F458764

General Info

Members Datasets Scaffolds Average Seq Length
521 317 1042 155

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_1423069_c1|nmdc:mga05p37_1423069_c1_71_610
Length 179
Sequence VLIIGAREQRARCRIDPSRSSSTGDCHGRNPPAASALHPRNRDPEGPHGWNTRDPQRVALAYTIDSRWRNRAEFLHGRAEIEAFLTRKWQRELDYRLIKEIWAFRENRIAVRFAYEWRDDSGSWFRSYGNENWEFDEHGLMRRRIASINDLPIKESERKYHWPLGRRPDDHASLSDLGL

Samples

Sample ID Description Type Environment
1 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
74 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
75 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
86 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
87 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
88 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
133 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
134 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
135 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
136 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
137 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
138 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
139 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
140 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
141 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
142 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
143 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
146 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
147 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
148 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
149 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
150 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
151 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
152 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
154 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
155 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
156 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
157 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
158 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
159 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
160 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
161 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
162 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
163 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
166 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
167 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
171 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
172 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
180 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
181 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
182 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
183 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
184 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
185 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
186 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
189 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
190 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
191 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
192 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
193 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
194 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
195 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
196 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
197 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
198 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
199 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
200 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
201 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
202 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
203 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
204 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
205 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
206 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
207 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
208 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
209 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
210 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
211 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
212 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
213 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
214 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
215 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
216 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
217 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
218 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
219 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
220 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
221 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
222 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
223 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
224 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
225 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
226 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
227 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
228 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
229 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
230 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
231 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
232 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
233 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
234 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
235 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
236 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
237 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
