0075362_10021024 3300006177 Bacteria 2733
139 Ga0075367_10003034 3300006178 Bacteria 7864
140 Ga0075367_10012459 3300006178 Bacteria 4536
141 Ga0075369_10050494 3300006186 Bacteria 1799
142 Ga0097621_100017176 3300006237 Bacteria 5490
143 Ga0097621_100020028 3300006237 Bacteria 5150
144 Ga0068871_100006234 3300006358 Bacteria 8412
145 Ga0068871_100078433 3300006358 Bacteria 2731
146 Ga0068871_100089461 3300006358 Bacteria 2563
147 Ga0075428_100002526 3300006844 Bacteria 19894
148 Ga0075428_100086411 3300006844 Bacteria 3421
149 Ga0075428_100118915 3300006844 Unclassified 2877
150 Ga0075428_100345041 3300006844 Bacteria 1598
151 Ga0075428_100398219 3300006844 Bacteria 1476
152 Ga0075430_100043155 3300006846 Bacteria 3811
153 Ga0075430_100063503 3300006846 Bacteria 3102
154 Ga0075430_100391684 3300006846 Bacteria 1146
155 Ga0075430_100438460 3300006846 Bacteria 1078
156 Ga0075431_100047525 3300006847 Bacteria 4425
157 Ga0075431_100054530 3300006847 Bacteria 4123
158 Ga0075431_100080674 3300006847 Bacteria 3359
159 Ga0075431_100086484 3300006847 Bacteria 3235
160 Ga0075431_100242503 3300006847 Bacteria 1833
161 Ga0075431_100266827 3300006847 Bacteria 1736
162 Ga0075431_100363834 3300006847 Bacteria 1452
163 Ga0075431_100627330 3300006847 Bacteria 1057
164 Ga0075433_10007372 3300006852 Bacteria 8731
165 Ga0075433_10027631 3300006852 Bacteria 4814
166 Ga0075433_10048564 3300006852 Bacteria 3691
167 Ga0075433_10049626 3300006852 Bacteria 3651
168 Ga0075433_10201615 3300006852 Bacteria 1769
169 Ga0075433_10218138 3300006852 Bacteria 1695
170 Ga0075434_100000442 3300006871 Bacteria 30797
171 Ga0075434_100006512 3300006871 Bacteria 10709
172 Ga0075434_100027189 3300006871 Bacteria 5614
173 Ga0075434_100044467 3300006871 Bacteria 4406
174 Ga0075434_100056784 3300006871 Bacteria 3891
175 Ga0075434_100088510 3300006871 Bacteria 3097
176 Ga0075434_100136547 3300006871 Bacteria 2472
177 Ga0075434_100353785 3300006871 Bacteria 1490
178 Ga0075434_100546153 3300006871 Bacteria 1178
179 Ga0075429_100022211 3300006880 Bacteria 5504
180 Ga0075429_100026684 3300006880 Bacteria 5016
181 Ga0075429_100050997 3300006880 Bacteria 3600
182 Ga0075429_100069409 3300006880 Bacteria 3068
183 Ga0075429_100311377 3300006880 Bacteria 1378
184 Ga0075429_100492455 3300006880 Bacteria 1074
185 Ga0075429_100597879 3300006880 Bacteria 967
186 Ga0068865_100001647 3300006881 Bacteria 13088
187 Ga0068865_100024364 3300006881 Bacteria 3969
188 Ga0068865_100243607 3300006881 Unclassified 1416
189 Ga0075436_100003799 3300006914 Bacteria 10358
190 Ga0075436_100006627 3300006914 Bacteria 7935
191 Ga0075436_100029047 3300006914 Bacteria 3803
192 Ga0097620_100028463 3300006931 Bacteria 5602
193 Ga0097620_100052528 3300006931 Bacteria 4098
194 Ga0097620_100262751 3300006931 Bacteria 1817
195 Ga0097620_100368989 3300006931 Bacteria 1531
196 Ga0097620_100575954 3300006931 Bacteria 1219
197 Ga0075435_100000028 3300007076 Bacteria 82360
198 Ga0075435_100002472 3300007076 Bacteria 12288
199 Ga0075435_100004691 3300007076 Bacteria 9426
200 Ga0075435_100016475 3300007076 Bacteria 5573
201 Ga0075435_100020765 3300007076 Bacteria 5039
202 Ga0075435_100063938 3300007076 Bacteria 2989
203 Ga0105240_10013601 3300009093 Bacteria 11164
204 Ga0111539_10000658 3300009094 Bacteria 44608
205 Ga0111539_10001500 3300009094 Bacteria 31168
206 Ga0111539_10005560 3300009094 Bacteria 16299
207 Ga0111539_10013669 3300009094 Bacteria 10142
208 Ga0111539_10032870 3300009094 Bacteria 6300
209 Ga0111539_10060573 3300009094 Bacteria 4485
210 Ga0111539_10097589 3300009094 Bacteria 3452
211 Ga0111539_10139365 3300009094 Bacteria 2840
212 Ga0111539_10160432 3300009094 Bacteria 2630
213 Ga0111539_10183182 3300009094 Unclassified 2446
214 Ga0105245_10007790 3300009098 Bacteria 9385
215 Ga0105245_10133642 3300009098 Bacteria 2329
216 Ga0105247_10006270 3300009101 Bacteria 7376
217 Ga0114129_10000222 3300009147 Bacteria 63223
218 Ga0114129_10004603 3300009147 Bacteria 19475
219 Ga0114129_10011346 3300009147 Bacteria 12691
220 Ga0114129_10013621 3300009147 Bacteria 11586
221 Ga0114129_10026556 3300009147 Bacteria 8201
222 Ga0114129_10098983 3300009147 Bacteria 4036
223 Ga0114129_10116549 3300009147 Bacteria 3681
224 Ga0114129_10133158 3300009147 Bacteria 3413
225 Ga0114129_10172494 3300009147 Bacteria 2948
226 Ga0114129_10317289 3300009147 Bacteria 2073
227 Ga0114129_10595152 3300009147 Bacteria 1434
228 Ga0105243_10063856 3300009148 Bacteria 2952
229 Ga0105243_10184519 3300009148 Bacteria 1817
230 Ga0105241_10339937 3300009174 Bacteria 1300
231 Ga0105242_10076503 3300009176 Bacteria 2790
232 Ga0105242_10116914 3300009176 Bacteria 2282
233 Ga0105242_10310944 3300009176 Bacteria 1442
234 Ga0105248_10003412 3300009177 Bacteria 17649
235 Ga0105248_10004667 3300009177 Bacteria 15171
236 Ga0105248_10031899 3300009177 Bacteria 5887
237 Ga0105248_10057331 3300009177 Bacteria 4372
238 Ga0105248_10123632 3300009177 Bacteria 2919
239 Ga0105248_10159088 3300009177 Bacteria 2548
240 Ga0105248_10222934 3300009177 Bacteria 2123
241 Ga0105248_10362703 3300009177 Bacteria 1631
242 Ga0105248_10608532 3300009177 Bacteria 1233
243 Ga0105238_10164285 3300009551 Bacteria 2196
244 Ga0105249_10003892 3300009553 Bacteria 12899
245 Ga0105249_10049242 3300009553 Bacteria 3842
246 Ga0105249_10320205 3300009553 Bacteria 1562
247 Ga0105239_10116744 3300010375 Bacteria 2962
248 Ga0163162_10051125 3300013306 Bacteria 4145
249 Ga0157375_10239778 3300013308 Bacteria 1973
250 Ga0163163_10159362 3300014325 Bacteria 2302
251 Ga0157380_10050793 3300014326 Bacteria 3276
252 Ga0157380_10091344 3300014326 Bacteria 2513
253 Ga0157380_10938339 3300014326 Bacteria 894
254 Ga0157377_10052174 3300014745 Bacteria 2308
255 Ga0157379_10025754 3300014968 Bacteria 5229
256 Ga0157376_10081540 3300014969 Bacteria 2778
257 Ga0207697_10019939 3300025315 Bacteria 2747
258 Ga0207697_10033503 3300025315 Bacteria 2102
259 Ga0207682_10017793 3300025893 Bacteria 2774
260 Ga0207642_10028547 3300025899 Bacteria 2299
261 Ga0207688_10100063 3300025901 Bacteria 1673
262 Ga0207688_10100265 3300025901 Bacteria 1671
263 Ga0207680_10131495 3300025903 Bacteria 1650
264 Ga0207647_10030589 3300025904 Bacteria 3471
265 Ga0207699_10046947 3300025906 Bacteria 2529
266 Ga0207645_10018602 3300025907 Bacteria 4565
267 Ga0207645_10042748 3300025907 Bacteria 2899
268 Ga0207645_10194467 3300025907 Bacteria 1334
269 Ga0207645_10205972 3300025907 Bacteria 1295
270 Ga0207643_10148329 3300025908 Bacteria 1405
271 Ga0207695_10030730 3300025913 Bacteria 5910
272 Ga0207663_10082084 3300025916 Bacteria 2113
273 Ga0207662_10002682 3300025918 Bacteria 8971
274 Ga0207649_10023799 3300025920 Bacteria 3551
275 Ga0207646_10167851 3300025922 Bacteria 1981
276 Ga0207681_10016900 3300025923 Bacteria 4575
277 Ga0207681_10023152 3300025923 Bacteria 3969
278 Ga0207681_10404311 3300025923 Bacteria 1103
279 Ga0207681_10491207 3300025923 Unclassified 1004
280 Ga0207650_10105922 3300025925 Bacteria 2171
281 Ga0207659_10003875 3300025926 Bacteria 9019
282 Ga0207659_10055364 3300025926 Bacteria 2837
283 Ga0207687_10381321 3300025927 Bacteria 1155
284 Ga0207644_10131710 3300025931 Bacteria 1915
285 Ga0207706_10013071 3300025933 Bacteria 7554
286 Ga0207706_10035954 3300025933 Bacteria 4401
287 Ga0207706_10061436 3300025933 Bacteria 3309
288 Ga0207706_10118307 3300025933 Bacteria 2330
289 Ga0207706_10165188 3300025933 Bacteria 1945
290 Ga0207706_10194507 3300025933 Bacteria 1779
291 Ga0207706_10712934 3300025933 Unclassified 856
292 Ga0207686_10085480 3300025934 Bacteria 2069
293 Ga0207686_10094806 3300025934 Bacteria 1979
294 Ga0207709_10060488 3300025935 Bacteria 2362
295 Ga0207709_10130962 3300025935 Bacteria 1710
296 Ga0207670_10225491 3300025936 Bacteria 1437
297 Ga0207670_10346494 3300025936 Bacteria 1175
298 Ga0207669_10010068 3300025937 Bacteria 4537
299 Ga0207669_10395012 3300025937 Bacteria 1081
300 Ga0207704_10008327 3300025938 Bacteria 4952
301 Ga0207704_10030530 3300025938 Bacteria 3022
302 Ga0207704_10106650 3300025938 Bacteria 1882
303 Ga0207691_10003895 3300025940 Bacteria 14495
304 Ga0207691_10079218 3300025940 Bacteria 2957
305 Ga0207711_10005354 3300025941 Bacteria 10869