238 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
239 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
240 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
241 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
242 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
243 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
244 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
245 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
246 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
247 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
248 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
249 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
250 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
251 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
252 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
253 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
254 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
255 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
256 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
257 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
258 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
259 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
260 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
261 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
262 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
263 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
264 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
265 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
266 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
267 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
268 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
269 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
270 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
271 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
272 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
273 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
274 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
275 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
276 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
277 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
278 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
279 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
280 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
281 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
282 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
283 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
284 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
285 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
286 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
287 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
288 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
289 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
290 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
291 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
292 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
293 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
294 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
295 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
296 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
297 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
298 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
299 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
300 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
301 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
302 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
303 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
304 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
305 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
306 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
307 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
308 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
309 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
310 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
311 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
312 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
313 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
314 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
315 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
316 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
317 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.82
Metatranscriptomes 0
Isolates 5.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.07
Nodule 4.8
Rhizoplane 7.29
Rhizosphere 82.53
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga05p37_1423069_c1 3300050507 Bacteria 696
2 Ga0070690_100041594 3300005330 Bacteria 2910
3 Ga0070680_100129447 3300005336 Bacteria 2110
4 Ga0070680_100779504 3300005336 Bacteria 824
5 Ga0068868_100234699 3300005338 Bacteria 1539
6 Ga0070689_100074946 3300005340 Bacteria 2648
7 Ga0070691_10270390 3300005341 Bacteria 918
8 Ga0070661_100090158 3300005344 Bacteria 2270
9 Ga0070661_100252641 3300005344 Bacteria 1361
10 Ga0070671_100043213 3300005355 Bacteria 3745
11 Ga0070688_100054887 3300005365 Bacteria 2497
12 Ga0070659_100286334 3300005366 Bacteria 1371
13 Ga0070667_100033611 3300005367 Bacteria 4288
14 Ga0070709_10488544 3300005434 Bacteria 933
15 Ga0070714_100183444 3300005435 Bacteria 1905
16 Ga0070714_100578235 3300005435 Bacteria 1077
17 Ga0070714_101273310 3300005435 Bacteria 718
18 Ga0070713_100032133 3300005436 Bacteria 4189
19 Ga0070713_100264286 3300005436 Bacteria 1573
20 Ga0070713_100358772 3300005436 Bacteria 1354
21 Ga0070713_100790168 3300005436 Bacteria 909
22 Ga0070710_10013600 3300005437 Bacteria 4080