306 Ga0207711_10045092 3300025941 Bacteria 3767
307 Ga0207711_10100591 3300025941 Bacteria 2557
308 Ga0207711_10256707 3300025941 Bacteria 1606
309 Ga0207711_10397998 3300025941 Bacteria 1279
310 Ga0207711_10635436 3300025941 Bacteria 996
311 Ga0207689_10077201 3300025942 Bacteria 2738
312 Ga0207689_10187647 3300025942 Unclassified 1705
313 Ga0207661_10062705 3300025944 Bacteria 3008
314 Ga0207661_10067051 3300025944 Bacteria 2917
315 Ga0207679_10024800 3300025945 Bacteria 4115
316 Ga0207679_10092344 3300025945 Bacteria 2345
317 Ga0207679_10417758 3300025945 Bacteria 1183
318 Ga0207679_10418771 3300025945 Bacteria 1182
319 Ga0207667_10246621 3300025949 Bacteria 1827
320 Ga0207651_10011147 3300025960 Bacteria 5018
321 Ga0207651_10068357 3300025960 Bacteria 2504
322 Ga0207651_10072008 3300025960 Bacteria 2452
323 Ga0207651_10219165 3300025960 Bacteria 1537
324 Ga0207712_10020648 3300025961 Bacteria 4317
325 Ga0207712_10046736 3300025961 Bacteria 3002
326 Ga0207668_10222031 3300025972 Bacteria 1518
327 Ga0207640_10005872 3300025981 Bacteria 6699
328 Ga0207658_10043446 3300025986 Bacteria 3267
329 Ga0207658_10265482 3300025986 Bacteria 1465
330 Ga0207677_10004893 3300026023 Bacteria 7232
331 Ga0207703_10015120 3300026035 Bacteria 6024
332 Ga0207703_10066380 3300026035 Bacteria 2968
333 Ga0207703_10086722 3300026035 Bacteria 2623
334 Ga0207703_10810884 3300026035 Bacteria 894
335 Ga0207678_10004205 3300026067 Bacteria 12920
336 Ga0207678_10357794 3300026067 Bacteria 1259
337 Ga0207708_10004404 3300026075 Bacteria 10377
338 Ga0207708_10051965 3300026075 Bacteria 3121
339 Ga0207708_10089200 3300026075 Bacteria 2376
340 Ga0207708_10210023 3300026075 Bacteria 1556
341 Ga0207641_10179700 3300026088 Bacteria 1937
342 Ga0207641_10426599 3300026088 Bacteria 1278
343 Ga0207648_10010521 3300026089 Bacteria 8763
344 Ga0207648_10104476 3300026089 Bacteria 2484
345 Ga0207648_10182794 3300026089 Bacteria 1856
346 Ga0207648_10319096 3300026089 Bacteria 1396
347 Ga0207648_10776303 3300026089 Bacteria 891
348 Ga0207676_10211056 3300026095 Bacteria 1722
349 Ga0207676_10230695 3300026095 Bacteria 1655
350 Ga0207674_10021362 3300026116 Bacteria 6972
351 Ga0207674_10476446 3300026116 Bacteria 1206
352 Ga0207675_100013533 3300026118 Bacteria 7615
353 Ga0207675_100018350 3300026118 Bacteria 6524
354 Ga0207675_100064039 3300026118 Bacteria 3436
355 Ga0207675_100185198 3300026118 Bacteria 1995
356 Ga0207683_10336145 3300026121 Bacteria 1385
357 Ga0207683_10368915 3300026121 Bacteria 1319
358 Ga0207428_10000974 3300027907 Bacteria 31750
359 Ga0207428_10011583 3300027907 Bacteria 7784
360 Ga0207428_10012342 3300027907 Bacteria 7510
361 Ga0207428_10014104 3300027907 Bacteria 6958
362 Ga0207428_10018622 3300027907 Bacteria 5928
363 Ga0207428_10019661 3300027907 Bacteria 5756
364 Ga0268266_10024783 3300028379 Bacteria 5105
365 Ga0268266_10221350 3300028379 Bacteria 1740
366 Ga0268266_10480764 3300028379 Bacteria 1184
367 Ga0268265_10102956 3300028380 Bacteria 2311
368 Ga0268265_10107321 3300028380 Bacteria 2270
369 Ga0268265_10112727 3300028380 Bacteria 2224
370 Ga0268265_10124664 3300028380 Bacteria 2129
371 Ga0268265_10336492 3300028380 Bacteria 1373
372 Ga0268265_10339875 3300028380 Bacteria 1366
373 Ga0268265_10451486 3300028380 Unclassified 1201
374 Ga0268264_10044428 3300028381 Bacteria 3686
375 Ga0268264_10147646 3300028381 Bacteria 2104
376 Ga0268264_10212120 3300028381 Bacteria 1778
377 Ga0268264_10602292 3300028381 Bacteria 1083
378 Ga0307408_100030910 3300031548 Bacteria 3723
379 Ga0307413_10035479 3300031824 Bacteria 2861
380 Ga0307410_10006976 3300031852 Bacteria 6149
381 Ga0307410_10044952 3300031852 Bacteria 2937
382 Ga0307406_10073467 3300031901 Bacteria 2249
383 Ga0307409_100294503 3300031995 Bacteria 1506
384 Ga0307416_100101957 3300032002 Bacteria 2501
385 Ga0307411_10007950 3300032005 Bacteria 5452
386 Ga0307411_10016668 3300032005 Bacteria 4163
387 Ga0373940_0083713 3300035088 Bacteria 947
388 Ga0373951_0016574 3300035091 Bacteria 1663
389 Ga0373939_0035782 3300035114 Bacteria 1465
390 Ga0373943_0246822 3300035170 Bacteria 1002
391 Ga0373924_0026726 3300035410 Bacteria 2291
392 Ga0373935_0264634 3300035692 Bacteria 1207
393 Ga0373937_0041166 3300036401 Bacteria 4215
394 Ga0373937_0597268 3300036401 Bacteria 1048
395 Ga0373925_0087726 3300037068 Bacteria 2375
396 Ga0395905_0189450 3300037471 Bacteria 1930
397 Ga0436365_1735656 3300039437 Bacteria 3680
398 Ga0451853_2213155 3300041512 Bacteria 949
399 Ga0439450_033970 3300042008 Unclassified 1158
400 Ga0439451_033132 3300042009 Bacteria 1039
401 Ga0439446_0021214 3300042156 Bacteria 1835
402 Ga0439464_0011191 3300042439 Bacteria 2374
403 Ga0450916_002513 3300042530 Bacteria 1953
404 Ga0495603_0044313 3300046455 Bacteria 2655
405 Ga0495629_0094765 3300046459 Bacteria 2083
406 Ga0495582_0384505 3300046473 Bacteria 809
407 Ga0495662_0191922 3300046476 Bacteria 1007
408 Ga0495618_0130048 3300046514 Bacteria 1611
409 Ga0495630_0073210 3300046517 Bacteria 2580
410 Ga0495630_0337563 3300046517 Bacteria 1153
411 Ga0495663_0039711 3300046525 Bacteria 1427
412 Ga0495640_0042789 3300046533 Bacteria 3158
413 Ga0495640_0085453 3300046533 Bacteria 2091
414 Ga0495598_0001715 3300046537 Bacteria 4394
415 Ga0495621_0007065 3300046539 Bacteria 3308
416 Ga0495621_0054615 3300046539 Unclassified 1436
417 Ga0495645_0026371 3300046543 Bacteria 4217
418 Ga0495645_0160490 3300046543 Bacteria 1555
419 Ga0495633_0012323 3300046558 Bacteria 4556
420 Ga0495656_0014608 3300046615 Bacteria 2947
421 Ga0495647_0057530 3300046681 Bacteria 1527
422 Ga0495658_0003728 3300046683 Bacteria 7538
423 Ga0495658_0045799 3300046683 Bacteria 2456
424 Ga0495658_0378625 3300046683 Bacteria 901
425 Ga0495613_0189772 3300046689 Bacteria 1453
426 Ga0495636_0035600 3300047318 Bacteria 2051
427 Ga0495674_0095687 3300047319 Bacteria 2532
428 Ga0495674_0185459 3300047319 Bacteria 1731
429 Ga0495680_0169585 3300047322 Bacteria 1581
430 Ga0495684_0049228 3300047471 Bacteria 3220
431 Ga0495684_0262045 3300047471 Bacteria 1254
432 Ga0495684_0338701 3300047471 Bacteria 1071
433 Ga0496101_0254478 3300048904 Bacteria 1369
434 Ga0496104_0002924 3300048907 Bacteria 14718
435 Ga0496104_0029285 3300048907 Bacteria 5107
436 Ga0496104_0364235 3300048907 Bacteria 1358
437 Ga0496105_0012817 3300048908 Bacteria 6646
438 Ga0496105_0017947 3300048908 Bacteria 5679
439 Ga0496108_0009260 3300048911 Bacteria 7967
440 Ga0496108_0016773 3300048911 Bacteria 5983
441 Ga0496109_0039693 3300048912 Bacteria 4261
442 Ga0496109_0174400 3300048912 Bacteria 2018
443 Ga0496109_0304509 3300048912 Bacteria 1503
444 Ga0496109_0438607 3300048912 Bacteria 1234
445 Ga0496110_0034118 3300048913 Bacteria 4406
446 Ga0496111_0025103 3300048914 Bacteria 4203
447 Ga0496112_0008607 3300048915 Bacteria 9144
448 Ga0496112_0028696 3300048915 Bacteria 5374
449 Ga0496112_0310427 3300048915 Bacteria 1522
450 Ga0496112_0470664 3300048915 Bacteria 1194
451 Ga0496113_0008067 3300048916 Bacteria 6834
452 Ga0496113_0009082 3300048916 Bacteria 6515
453 Ga0496113_0042799 3300048916 Bacteria 3348
454 Ga0501076_0393799 3300049592 Unclassified 1139
455 Ga0501253_013941 3300049683 Bacteria 1291
456 Ga0501080_0089009 3300049742 Bacteria 2868
457 nmdc:mga03683_3390_c1 3300050489 Bacteria 5134
458 nmdc:mga00v17_54352_c1 3300050491 Bacteria 2443
459 nmdc:mga00v17_6409_c1 3300050491 Bacteria 6243
460 nmdc:mga0yw44_169915_c1 3300050492 Bacteria 1431
461 nmdc:mga06z11_14809_c1 3300050494 Bacteria 3464
462 nmdc:mga06z11_24026_c1 3300050494 Bacteria 2870
463 nmdc:mga06z11_44870_c1 3300050494 Bacteria 2232
464 nmdc:mga07m45_3449_c1 3300050496 Bacteria 7624
465 nmdc:mga05p37_103122_c1 3300050507 Bacteria 3512
466 nmdc:mga05p37_11654_c1 3300050507 Bacteria 10478
467 nmdc:mga05p37_1742_c1 3300050507 Bacteria 25391
468 nmdc:mga05p37_21536_c1 3300050507 Bacteria 7810
469 nmdc:mga05p37_305997_c1 3300050507 Bacteria 1886
470 nmdc:mga05p37_320631_c1 3300050507 Bacteria 1834
471 nmdc:mga05p37_65691_c1 3300050507 Bacteria 4033
472 nmdc:mga05p37_801067_c1 3300050507 Bacteria 1031
473 nmdc:mga05p37_9254_c1 3300050507 Bacteria 11642
474 nmdc:mga09592_13417_c1 3300050508 Bacteria 6688
475 nmdc:mga09592_277699_c1 3300050508 Bacteria 1453