23 Ga0070710_10430271 3300005437 Bacteria 890
24 Ga0070710_10687840 3300005437 Bacteria 721
25 Ga0070701_10197538 3300005438 Bacteria 1187
26 Ga0070711_100270162 3300005439 Bacteria 1341
27 Ga0070711_100668000 3300005439 Bacteria 872
28 Ga0070711_100978600 3300005439 Bacteria 725
29 Ga0070705_100439506 3300005440 Bacteria 976
30 Ga0070678_100293847 3300005456 Bacteria 1378
31 Ga0068867_100112890 3300005459 Bacteria 2090
32 Ga0070706_100091594 3300005467 Bacteria 2820
33 Ga0070707_100438872 3300005468 Bacteria 1266
34 Ga0070698_100061631 3300005471 Bacteria 3785
35 Ga0070684_100081048 3300005535 Bacteria 2871
36 Ga0070697_100030504 3300005536 Bacteria 4332
37 Ga0070697_100734827 3300005536 Bacteria 872
38 Ga0070686_100196519 3300005544 Bacteria 1443
39 Ga0070686_100449087 3300005544 Bacteria 991
40 Ga0070693_100053869 3300005547 Bacteria 2311
41 Ga0068855_100212478 3300005563 Bacteria 2173
42 Ga0070664_100089703 3300005564 Bacteria 2660
43 Ga0070664_100113712 3300005564 Bacteria 2364
44 Ga0070664_100415981 3300005564 Bacteria 1231
45 Ga0068856_100824879 3300005614 Bacteria 947
46 Ga0070702_100050058 3300005615 Bacteria 2385
47 Ga0068859_100633873 3300005617 Bacteria 1161
48 Ga0068866_10208661 3300005718 Bacteria 1171
49 Ga0068863_101520900 3300005841 Bacteria 678
50 Ga0068858_100326557 3300005842 Bacteria 1467
51 Ga0068860_100149239 3300005843 Bacteria 2250
52 Ga0068860_100885824 3300005843 Bacteria 908
53 Ga0068862_100229199 3300005844 Bacteria 1685
54 Ga0081538_10038006 3300005981 Bacteria 3112
55 Ga0081540_1017646 3300005983 Bacteria 4409
56 Ga0070717_10020276 3300006028 Bacteria 5225
57 Ga0070717_10385274 3300006028 Bacteria 1257
58 Ga0070717_10590000 3300006028 Bacteria 1008
59 Ga0075363_100021933 3300006048 Bacteria 3224
60 Ga0075364_10046354 3300006051 Bacteria 2830
61 Ga0075364_10348651 3300006051 Bacteria 1009
62 Ga0075432_10108647 3300006058 Bacteria 1032
63 Ga0070716_101120446 3300006173 Bacteria 628
64 Ga0070712_100088610 3300006175 Bacteria 2261
65 Ga0070712_100583817 3300006175 Bacteria 944
66 Ga0075367_10023461 3300006178 Bacteria 3472
67 Ga0075367_10374040 3300006178 Bacteria 900
68 Ga0075369_10020483 3300006186 Bacteria 2708
69 Ga0097621_100431416 3300006237 Bacteria 1184
70 Ga0097621_100495471 3300006237 Bacteria 1106
71 Ga0068871_100633848 3300006358 Bacteria 974
72 Ga0068871_101070887 3300006358 Bacteria 753
73 Ga0075428_100004238 3300006844 Bacteria 15793
74 Ga0075428_100231560 3300006844 Bacteria 1994
75 Ga0075430_100209212 3300006846 Bacteria 1619
76 Ga0075431_100097636 3300006847 Bacteria 3034
77 Ga0075433_10029278 3300006852 Bacteria 4690
78 Ga0075433_10177982 3300006852 Bacteria 1892
79 Ga0075434_100248159 3300006871 Bacteria 1799
80 Ga0075434_100380352 3300006871 Bacteria 1433
81 Ga0075434_100450370 3300006871 Bacteria 1308
82 Ga0075434_100603790 3300006871 Bacteria 1116
83 Ga0075429_100206363 3300006880 Bacteria 1721
84 Ga0075429_100361555 3300006880 Bacteria 1271
85 Ga0075429_100370129 3300006880 Bacteria 1254
86 Ga0068865_101194824 3300006881 Bacteria 673
87 Ga0075436_100005314 3300006914 Bacteria 8856
88 Ga0097620_100633959 3300006931 Bacteria 1161
89 Ga0075435_100101884 3300007076 Bacteria 2379
90 Ga0075435_100235924 3300007076 Bacteria 1554
91 Ga0075435_100600948 3300007076 Bacteria 954
92 Ga0075435_100978355 3300007076 Bacteria 738
93 Ga0111539_10026682 3300009094 Bacteria 7060
94 Ga0111539_10127002 3300009094 Bacteria 2987
95 Ga0111539_10601109 3300009094 Bacteria 1281
96 Ga0105245_10043465 3300009098 Bacteria 4007
97 Ga0105245_10770411 3300009098 Bacteria 999
98 Ga0105247_10660929 3300009101 Bacteria 782
99 Ga0105247_10675122 3300009101 Bacteria 775
100 Ga0114129_10126850 3300009147 Bacteria 3508
101 Ga0114129_10212440 3300009147 Bacteria 2615
102 Ga0114129_11397714 3300009147 Bacteria 864
103 Ga0105243_10468721 3300009148 Bacteria 1186
104 Ga0105241_10003177 3300009174 Bacteria 12227
105 Ga0105241_10326727 3300009174 Bacteria 1324
106 Ga0105241_10491688 3300009174 Bacteria 1092
107 Ga0105242_10252277 3300009176 Bacteria 1590
108 Ga0105248_10025659 3300009177 Bacteria 6554
109 Ga0105237_10096914 3300009545 Bacteria 2940
110 Ga0105237_11293777 3300009545 Bacteria 735
111 Ga0105249_10418501 3300009553 Bacteria 1373
112 Ga0099796_10012500 3300010159 Bacteria 2400
113 Ga0099796_10090790 3300010159 Bacteria 1135
114 Ga0105239_10586797 3300010375 Bacteria 1271
115 Ga0105246_10101643 3300011119 Bacteria 2094
116 Ga0157341_1001833 3300012494 Bacteria 1335
117 Ga0157347_1015650 3300012502 Bacteria 847
118 Ga0157342_1004846 3300012507 Bacteria 1214
119 Ga0157373_11096122 3300013100 Bacteria 597
120 Ga0157370_10088991 3300013104 Bacteria 2900
121 Ga0157370_10529853 3300013104 Bacteria 1081
122 Ga0157374_10085108 3300013296 Bacteria 3006
123 Ga0157374_10307818 3300013296 Bacteria 1568
124 Ga0157374_10598820 3300013296 Bacteria 1112
125 Ga0157374_10997814 3300013296 Bacteria 856
126 Ga0157378_10113874 3300013297 Bacteria 2484
127 Ga0163162_10152949 3300013306 Bacteria 2426
128 Ga0163162_10196697 3300013306 Bacteria 2145
129 Ga0163162_10677444 3300013306 Bacteria 1154
130 Ga0157375_10000051 3300013308 Bacteria 130143
131 Ga0157375_10228574 3300013308 Bacteria 2019
132 Ga0157375_11186067 3300013308 Bacteria 895
133 Ga0157379_10368073 3300014968 Bacteria 1318
134 Ga0157376_10063007 3300014969 Bacteria 3122
135 Ga0157376_10392578 3300014969 Bacteria 1339
136 Ga0157376_10404217 3300014969 Bacteria 1321
137 Ga0157376_11025019 3300014969 Bacteria 849
138 Ga0163161_11598266 3300017792 Bacteria 575
139 Ga0213873_10044928 3300021358 Bacteria 1150
140 Ga0213876_10027223 3300021384 Bacteria 3017
141 Ga0213875_10193935 3300021388 Bacteria 955
142 Ga0209233_1000034 3300025261 Bacteria 578898
143 Ga0207697_10453785 3300025315 Bacteria 568
144 Ga0207692_10292170 3300025898 Bacteria 989
145 Ga0207692_10416694 3300025898 Bacteria 840
146 Ga0207642_10011650 3300025899 Bacteria 3146
147 Ga0207710_10099828 3300025900 Bacteria 1368
148 Ga0207685_10495200 3300025905 Bacteria 642
149 Ga0207685_10597521 3300025905 Bacteria 592
150 Ga0207699_10403952 3300025906 Bacteria 973
151 Ga0207684_10105666 3300025910 Bacteria 2408
152 Ga0207654_10025762 3300025911 Bacteria 3177
153 Ga0207654_10703802 3300025911 Bacteria 726
154 Ga0207707_10463928 3300025912 Bacteria 1083
155 Ga0207695_11323160 3300025913 Bacteria 601
156 Ga0207693_10089068 3300025915 Bacteria 2419
157 Ga0207693_10513466 3300025915 Bacteria 935
158 Ga0207693_10581867 3300025915 Bacteria 872
159 Ga0207693_10586351 3300025915 Bacteria 868
160 Ga0207663_10095865 3300025916 Bacteria 1980
161 Ga0207663_10260357 3300025916 Bacteria 1281
162 Ga0207663_10631758 3300025916 Bacteria 844
163 Ga0207660_10171804 3300025917 Bacteria 1678
164 Ga0207657_10612604 3300025919 Bacteria 849
165 Ga0207649_10466614 3300025920 Bacteria 955
166 Ga0207646_11051296 3300025922 Bacteria 718
167 Ga0207650_10138563 3300025925 Bacteria 1911
168 Ga0207687_10014391 3300025927 Bacteria 5176
169 Ga0207687_10121617 3300025927 Bacteria 1953
170 Ga0207687_11189029 3300025927 Bacteria 655
171 Ga0207700_10050151 3300025928 Bacteria 3109
172 Ga0207700_10515403 3300025928 Bacteria 1059
173 Ga0207700_10583300 3300025928 Bacteria 994
174 Ga0207700_11112700 3300025928 Bacteria 706
175 Ga0207700_11317023 3300025928 Bacteria 643
176 Ga0207664_10364729 3300025929 Bacteria 1280
177 Ga0207664_10485151 3300025929 Bacteria 1106
178 Ga0207644_10083891 3300025931 Bacteria 2361
179 Ga0207706_10051759 3300025933 Bacteria 3626
180 Ga0207706_10883841 3300025933 Bacteria 755
181 Ga0207686_10022044 3300025934 Bacteria 3663
182 Ga0207670_10056323 3300025936 Bacteria 2661
183 Ga0207704_11068854 3300025938 Bacteria 685
184 Ga0207665_10089857 3300025939 Bacteria 2128
185 Ga0207665_10549806 3300025939 Bacteria 897
186 Ga0207711_10040103 3300025941 Bacteria 3983
187 Ga0207711_10049399 3300025941 Bacteria 3602
188 Ga0207689_10028959 3300025942 Bacteria 4629
189 Ga0207679_10284683 3300025945 Bacteria 1419
190 Ga0207668_11753392 3300025972 Bacteria 560
191 Ga0207658_10016143 3300025986 Bacteria 5131
192 Ga0207658_11087656 3300025986 Bacteria 730
193 Ga0207677_10030992 3300026023 Bacteria 3421
194 Ga0207677_10038647 3300026023 Bacteria 3131
195 Ga0207703_10792531 3300026035 Bacteria 904
196 Ga0207703_11167517 3300026035 Bacteria 740
197 Ga0207702_10726075 3300026078 Bacteria 980
198 Ga0207702_11455564 3300026078 Bacteria 679
199 Ga0207641_10070454 3300026088 Bacteria 3004
200 Ga0207641_11295345 3300026088 Bacteria 729
201 Ga0207648_10048153 3300026089 Bacteria 3733
202 Ga0207676_10127463 3300026095 Bacteria 2158
203 Ga0207683_10001084 3300026121 Bacteria 24821
204 Ga0207698_10970364 3300026142 Bacteria 860
205 Ga0207428_10048538 3300027907 Bacteria 3405
206 Ga0207428_10057373 3300027907 Bacteria 3091
207 Ga0268266_10203403 3300028379 Bacteria 1813
208 Ga0268265_10226184 3300028380 Bacteria 1641
209 Ga0268264_10170997 3300028381 Bacteria 1965
210 Ga0268264_10231948 3300028381 Bacteria 1705
211 Ga0268264_10252298 3300028381 Bacteria 1639
212 Ga0265334_10001175 3300028573 Bacteria 12831
213 Ga0265334_10108184 3300028573 Bacteria 1001
214 Ga0265338_10664591 3300028800 Bacteria 721
215 Ga0265328_10011863 3300031239 Bacteria 3475
216 Ga0265329_10100356 3300031242 Bacteria 921
217 Ga0265340_10032671 3300031247 Bacteria 2597
218 Ga0265339_10020216 3300031249 Bacteria 3893
219 Ga0265339_10426308 3300031249 Bacteria 618
220 Ga0265331_10018752 3300031250 Bacteria 3580
221 Ga0265316_10112613 3300031344 Bacteria 2059
222 Ga0265316_10535202 3300031344 Bacteria 835
223 Ga0265316_10858724 3300031344 Bacteria 635
224 Ga0265313_10009909 3300031595 Bacteria 6119
225 Ga0307508_10856291 3300031616 Bacteria 531
226 Ga0265314_10306240 3300031711 Bacteria 889
227 Ga0265342_10035864 3300031712 Bacteria 3032
228 Ga0307409_100199687 3300031995 Bacteria 1788
229 Ga0373938_0062991 3300034957 Bacteria 871
230 Ga0373926_0021299 3300035083 Bacteria 2244
231 Ga0373934_0419746 3300035086 Bacteria 560
232 Ga0373940_0141366 3300035088 Bacteria 761
233 Ga0373944_0009516 3300035089 Bacteria 2636
234 Ga0373949_0069835 3300035090 Bacteria 918
235 Ga0373952_0003784 3300035092 Bacteria 2737
236 Ga0373923_0016401 3300035111 Bacteria 2814
237 Ga0373923_0133436 3300035111 Bacteria 1118
238 Ga0373923_0217702 3300035111 Bacteria 887
239 Ga0373932_0004914 3300035112 Bacteria 3148
240 Ga0373936_0042572 3300035113 Bacteria 1823
241 Ga0373936_0267737 3300035113 Bacteria 766
242 Ga0373939_0002405 3300035114 Bacteria 4410
243 Ga0373941_0127245 3300035115 Bacteria 914
244 Ga0373945_0015747 3300035116 Bacteria 2547
245 Ga0373945_0177163 3300035116 Bacteria 876
246 Ga0373953_0159586 3300035117 Bacteria 969
247 Ga0373954_0082675 3300035118 Bacteria 1536
248 Ga0373956_0172651 3300035119 Bacteria 1021
249 Ga0373956_0236249 3300035119 Bacteria 868
250 Ga0373957_0514849 3300035120 Bacteria 521
251 Ga0373943_0056267 3300035170 Bacteria 1951
252 Ga0373946_0049379 3300035171 Bacteria 1754
253 Ga0373946_0075848 3300035171 Bacteria 1462
254 Ga0373955_0077789 3300035172 Bacteria 1868
255 Ga0373955_0496339 3300035172 Bacteria 745
256 Ga0373961_0002399 3300035241 Bacteria 4874
257 Ga0373962_0020309 3300035242 Bacteria 1744
258 Ga0373924_0030883 3300035410 Bacteria 2150
259 Ga0373931_0027509 3300035691 Bacteria 2903
260 Ga0373935_0086628 3300035692 Bacteria 2044
261 Ga0373935_0129086 3300035692 Bacteria 1697
262 Ga0373935_0192148 3300035692 Bacteria 1407
263 Ga0373927_0104918 3300035695 Bacteria 1840
264 Ga0373927_0122330 3300035695 Bacteria 1698
265 Ga0373927_0165714 3300035695 Bacteria 1448
266 Ga0373927_0324972 3300035695 Bacteria 1013
267 Ga0373927_0687595 3300035695 Bacteria 676
268 Ga0373933_0037001 3300035724 Bacteria 2861
269 Ga0373933_0110350 3300035724 Bacteria 1715
270 Ga0373933_0463371 3300035724 Bacteria 829