476 nmdc:mga09592_385919_c1 3300050508 Bacteria 1211
477 nmdc:mga0qj67_180795_c1 3300050509 Bacteria 1713
478 nmdc:mga0qj67_226314_c1 3300050509 Unclassified 1518
479 nmdc:mga0qj67_31376_c1 3300050509 Bacteria 4139
480 nmdc:mga0qj67_455276_c1 3300050509 Bacteria 1030
481 nmdc:mga0qj67_61128_c1 3300050509 Bacteria 2991
482 nmdc:mga0qj67_75053_c1 3300050509 Bacteria 2702
483 nmdc:mga06r32_139511_c1 3300050510 Unclassified 2400
484 nmdc:mga06r32_177451_c1 3300050510 Bacteria 2115
485 nmdc:mga06r32_230055_c1 3300050510 Bacteria 1842
486 nmdc:mga06r32_353333_c1 3300050510 Bacteria 1454
487 nmdc:mga06r32_354385_c1 3300050510 Bacteria 1452
488 nmdc:mga06r32_48197_c1 3300050510 Bacteria 4072
489 nmdc:mga06r32_80623_c1 3300050510 Bacteria 3168
490 nmdc:mga08y16_109365_c1 3300050511 Unclassified 2878
491 nmdc:mga08y16_111593_c1 3300050511 Bacteria 2846
492 nmdc:mga08y16_13369_c1 3300050511 Bacteria 8634
493 nmdc:mga08y16_17338_c1 3300050511 Bacteria 7582
494 nmdc:mga08y16_2338_c2 3300050511 Bacteria 7332
495 nmdc:mga08y16_300_c1 3300050511 Bacteria 44608
496 nmdc:mga08y16_311229_c1 3300050511 Bacteria 1622
497 nmdc:mga08y16_59300_c1 3300050511 Bacteria 3998
498 nmdc:mga08y16_89671_c1 3300050511 Bacteria 3204
499 nmdc:mga08y16_950_c1 3300050511 Bacteria 28167
500 nmdc:mga0n895_12004_c1 3300050512 Bacteria 7753
501 nmdc:mga0n895_167472_c1 3300050512 Bacteria 2229
502 nmdc:mga0n895_199833_c1 3300050512 Bacteria 2030
503 nmdc:mga0n895_21_c1 3300050512 Bacteria 93738
504 nmdc:mga0n895_314260_c1 3300050512 Bacteria 1588
505 nmdc:mga0n895_31485_c1 3300050512 Bacteria 5080
506 nmdc:mga0n895_61434_c1 3300050512 Bacteria 3709
507 nmdc:mga0rr50_2147_c1 3300050513 Bacteria 11026
508 nmdc:mga0rr50_28228_c1 3300050513 Bacteria 3942
509 nmdc:mga0rr50_8_c1 3300050513 Bacteria 271775
510 nmdc:mga0rr50_9924_c1 3300050513 Bacteria 6020
511 nmdc:mga08x19_30691_c1 3300050514 Bacteria 3378
512 nmdc:mga08x19_49932_c1 3300050514 Bacteria 2684
513 nmdc:mga08x19_949_c1 3300050514 Bacteria 18243
514 nmdc:mga0a205_143097_c1 3300050515 Bacteria 2291
515 nmdc:mga0a205_263616_c1 3300050515 Bacteria 1601
516 nmdc:mga0a205_53018_c1 3300050515 Bacteria 3914
517 nmdc:mga0a205_65002_c1 3300050515 Bacteria 3524
518 nmdc:mga0a205_6610_c1 3300050515 Bacteria 8887
519 nmdc:mga0a205_6837_c1 3300050515 Bacteria 10317
520 nmdc:mga0sz30_86180_c1 3300050516 Bacteria 1363
521 Ga0495619_0013778 3300053085 Bacteria 5101
522 Ga0500658_0100295 3300053134 Bacteria 1263
523 Ga0070697_100143949
524 Ga0065712_10005423
525 Ga0065712_10068319
526 Ga0065712_10070239
527 Ga0065715_10004564
528 Ga0065715_10020448
529 Ga0065715_10053854
530 Ga0065707_10087575
531 Ga0070676_10200207
532 Ga0070676_10209134
533 Ga0070676_10315684
534 Ga0070683_100014957
535 Ga0070690_100008824
536 Ga0070670_100270244
537 Ga0070666_10083288
538 Ga0070682_100086989
539 Ga0068868_100013803
540 Ga0068868_100302029
541 Ga0070660_100385069
542 Ga0070689_100031516
543 Ga0070687_100026429
544 Ga0070687_100133727
545 Ga0070661_100040847
546 Ga0070668_100019740
547 Ga0070668_100072160
548 Ga0070668_100263967
549 Ga0070669_100006274
550 Ga0070669_100053222
551 Ga0070669_100060153
552 Ga0070669_100087812
553 Ga0070669_100327884
554 Ga0070675_100019501
555 Ga0070675_100029165
556 Ga0070675_100107559
557 Ga0070675_100117355
558 Ga0070675_100182748
559 Ga0070675_100354308
560 Ga0070675_100517659
561 Ga0070674_100003279
562 Ga0070674_100005542
563 Ga0070674_100024411
564 Ga0070673_100006100
565 Ga0070673_100035907
566 Ga0070673_100095141
567 Ga0070673_100169877
568 Ga0070673_100472464
569 Ga0070688_100016656
570 Ga0070688_100026170
571 Ga0070688_100122287
572 Ga0070667_100230649
573 Ga0070703_10156983
574 Ga0070709_10115127
575 Ga0070701_10049401
576 Ga0070701_10094210
577 Ga0070701_10142366
578 Ga0070705_100033440
579 Ga0070705_100129000
580 Ga0070700_100040859
581 Ga0070700_100260796
582 Ga0070694_100075041
583 Ga0070694_100091260
584 Ga0070663_100005839
585 Ga0070678_100425264
586 Ga0070662_100027346
587 Ga0070662_100086750
588 Ga0068867_100121736
589 Ga0068867_100206034
590 Ga0068867_100440569
591 Ga0070685_10060642
592 Ga0070685_10154387
593 Ga0070706_100247409
594 Ga0070699_100001911
595 Ga0070699_100064864
596 Ga0070699_100512194
597 Ga0070699_100532253
598 Ga0070684_100000118
599 Ga0070684_100241394
600 Ga0070697_100064498
601 Ga0070697_100503819
602 Ga0068853_100616930
603 Ga0070672_100014343
604 Ga0070672_100042829
605 Ga0070672_100083709
606 Ga0070686_100015702
607 Ga0070686_100078379
608 Ga0070695_100002619
609 Ga0070695_100052293
610 Ga0070695_100066957
611 Ga0070695_100293717
612 Ga0070696_100139626
613 Ga0070696_100253795
614 Ga0070693_100143226
615 Ga0070665_100024097
616 Ga0070704_100034828
617 Ga0070704_100335809
618 Ga0070704_100458677
619 Ga0068855_100314214
620 Ga0070664_100003076
621 Ga0070664_100009768
622 Ga0070664_100546319
623 Ga0068854_100012955
624 Ga0068854_100080745
625 Ga0068854_100160110
626 Ga0070702_100323623
627 Ga0068852_100004653
628 Ga0068859_100028459
629 Ga0068859_100052529
630 Ga0068859_100262754
631 Ga0068859_100368962
632 Ga0068859_100575956
633 Ga0068864_100040059
634 Ga0068864_100061520
635 Ga0068864_100255038
636 Ga0068866_10035327
637 Ga0068866_10057642
638 Ga0068861_100098301
639 Ga0068861_100110068
640 Ga0068870_10090464
641 Ga0068870_10140383
642 Ga0068863_100193622
643 Ga0068863_100324397
644 Ga0068858_100001339
645 Ga0068858_100022553
646 Ga0068858_100024006
647 Ga0068858_100063200
648 Ga0068858_100173611
649 Ga0068860_100095623
650 Ga0068860_100167842
651 Ga0068862_100036814
652 Ga0068862_100057589
653 Ga0068862_100279164
654 Ga0068862_100515697
655 Ga0081539_10002472
656 Ga0075365_10010706
657 Ga0075365_10387450
658 Ga0075368_10016039
659 Ga0075364_10005618
660 Ga0075362_10021024
661 Ga0075367_10003034
662 Ga0075367_10012459
663 Ga0075369_10050494
664 Ga0097621_100017176
665 Ga0097621_100020028
666 Ga0068871_100006234
667 Ga0068871_100078433
668 Ga0068871_100089461
669 Ga0075428_100002526
670 Ga0075428_100086411
671 Ga0075428_100118915
672 Ga0075428_100345041
673 Ga0075428_100398219
674 Ga0075430_100043155
675 Ga0075430_100063503
676 Ga0075430_100391684
677 Ga0075430_100438460
678 Ga0075431_100047525
679 Ga0075431_100054530
680 Ga0075431_100080674
681 Ga0075431_100086484
682 Ga0075431_100242503
683 Ga0075431_100266827
684 Ga0075431_100363834
685 Ga0075431_100627330
686 Ga0075433_10007372
687 Ga0075433_10027631
688 Ga0075433_10048564
689 Ga0075433_10049626
690 Ga0075433_10201615
691 Ga0075433_10218138
692 Ga0075434_100000442
693 Ga0075434_100006512
694 Ga0075434_100027189
695 Ga0075434_100044467
696 Ga0075434_100056784
697 Ga0075434_100088510
698 Ga0075434_100136547
699 Ga0075434_100353785
700 Ga0075434_100546153
701 Ga0075429_100022211
702 Ga0075429_100026684
703 Ga0075429_100050997
704 Ga0075429_100069409
705 Ga0075429_100311377
706 Ga0075429_100492455
707 Ga0075429_100597879
708 Ga0068865_100001647
709 Ga0068865_100024364
710 Ga0068865_100243607
711 Ga0075436_100003799
712 Ga0075436_100006627
713 Ga0075436_100029047
714 Ga0097620_100028463
715 Ga0097620_100052528
716 Ga0097620_100262751
717 Ga0097620_100368989
718 Ga0097620_100575954
719 Ga0075435_100000028
720 Ga0075435_100002472
721 Ga0075435_100004691
722 Ga0075435_100016475
723 Ga0075435_100020765
724 Ga0075435_100063938
725 Ga0105240_10013601
726 Ga0111539_10000658
727 Ga0111539_10001500
728 Ga0111539_10005560
729 Ga0111539_10013669
730 Ga0111539_10032870
731 Ga0111539_10060573
732 Ga0111539_10097589
733 Ga0111539_10139365
734 Ga0111539_10160432
735 Ga0111539_10183182
736 Ga0105245_10007790
737 Ga0105245_10133642
738 Ga0105247_10006270
739 Ga0114129_10000222
740 Ga0114129_10004603
741 Ga0114129_10011346
742 Ga0114129_10013621
743 Ga0114129_10026556
744 Ga0114129_10098983
745 Ga0114129_10116549
746 Ga0114129_10133158
747 Ga0114129_10172494
748 Ga0114129_10317289
749 Ga0114129_10595152
750 Ga0105243_10063856
751 Ga0105243_10184519
752 Ga0105241_10339937
753 Ga0105242_10076503
754 Ga0105242_10116914
755 Ga0105242_10310944
756 Ga0105248_10003412
757 Ga0105248_10004667
758 Ga0105248_10031899
759 Ga0105248_10057331
760 Ga0105248_10123632
761 Ga0105248_10159088
762 Ga0105248_10222934
763 Ga0105248_10362703