271 Ga0373933_0696331 3300035724 Bacteria 668
272 Ga0373933_0857855 3300035724 Bacteria 598
273 Ga0373947_0008032 3300035725 Bacteria 6087
274 Ga0373947_0100234 3300035725 Bacteria 1819
275 Ga0373947_0103316 3300035725 Bacteria 1793
276 Ga0373937_0072831 3300036401 Bacteria 3169
277 Ga0373937_0104327 3300036401 Bacteria 2634
278 Ga0373937_0115496 3300036401 Bacteria 2499
279 Ga0373937_0902615 3300036401 Bacteria 832
280 Ga0373937_0985736 3300036401 Bacteria 791
281 Ga0373925_0055140 3300037068 Bacteria 2974
282 Ga0373925_0100148 3300037068 Bacteria 2226
283 Ga0373925_0134902 3300037068 Bacteria 1928
284 Ga0373925_0576319 3300037068 Bacteria 926
285 Ga0395899_0072158 3300037312 Bacteria 2526
286 Ga0395900_0007219 3300037418 Bacteria 11511
287 Ga0395900_0007280 3300037418 Bacteria 11457
288 Ga0395900_0315694 3300037418 Bacteria 1545
289 Ga0395898_0022065 3300037466 Bacteria 6450
290 Ga0395898_0093539 3300037466 Bacteria 2889
291 Ga0395905_0003777 3300037471 Bacteria 16034
292 Ga0395905_0015222 3300037471 Bacteria 7314
293 Ga0395905_0138232 3300037471 Bacteria 2292
294 Ga0395905_0292412 3300037471 Bacteria 1516
295 Ga0436364_0190198 3300037853 Bacteria 1820
296 Ga0436364_0235567 3300037853 Bacteria 911
297 Ga0436364_0469958 3300037853 Bacteria 3385
298 Ga0436364_0505086 3300037853 Bacteria 936
299 Ga0395901_0007190 3300038443 Bacteria 11227
300 Ga0395901_0087687 3300038443 Bacteria 3254
301 Ga0436365_0643872 3300039437 Bacteria 9586
302 Ga0436365_1208435 3300039437 Bacteria 778
303 Ga0436360_0405156 3300039438 Bacteria 577
304 Ga0436363_0129933 3300039450 Bacteria 833
305 Ga0436363_0138725 3300039450 Bacteria 1358
306 Ga0436362_0075844 3300039453 Bacteria 597
307 Ga0436362_0078723 3300039453 Bacteria 5754
308 Ga0451787_523998 3300041441 Bacteria 625
309 Ga0466957_0617759 3300044842 Bacteria 760
310 Ga0451576_0269263 3300045051 Bacteria 1781
311 Ga0495592_0293356 3300046454 Bacteria 1059
312 Ga0495603_0119135 3300046455 Bacteria 1538
313 Ga0495603_0249635 3300046455 Bacteria 1021
314 Ga0495591_071151 3300046458 Bacteria 903
315 Ga0495629_0000246 3300046459 Bacteria 47200
316 Ga0495629_0015629 3300046459 Bacteria 5450
317 Ga0495629_0210619 3300046459 Bacteria 1342
318 Ga0495629_0652570 3300046459 Bacteria 701
319 Ga0495638_0132112 3300046460 Bacteria 1465
320 Ga0495638_0278080 3300046460 Bacteria 911
321 Ga0495641_0058336 3300046461 Bacteria 1746
322 Ga0495641_0347838 3300046461 Bacteria 670
323 Ga0495651_0060380 3300046462 Bacteria 2904
324 Ga0495653_0057114 3300046463 Bacteria 2973
325 Ga0495653_0705934 3300046463 Bacteria 612
326 Ga0495580_0074263 3300046472 Bacteria 2373
327 Ga0495582_0051002 3300046473 Bacteria 2281
328 Ga0495639_0019766 3300046475 Bacteria 2939
329 Ga0495662_0113335 3300046476 Bacteria 1329
330 Ga0495662_0123239 3300046476 Bacteria 1273
331 Ga0495664_0241973 3300046477 Bacteria 1091
332 Ga0495584_0075642 3300046491 Bacteria 1693
333 Ga0495585_0004392 3300046492 Bacteria 9150
334 Ga0495594_0001453 3300046499 Bacteria 12293
335 Ga0495594_0034370 3300046499 Bacteria 2757
336 Ga0495594_0050173 3300046499 Bacteria 2295
337 Ga0495594_0583408 3300046499 Bacteria 634
338 Ga0495583_0385656 3300046506 Bacteria 551
339 Ga0495608_0140422 3300046511 Bacteria 1542
340 Ga0495618_0070311 3300046514 Bacteria 2225
341 Ga0495628_0661270 3300046516 Bacteria 741
342 Ga0495630_0306047 3300046517 Bacteria 1215
343 Ga0495630_1209865 3300046517 Bacteria 571
344 Ga0495631_0149237 3300046518 Bacteria 1003
345 Ga0495644_0005048 3300046523 Bacteria 5162
346 Ga0495666_0013203 3300046526 Bacteria 4118
347 Ga0495642_0000748 3300046528 Bacteria 16042
348 Ga0495652_0039866 3300046529 Bacteria 4060
349 Ga0495652_0952420 3300046529 Bacteria 564
350 Ga0495665_0125455 3300046531 Bacteria 1344
351 Ga0495587_0043179 3300046536 Bacteria 2686
352 Ga0495598_0019689 3300046537 Bacteria 1773
353 Ga0495645_0164710 3300046543 Bacteria 1530
354 Ga0495622_0008191 3300046557 Bacteria 4843
355 Ga0495633_0002205 3300046558 Bacteria 13943
356 Ga0495667_0063131 3300046559 Bacteria 2425
357 Ga0495656_0000623 3300046615 Bacteria 11319
358 Ga0495668_0002882 3300046616 Bacteria 13624
359 Ga0495634_0105306 3300046642 Bacteria 1819
360 Ga0495634_0233584 3300046642 Bacteria 1130
361 Ga0495611_0000591 3300046648 Bacteria 20927
362 Ga0495611_0005950 3300046648 Bacteria 5204
363 Ga0495635_0152091 3300046663 Bacteria 1575
364 Ga0495659_0005295 3300046664 Bacteria 4059
365 Ga0495661_0113451 3300046665 Bacteria 1507
366 Ga0495588_0068168 3300046674 Bacteria 1847
367 Ga0495657_0019371 3300046675 Bacteria 4909
368 Ga0495657_0203625 3300046675 Bacteria 1205
369 Ga0495599_0027129 3300046678 Bacteria 3590
370 Ga0495646_0043928 3300046680 Bacteria 2734
371 Ga0495647_0026152 3300046681 Bacteria 2135
372 Ga0495647_0108956 3300046681 Bacteria 1154
373 Ga0495658_0003194 3300046683 Bacteria 8159
374 Ga0495658_0005215 3300046683 Bacteria 6392
375 Ga0495658_0009009 3300046683 Bacteria 4960
376 Ga0495658_0051472 3300046683 Bacteria 2333
377 Ga0495669_0253967 3300046684 Bacteria 844
378 Ga0495613_0036554 3300046689 Bacteria 3642
379 Ga0495613_0147561 3300046689 Bacteria 1678
380 Ga0495624_0054910 3300046690 Bacteria 2511
381 Ga0495624_0059242 3300046690 Bacteria 2403
382 Ga0495670_0008879 3300046691 Bacteria 4945
383 Ga0495671_0003813 3300046692 Bacteria 9167
384 Ga0495671_0048176 3300046692 Bacteria 2127
385 Ga0495589_0317527 3300046794 Bacteria 720
386 Ga0495581_0009527 3300047315 Bacteria 5621
387 Ga0495581_0012098 3300047315 Bacteria 4993
388 Ga0495604_0008765 3300047317 Bacteria 7991
389 Ga0495674_0131415 3300047319 Bacteria 2109
390 Ga0495676_0086271 3300047321 Bacteria 2362
391 Ga0495676_0209899 3300047321 Bacteria 1348
392 Ga0495676_0346094 3300047321 Bacteria 994
393 Ga0495680_0021476 3300047322 Bacteria 5403
394 Ga0495680_0086130 3300047322 Bacteria 2364
395 Ga0495680_0088748 3300047322 Bacteria 2323