764 Ga0105248_10608532
765 Ga0105238_10164285
766 Ga0105249_10003892
767 Ga0105249_10049242
768 Ga0105249_10320205
769 Ga0105239_10116744
770 Ga0163162_10051125
771 Ga0157375_10239778
772 Ga0163163_10159362
773 Ga0157380_10050793
774 Ga0157380_10091344
775 Ga0157380_10938339
776 Ga0157377_10052174
777 Ga0157379_10025754
778 Ga0157376_10081540
779 Ga0207697_10019939
780 Ga0207697_10033503
781 Ga0207682_10017793
782 Ga0207642_10028547
783 Ga0207688_10100063
784 Ga0207688_10100265
785 Ga0207680_10131495
786 Ga0207647_10030589
787 Ga0207699_10046947
788 Ga0207645_10018602
789 Ga0207645_10042748
790 Ga0207645_10194467
791 Ga0207645_10205972
792 Ga0207643_10148329
793 Ga0207695_10030730
794 Ga0207663_10082084
795 Ga0207662_10002682
796 Ga0207649_10023799
797 Ga0207646_10167851
798 Ga0207681_10016900
799 Ga0207681_10023152
800 Ga0207681_10404311
801 Ga0207681_10491207
802 Ga0207650_10105922
803 Ga0207659_10003875
804 Ga0207659_10055364
805 Ga0207687_10381321
806 Ga0207644_10131710
807 Ga0207706_10013071
808 Ga0207706_10035954
809 Ga0207706_10061436
810 Ga0207706_10118307
811 Ga0207706_10165188
812 Ga0207706_10194507
813 Ga0207706_10712934
814 Ga0207686_10085480
815 Ga0207686_10094806
816 Ga0207709_10060488
817 Ga0207709_10130962
818 Ga0207670_10225491
819 Ga0207670_10346494
820 Ga0207669_10010068
821 Ga0207669_10395012
822 Ga0207704_10008327
823 Ga0207704_10030530
824 Ga0207704_10106650
825 Ga0207691_10003895
826 Ga0207691_10079218
827 Ga0207711_10005354
828 Ga0207711_10045092
829 Ga0207711_10100591
830 Ga0207711_10256707
831 Ga0207711_10397998
832 Ga0207711_10635436
833 Ga0207689_10077201
834 Ga0207689_10187647
835 Ga0207661_10062705
836 Ga0207661_10067051
837 Ga0207679_10024800
838 Ga0207679_10092344
839 Ga0207679_10417758
840 Ga0207679_10418771
841 Ga0207667_10246621
842 Ga0207651_10011147
843 Ga0207651_10068357
844 Ga0207651_10072008
845 Ga0207651_10219165
846 Ga0207712_10020648
847 Ga0207712_10046736
848 Ga0207668_10222031
849 Ga0207640_10005872
850 Ga0207658_10043446
851 Ga0207658_10265482
852 Ga0207677_10004893
853 Ga0207703_10015120
854 Ga0207703_10066380
855 Ga0207703_10086722
856 Ga0207703_10810884
857 Ga0207678_10004205
858 Ga0207678_10357794
859 Ga0207708_10004404
860 Ga0207708_10051965
861 Ga0207708_10089200
862 Ga0207708_10210023
863 Ga0207641_10179700
864 Ga0207641_10426599
865 Ga0207648_10010521
866 Ga0207648_10104476
867 Ga0207648_10182794
868 Ga0207648_10319096
869 Ga0207648_10776303
870 Ga0207676_10211056
871 Ga0207676_10230695
872 Ga0207674_10021362
873 Ga0207674_10476446
874 Ga0207675_100013533
875 Ga0207675_100018350
876 Ga0207675_100064039
877 Ga0207675_100185198
878 Ga0207683_10336145
879 Ga0207683_10368915
880 Ga0207428_10000974
881 Ga0207428_10011583
882 Ga0207428_10012342
883 Ga0207428_10014104
884 Ga0207428_10018622
885 Ga0207428_10019661
886 Ga0268266_10024783
887 Ga0268266_10221350
888 Ga0268266_10480764
889 Ga0268265_10102956
890 Ga0268265_10107321
891 Ga0268265_10112727
892 Ga0268265_10124664
893 Ga0268265_10336492
894 Ga0268265_10339875
895 Ga0268265_10451486
896 Ga0268264_10044428
897 Ga0268264_10147646
898 Ga0268264_10212120
899 Ga0268264_10602292
900 Ga0307408_100030910
901 Ga0307413_10035479
902 Ga0307410_10006976
903 Ga0307410_10044952
904 Ga0307406_10073467
905 Ga0307409_100294503
906 Ga0307416_100101957
907 Ga0307411_10007950
908 Ga0307411_10016668
909 Ga0373940_0083713
910 Ga0373951_0016574
911 Ga0373939_0035782
912 Ga0373943_0246822
913 Ga0373924_0026726
914 Ga0373935_0264634
915 Ga0373937_0041166
916 Ga0373937_0597268
917 Ga0373925_0087726
918 Ga0395905_0189450
919 Ga0436365_1735656
920 Ga0451853_2213155
921 Ga0439450_033970
922 Ga0439451_033132
923 Ga0439446_0021214
924 Ga0439464_0011191
925 Ga0450916_002513
926 Ga0495603_0044313
927 Ga0495629_0094765
928 Ga0495582_0384505
929 Ga0495662_0191922
930 Ga0495618_0130048
931 Ga0495630_0073210
932 Ga0495630_0337563
933 Ga0495663_0039711
934 Ga0495640_0042789
935 Ga0495640_0085453
936 Ga0495598_0001715
937 Ga0495621_0007065
938 Ga0495621_0054615
939 Ga0495645_0026371
940 Ga0495645_0160490
941 Ga0495633_0012323
942 Ga0495656_0014608
943 Ga0495647_0057530
944 Ga0495658_0003728
945 Ga0495658_0045799
946 Ga0495658_0378625
947 Ga0495613_0189772
948 Ga0495636_0035600
949 Ga0495674_0095687
950 Ga0495674_0185459
951 Ga0495680_0169585
952 Ga0495684_0049228
953 Ga0495684_0262045
954 Ga0495684_0338701
955 Ga0496101_0254478
956 Ga0496104_0002924
957 Ga0496104_0029285
958 Ga0496104_0364235
959 Ga0496105_0012817
960 Ga0496105_0017947
961 Ga0496108_0009260
962 Ga0496108_0016773
963 Ga0496109_0039693
964 Ga0496109_0174400
965 Ga0496109_0304509
966 Ga0496109_0438607
967 Ga0496110_0034118
968 Ga0496111_0025103
969 Ga0496112_0008607
970 Ga0496112_0028696
971 Ga0496112_0310427
972 Ga0496112_0470664
973 Ga0496113_0008067
974 Ga0496113_0009082
975 Ga0496113_0042799
976 Ga0501076_0393799
977 Ga0501253_013941
978 Ga0501080_0089009
979 nmdc:mga03683_3390_c1
980 nmdc:mga00v17_54352_c1
981 nmdc:mga00v17_6409_c1
982 nmdc:mga0yw44_169915_c1
983 nmdc:mga06z11_14809_c1
984 nmdc:mga06z11_24026_c1
985 nmdc:mga06z11_44870_c1
986 nmdc:mga07m45_3449_c1
987 nmdc:mga05p37_103122_c1
988 nmdc:mga05p37_11654_c1
989 nmdc:mga05p37_1742_c1
990 nmdc:mga05p37_21536_c1
991 nmdc:mga05p37_305997_c1
992 nmdc:mga05p37_320631_c1
993 nmdc:mga05p37_65691_c1
994 nmdc:mga05p37_801067_c1
995 nmdc:mga05p37_9254_c1
996 nmdc:mga09592_13417_c1
997 nmdc:mga09592_277699_c1
998 nmdc:mga09592_385919_c1
999 nmdc:mga0qj67_180795_c1
1000 nmdc:mga0qj67_226314_c1
1001 nmdc:mga0qj67_31376_c1
1002 nmdc:mga0qj67_455276_c1
1003 nmdc:mga0qj67_61128_c1
1004 nmdc:mga0qj67_75053_c1
1005 nmdc:mga06r32_139511_c1
1006 nmdc:mga06r32_177451_c1
1007 nmdc:mga06r32_230055_c1
1008 nmdc:mga06r32_353333_c1
1009 nmdc:mga06r32_354385_c1
1010 nmdc:mga06r32_48197_c1
1011 nmdc:mga06r32_80623_c1
1012 nmdc:mga08y16_109365_c1
1013 nmdc:mga08y16_111593_c1
1014 nmdc:mga08y16_13369_c1
1015 nmdc:mga08y16_17338_c1
1016 nmdc:mga08y16_2338_c2
1017 nmdc:mga08y16_300_c1
1018 nmdc:mga08y16_311229_c1
1019 nmdc:mga08y16_59300_c1
1020 nmdc:mga08y16_89671_c1
1021 nmdc:mga08y16_950_c1
1022 nmdc:mga0n895_12004_c1
1023 nmdc:mga0n895_167472_c1
1024 nmdc:mga0n895_199833_c1
1025 nmdc:mga0n895_21_c1
1026 nmdc:mga0n895_314260_c1
1027 nmdc:mga0n895_31485_c1
1028 nmdc:mga0n895_61434_c1
1029 nmdc:mga0rr50_2147_c1
1030 nmdc:mga0rr50_28228_c1
1031 nmdc:mga0rr50_8_c1
1032 nmdc:mga0rr50_9924_c1
1033 nmdc:mga08x19_30691_c1
1034 nmdc:mga08x19_49932_c1
1035 nmdc:mga08x19_949_c1
1036 nmdc:mga0a205_143097_c1
1037 nmdc:mga0a205_263616_c1
1038 nmdc:mga0a205_53018_c1
1039 nmdc:mga0a205_65002_c1
1040 nmdc:mga0a205_6610_c1
1041 nmdc:mga0a205_6837_c1
1042 nmdc:mga0sz30_86180_c1
1043 Ga0495619_0013778
1044 Ga0500658_0100295

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

105

276

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.7893 59 254
7mc0-assembly1.cif.gz_B inward facing conformation of the metni methionine abc transporter 0.7463 53 256
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.7274 59 254
7ahh-assembly1.cif.gz_A opua inhibited inward-facing, sbd docked 0.709 61 254
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.706 65 256
ID Description Score Start End Superfamily
af_Q57856_64_258_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8292 68 253 1.10.3720.10
af_P75851_53_247_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8288 68 254 1.10.3720.10
af_Q2FVG9_10_202_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8236 68 254 1.10.3720.10
af_Q47539_71_268_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8002 73 256 1.10.3720.10
af_Q2FVG9_10_202_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7971 68 254 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A3A4JTK6-F1-model_v4 ABC transporter permease 0.9106 2 260 GO:0005886
GO:0055085
AF-A0A3A4PS04-F1-model_v4 ABC transporter permease 0.9103 5 260 GO:0005886
GO:0055085
AF-A0A7Y5W1W6-F1-model_v4 ABC transporter permease subunit 0.9086 5 259 GO:0005886
GO:0055085
AF-A0A3L7NLT9-F1-model_v4 ABC transporter permease 0.9028 6 260 GO:0005886
GO:0055085
AF-A0A5C5Z5Y9-F1-model_v4 Bicarbonate transport system permease protein CmpB 0.9023 5 259 GO:0005886
GO:0055085

Map