396 Ga0495680_0498545 3300047322 Bacteria 827
397 Ga0495680_0647015 3300047322 Bacteria 703
398 Ga0495675_0103117 3300047444 Bacteria 1784
399 Ga0495677_0000595 3300047445 Bacteria 14847
400 Ga0495679_031887 3300047446 Bacteria 1696
401 Ga0495673_0040362 3300047469 Bacteria 2109
402 Ga0495684_0004035 3300047471 Bacteria 11457
403 Ga0495684_0877646 3300047471 Bacteria 580
404 Ga0495593_0105477 3300047673 Bacteria 1442
405 Ga0495602_1030158 3300048088 Bacteria 542
406 Ga0495614_0258887 3300048089 Bacteria 797
407 Ga0495614_0292417 3300048089 Bacteria 752
408 Ga0496100_0128958 3300048903 Bacteria 1779
409 Ga0496100_0432677 3300048903 Bacteria 1006
410 Ga0496101_0430556 3300048904 Bacteria 1040
411 Ga0496101_0702222 3300048904 Bacteria 798
412 Ga0496102_0485871 3300048905 Bacteria 1156
413 Ga0496102_1300677 3300048905 Bacteria 646
414 Ga0496103_0311188 3300048906 Bacteria 1013
415 Ga0496103_0615428 3300048906 Bacteria 691
416 Ga0496103_1015029 3300048906 Bacteria 516
417 Ga0496104_0015787 3300048907 Bacteria 6850
418 Ga0496104_0241044 3300048907 Bacteria 1720
419 Ga0496105_0030277 3300048908 Bacteria 4435
420 Ga0496105_0046844 3300048908 Bacteria 3568
421 Ga0496105_0128300 3300048908 Bacteria 2091
422 Ga0496106_0173244 3300048909 Bacteria 1711
423 Ga0496107_0438890 3300048910 Bacteria 970
424 Ga0496108_0095470 3300048911 Bacteria 2531
425 Ga0496108_0100465 3300048911 Bacteria 2467
426 Ga0496108_0216692 3300048911 Bacteria 1662
427 Ga0496109_0020682 3300048912 Bacteria 5813
428 Ga0496109_0036637 3300048912 Bacteria 4428
429 Ga0496109_0423520 3300048912 Bacteria 1257
430 Ga0496110_0002352 3300048913 Bacteria 14158
431 Ga0496110_0055389 3300048913 Bacteria 3489
432 Ga0496110_0433658 3300048913 Bacteria 1198
433 Ga0496111_0003979 3300048914 Bacteria 9277
434 Ga0496111_0038529 3300048914 Bacteria 3425
435 Ga0496111_0483166 3300048914 Bacteria 912
436 Ga0496112_0059846 3300048915 Bacteria 3753
437 Ga0496112_0262169 3300048915 Bacteria 1677
438 Ga0496112_0674146 3300048915 Bacteria 963
439 Ga0496113_0434627 3300048916 Bacteria 1054
440 Ga0496113_0571144 3300048916 Bacteria 906
441 Ga0496114_0706941 3300048917 Bacteria 883
442 Ga0496114_0808339 3300048917 Bacteria 816
443 Ga0496115_0267321 3300048918 Bacteria 1405
444 Ga0496115_1040912 3300048918 Bacteria 623
445 Ga0501075_1214711 3300049591 Bacteria 572
446 Ga0501083_0006684 3300049744 Bacteria 8181
447 nmdc:mga03n38_386548_c1 3300050490 Bacteria 768
448 nmdc:mga00v17_27490_c1 3300050491 Bacteria 3321
449 nmdc:mga00v17_45130_c1 3300050491 Bacteria 2662
450 nmdc:mga0yw44_5608_c1 3300050492 Bacteria 5964
451 nmdc:mga0yw44_81604_c1 3300050492 Bacteria 2028
452 nmdc:mga06z11_140021_c1 3300050494 Bacteria 1367
453 nmdc:mga06z11_588697_c1 3300050494 Bacteria 676
454 nmdc:mga05p37_113697_c1 3300050507 Bacteria 3328
455 nmdc:mga05p37_11547_c1 3300050507 Bacteria 10522
456 nmdc:mga05p37_686694_c1 3300050507 Bacteria 1140
457 nmdc:mga05p37_987053_c1 3300050507 Bacteria 896
458 nmdc:mga09592_1185889_c1 3300050508 Bacteria 632
459 nmdc:mga09592_481708_c1 3300050508 Bacteria 1069
460 nmdc:mga0qj67_193769_c1 3300050509 Bacteria 1651
461 nmdc:mga06r32_132585_c1 3300050510 Bacteria 2465
462 nmdc:mga06r32_181860_c1 3300050510 Bacteria 1393
463 nmdc:mga08y16_1176441_c1 3300050511 Bacteria 738
464 nmdc:mga08y16_329491_c1 3300050511 Bacteria 1571
465 nmdc:mga08y16_39556_c1 3300050511 Bacteria 4948
466 nmdc:mga0n895_163552_c1 3300050512 Bacteria 2257
467 nmdc:mga0n895_375453_c1 3300050512 Bacteria 1439
468 nmdc:mga0n895_71726_c1 3300050512 Bacteria 3435
469 nmdc:mga0n895_85598_c1 3300050512 Bacteria 3148
470 nmdc:mga0rr50_1534730_c1 3300050513 Bacteria 563
471 nmdc:mga0rr50_171032_c1 3300050513 Bacteria 1770
472 nmdc:mga0rr50_264925_c1 3300050513 Bacteria 1431
473 nmdc:mga0rr50_700072_c1 3300050513 Bacteria 865
474 nmdc:mga0rr50_985511_c1 3300050513 Bacteria 718
475 nmdc:mga08x19_1064058_c1 3300050514 Bacteria 574
476 nmdc:mga08x19_36254_c1 3300050514 Bacteria 3123
477 nmdc:mga08x19_408113_c1 3300050514 Bacteria 953
478 nmdc:mga08x19_655282_c1 3300050514 Bacteria 745
479 nmdc:mga0a205_172267_c1 3300050515 Bacteria 2060
480 Ga0495601_0021049 3300053077 Bacteria 3989
481 Ga0495601_0039817 3300053077 Bacteria 2943
482 Ga0495601_0051334 3300053077 Bacteria 2603
483 Ga0495601_0064386 3300053077 Bacteria 2331
484 Ga0495595_0027007 3300053084 Bacteria 2554
485 Ga0495595_0094685 3300053084 Bacteria 1436
486 Ga0495595_0361389 3300053084 Bacteria 733
487 Ga0495619_0000969 3300053085 Bacteria 18796
488 Ga0495619_0001147 3300053085 Bacteria 17396
489 Ga0495619_0017019 3300053085 Bacteria 4608
490 Ga0500643_006461 3300053087 Bacteria 4893
491 Ga0500641_0059312 3300053096 Bacteria 1591
492 Ga0590077_027443 3300059426 Unclassified 1234
493 Ga0501082_0099530 3300060353 Bacteria 2514
494 Ga0530510_0121682 3300061734 Bacteria 1916
495 2856371378 2856364286 Bacteria 6939991
496 2869168626 2869162929 Bacteria 6399702
497 2869292601 2869285874 Bacteria 6901219
498 2871429416 2871429161 Bacteria 6547891
499 2874154323 2874146452 Bacteria 7533118
500 2874161824 2874155637 Bacteria 6724144
501 2876384760 2876377896 Bacteria 6565995
502 2876397468 2876392853 Bacteria 6660880
503 2876420006 2876413966 Bacteria 6831344
504 2878752944 2878745973 Bacteria 6867388
505 2883355144 2883354860 Bacteria 5865246
506 2903495043 2903492973 Bacteria 13473544
507 2904664222 2904659560 Bacteria 6685615
508 2906315335 2906308376 Bacteria 6841989
509 2906321591 2906321335 Bacteria 6579571
510 2937821878 2937813078 Bacteria 7783518
511 2937826122 2937822353 Bacteria 7290551
512 2958041988 2958041894 Bacteria 13082850
513 2958137001 2958130278 Bacteria 6897202
514 2958186884 2958179912 Bacteria 6874908
515 2961085385 2961077736 Bacteria 7079850
516 2961118638 2961114664 Bacteria 6680456
517 2968115361 2968110612 Bacteria 6814636
518 2977849898 2977843712 Bacteria 6753583
519 8004395275 8004387939 Bacteria 7049250
520 8004644444 8004640170 Bacteria 6723001
521 8004721596 8004714634 Bacteria 6776161
522 nmdc:mga05p37_1423069_c1
523 Ga0070690_100041594
524 Ga0070680_100129447
525 Ga0070680_100779504
526 Ga0068868_100234699
527 Ga0070689_100074946
528 Ga0070691_10270390
529 Ga0070661_100090158
530 Ga0070661_100252641
531 Ga0070671_100043213
532 Ga0070688_100054887
533 Ga0070659_100286334
534 Ga0070667_100033611
535 Ga0070709_10488544
536 Ga0070714_100183444
537 Ga0070714_100578235
538 Ga0070714_101273310
539 Ga0070713_100032133
540 Ga0070713_100264286
541 Ga0070713_100358772
542 Ga0070713_100790168
543 Ga0070710_10013600
544 Ga0070710_10430271
545 Ga0070710_10687840
546 Ga0070701_10197538
547 Ga0070711_100270162
548 Ga0070711_100668000
549 Ga0070711_100978600
550 Ga0070705_100439506
551 Ga0070678_100293847
552 Ga0068867_100112890
553 Ga0070706_100091594
554 Ga0070707_100438872
555 Ga0070698_100061631
556 Ga0070684_100081048
557 Ga0070697_100030504
558 Ga0070697_100734827
559 Ga0070686_100196519
560 Ga0070686_100449087
561 Ga0070693_100053869
562 Ga0068855_100212478
563 Ga0070664_100089703
564 Ga0070664_100113712
565 Ga0070664_100415981
566 Ga0068856_100824879
567 Ga0070702_100050058
568 Ga0068859_100633873
569 Ga0068866_10208661
570 Ga0068863_101520900
571 Ga0068858_100326557
572 Ga0068860_100149239
573 Ga0068860_100885824
574 Ga0068862_100229199
575 Ga0081538_10038006
576 Ga0081540_1017646
577 Ga0070717_10020276
578 Ga0070717_10385274
579 Ga0070717_10590000
580 Ga0075363_100021933
581 Ga0075364_10046354
582 Ga0075364_10348651
583 Ga0075432_10108647
584 Ga0070716_101120446
585 Ga0070712_100088610
586 Ga0070712_100583817
587 Ga0075367_10023461
588 Ga0075367_10374040
589 Ga0075369_10020483
590 Ga0097621_100431416
591 Ga0097621_100495471
592 Ga0068871_100633848
593 Ga0068871_101070887
594 Ga0075428_100004238
595 Ga0075428_100231560
596 Ga0075430_100209212
597 Ga0075431_100097636
598 Ga0075433_10029278
599 Ga0075433_10177982
600 Ga0075434_100248159
601 Ga0075434_100380352
602 Ga0075434_100450370
603 Ga0075434_100603790
604 Ga0075429_100206363
605 Ga0075429_100361555
606 Ga0075429_100370129
607 Ga0068865_101194824
608 Ga0075436_100005314
609 Ga0097620_100633959
610 Ga0075435_100101884
611 Ga0075435_100235924
612 Ga0075435_100600948
613 Ga0075435_100978355
614 Ga0111539_10026682
615 Ga0111539_10127002
616 Ga0111539_10601109
617 Ga0105245_10043465
618 Ga0105245_10770411
619 Ga0105247_10660929
620 Ga0105247_10675122
621 Ga0114129_10126850
622 Ga0114129_10212440
623 Ga0114129_11397714
624 Ga0105243_10468721
625 Ga0105241_10003177
626 Ga0105241_10326727
627 Ga0105241_10491688
628 Ga0105242_10252277
629 Ga0105248_10025659
630 Ga0105237_10096914
631 Ga0105237_11293777
632 Ga0105249_10418501
633 Ga0099796_10012500
634 Ga0099796_10090790
635 Ga0105239_10586797
636 Ga0105246_10101643
637 Ga0157341_1001833
638 Ga0157347_1015650
639 Ga0157342_1004846
640 Ga0157373_11096122
641 Ga0157370_10088991
642 Ga0157370_10529853
643 Ga0157374_10085108
644 Ga0157374_10307818
645 Ga0157374_10598820
646 Ga0157374_10997814
647 Ga0157378_10113874
648 Ga0163162_10152949
649 Ga0163162_10196697
650 Ga0163162_10677444
651 Ga0157375_10000051
652 Ga0157375_10228574
653 Ga0157375_11186067
654 Ga0157379_10368073
655 Ga0157376_10063007
656 Ga0157376_10392578
657 Ga0157376_10404217
658 Ga0157376_11025019
659 Ga0163161_11598266
660 Ga0213873_10044928
661 Ga0213876_10027223
662 Ga0213875_10193935
663 Ga0209233_1000034
664 Ga0207697_10453785
665 Ga0207692_10292170
666 Ga0207692_10416694
667 Ga0207642_10011650
668 Ga0207710_10099828
669 Ga0207685_10495200
670 Ga0207685_10597521
671 Ga0207699_10403952
672 Ga0207684_10105666
673 Ga0207654_10025762
674 Ga0207654_10703802
675 Ga0207707_10463928
676 Ga0207695_11323160
677 Ga0207693_10089068
678 Ga0207693_10513466
679 Ga0207693_10581867
680 Ga0207693_10586351
681 Ga0207663_10095865
682 Ga0207663_10260357
683 Ga0207663_10631758
684 Ga0207660_10171804
685 Ga0207657_10612604
686 Ga0207649_10466614
687 Ga0207646_11051296
688 Ga0207650_10138563
689 Ga0207687_10014391
690 Ga0207687_10121617
691 Ga0207687_11189029
692 Ga0207700_10050151
693 Ga0207700_10515403
694 Ga0207700_10583300
695 Ga0207700_11112700
696 Ga0207700_11317023
697 Ga0207664_10364729
698 Ga0207664_10485151
699 Ga0207644_10083891
700 Ga0207706_10051759
701 Ga0207706_10883841
702 Ga0207686_10022044
703 Ga0207670_10056323
704 Ga0207704_11068854
705 Ga0207665_10089857
706 Ga0207665_10549806
707 Ga0207711_10040103
708 Ga0207711_10049399
709 Ga0207689_10028959
710 Ga0207679_10284683
711 Ga0207668_11753392
712 Ga0207658_10016143
713 Ga0207658_11087656
714 Ga0207677_10030992
715 Ga0207677_10038647
716 Ga0207703_10792531
717 Ga0207703_11167517
718 Ga0207702_10726075
719 Ga0207702_11455564
720 Ga0207641_10070454
721 Ga0207641_11295345
722 Ga0207648_10048153
723 Ga0207676_10127463
724 Ga0207683_10001084
725 Ga0207698_10970364
726 Ga0207428_10048538
727 Ga0207428_10057373
728 Ga0268266_10203403
729 Ga0268265_10226184
730 Ga0268264_10170997
731 Ga0268264_10231948
732 Ga0268264_10252298
733 Ga0265334_10001175
734 Ga0265334_10108184
735 Ga0265338_10664591
736 Ga0265328_10011863
737 Ga0265329_10100356
738 Ga0265340_10032671
739 Ga0265339_10020216
740 Ga0265339_10426308
741 Ga0265331_10018752
742 Ga0265316_10112613
743 Ga0265316_10535202
744 Ga0265316_10858724
745 Ga0265313_10009909
746 Ga0307508_10856291
747 Ga0265314_10306240
748 Ga0265342_10035864
749 Ga0307409_100199687
750 Ga0373938_0062991
751 Ga0373926_0021299
752 Ga0373934_0419746
753 Ga0373940_0141366
754 Ga0373944_0009516
755 Ga0373949_0069835
756 Ga0373952_0003784
757 Ga0373923_0016401
758 Ga0373923_0133436
759 Ga0373923_0217702
760 Ga0373932_0004914
761 Ga0373936_0042572
762 Ga0373936_0267737
763 Ga0373939_0002405
764 Ga0373941_0127245
765 Ga0373945_0015747
766 Ga0373945_0177163
767 Ga0373953_0159586
768 Ga0373954_0082675
769 Ga0373956_0172651
770 Ga0373956_0236249
771 Ga0373957_0514849
772 Ga0373943_0056267
773 Ga0373946_0049379
774 Ga0373946_0075848
775 Ga0373955_0077789
776 Ga0373955_0496339
777 Ga0373961_0002399
778 Ga0373962_0020309
779 Ga0373924_0030883
780 Ga0373931_0027509
781 Ga0373935_0086628
782 Ga0373935_0129086
783 Ga0373935_0192148
784 Ga0373927_0104918
785 Ga0373927_0122330
786 Ga0373927_0165714
787 Ga0373927_0324972
788 Ga0373927_0687595
789 Ga0373933_0037001
790 Ga0373933_0110350
791 Ga0373933_0463371
792 Ga0373933_0696331
793 Ga0373933_0857855
794 Ga0373947_0008032
795 Ga0373947_0100234
796 Ga0373947_0103316
797 Ga0373937_0072831
798 Ga0373937_0104327
799 Ga0373937_0115496
800 Ga0373937_0902615
801 Ga0373937_0985736
802 Ga0373925_0055140
803 Ga0373925_0100148
804 Ga0373925_0134902
805 Ga0373925_0576319
806 Ga0395899_0072158
807 Ga0395900_0007219
808 Ga0395900_0007280
809 Ga0395900_0315694
810 Ga0395898_0022065
811 Ga0395898_0093539
812 Ga0395905_0003777
813 Ga0395905_0015222
814 Ga0395905_0138232
815 Ga0395905_0292412
816 Ga0436364_0190198
817 Ga0436364_0235567
818 Ga0436364_0469958
819 Ga0436364_0505086
820 Ga0395901_0007190
821 Ga0395901_0087687
822 Ga0436365_0643872
823 Ga0436365_1208435
824 Ga0436360_0405156
825 Ga0436363_0129933
826 Ga0436363_0138725
827 Ga0436362_0075844
828 Ga0436362_0078723
829 Ga0451787_523998
830 Ga0466957_0617759
831 Ga0451576_0269263
832 Ga0495592_0293356
833 Ga0495603_0119135
834 Ga0495603_0249635
835 Ga0495591_071151
836 Ga0495629_0000246
837 Ga0495629_0015629
838 Ga0495629_0210619
839 Ga0495629_0652570
840 Ga0495638_0132112
841 Ga0495638_0278080
842 Ga0495641_0058336
843 Ga0495641_0347838
844 Ga0495651_0060380
845 Ga0495653_0057114
846 Ga0495653_0705934
847 Ga0495580_0074263
848 Ga0495582_0051002
849 Ga0495639_0019766
850 Ga0495662_0113335
851 Ga0495662_0123239
852 Ga0495664_0241973
853 Ga0495584_0075642
854 Ga0495585_0004392
855 Ga0495594_0001453
856 Ga0495594_0034370
857 Ga0495594_0050173
858 Ga0495594_0583408
859 Ga0495583_0385656
860 Ga0495608_0140422
861 Ga0495618_0070311
862 Ga0495628_0661270
863 Ga0495630_0306047
864 Ga0495630_1209865
865 Ga0495631_0149237
866 Ga0495644_0005048
867 Ga0495666_0013203
868 Ga0495642_0000748
869 Ga0495652_0039866
870 Ga0495652_0952420
871 Ga0495665_0125455
872 Ga0495587_0043179
873 Ga0495598_0019689
874 Ga0495645_0164710
875 Ga0495622_0008191
876 Ga0495633_0002205
877 Ga0495667_0063131
878 Ga0495656_0000623
879 Ga0495668_0002882
880 Ga0495634_0105306
881 Ga0495634_0233584
882 Ga0495611_0000591
883 Ga0495611_0005950
884 Ga0495635_0152091
885 Ga0495659_0005295
886 Ga0495661_0113451
887 Ga0495588_0068168
888 Ga0495657_0019371
889 Ga0495657_0203625
890 Ga0495599_0027129
891 Ga0495646_0043928
892 Ga0495647_0026152
893 Ga0495647_0108956
894 Ga0495658_0003194
895 Ga0495658_0005215
896 Ga0495658_0009009
897 Ga0495658_0051472
898 Ga0495669_0253967
899 Ga0495613_0036554
900 Ga0495613_0147561
901 Ga0495624_0054910
902 Ga0495624_0059242
903 Ga0495670_0008879
904 Ga0495671_0003813
905 Ga0495671_0048176
906 Ga0495589_0317527
907 Ga0495581_0009527
908 Ga0495581_0012098
909 Ga0495604_0008765
910 Ga0495674_0131415
911 Ga0495676_0086271
912 Ga0495676_0209899
913 Ga0495676_0346094
914 Ga0495680_0021476
915 Ga0495680_0086130
916 Ga0495680_0088748
917 Ga0495680_0498545
918 Ga0495680_0647015
919 Ga0495675_0103117
920 Ga0495677_0000595
921 Ga0495679_031887
922 Ga0495673_0040362
923 Ga0495684_0004035
924 Ga0495684_0877646
925 Ga0495593_0105477
926 Ga0495602_1030158
927 Ga0495614_0258887
928 Ga0495614_0292417
929 Ga0496100_0128958
930 Ga0496100_0432677
931 Ga0496101_0430556
932 Ga0496101_0702222
933 Ga0496102_0485871
934 Ga0496102_1300677
935 Ga0496103_0311188
936 Ga0496103_0615428
937 Ga0496103_1015029
938 Ga0496104_0015787
939 Ga0496104_0241044
940 Ga0496105_0030277
941 Ga0496105_0046844
942 Ga0496105_0128300
943 Ga0496106_0173244
944 Ga0496107_0438890
945 Ga0496108_0095470
946 Ga0496108_0100465
947 Ga0496108_0216692
948 Ga0496109_0020682
949 Ga0496109_0036637
950 Ga0496109_0423520
951 Ga0496110_0002352
952 Ga0496110_0055389
953 Ga0496110_0433658
954 Ga0496111_0003979
955 Ga0496111_0038529
956 Ga0496111_0483166
957 Ga0496112_0059846
958 Ga0496112_0262169
959 Ga0496112_0674146
960 Ga0496113_0434627
961 Ga0496113_0571144
962 Ga0496114_0706941
963 Ga0496114_0808339
964 Ga0496115_0267321
965 Ga0496115_1040912
966 Ga0501075_1214711
967 Ga0501083_0006684
968 nmdc:mga03n38_386548_c1
969 nmdc:mga00v17_27490_c1
970 nmdc:mga00v17_45130_c1
971 nmdc:mga0yw44_5608_c1
972 nmdc:mga0yw44_81604_c1
973 nmdc:mga06z11_140021_c1
974 nmdc:mga06z11_588697_c1
975 nmdc:mga05p37_113697_c1
976 nmdc:mga05p37_11547_c1
977 nmdc:mga05p37_686694_c1
978 nmdc:mga05p37_987053_c1
979 nmdc:mga09592_1185889_c1
980 nmdc:mga09592_481708_c1
981 nmdc:mga0qj67_193769_c1
982 nmdc:mga06r32_132585_c1
983 nmdc:mga06r32_181860_c1
984 nmdc:mga08y16_1176441_c1
985 nmdc:mga08y16_329491_c1
986 nmdc:mga08y16_39556_c1
987 nmdc:mga0n895_163552_c1
988 nmdc:mga0n895_375453_c1
989 nmdc:mga0n895_71726_c1
990 nmdc:mga0n895_85598_c1
991 nmdc:mga0rr50_1534730_c1
992 nmdc:mga0rr50_171032_c1
993 nmdc:mga0rr50_264925_c1
994 nmdc:mga0rr50_700072_c1
995 nmdc:mga0rr50_985511_c1
996 nmdc:mga08x19_1064058_c1
997 nmdc:mga08x19_36254_c1
998 nmdc:mga08x19_408113_c1
999 nmdc:mga08x19_655282_c1
1000 nmdc:mga0a205_172267_c1
1001 Ga0495601_0021049
1002 Ga0495601_0039817
1003 Ga0495601_0051334
1004 Ga0495601_0064386
1005 Ga0495595_0027007
1006 Ga0495595_0094685
1007 Ga0495595_0361389
1008 Ga0495619_0000969
1009 Ga0495619_0001147
1010 Ga0495619_0017019
1011 Ga0500643_006461
1012 Ga0500641_0059312
1013 Ga0590077_027443
1014 Ga0501082_0099530
1015 Ga0530510_0121682
1016 2856371378
1017 2869168626
1018 2869292601
1019 2871429416
1020 2874154323
1021 2874161824
1022 2876384760
1023 2876397468
1024 2876420006
1025 2878752944
1026 2883355144
1027 2903495043
1028 2904664222
1029 2906315335
1030 2906321591
1031 2937821878
1032 2937826122
1033 2958041988
1034 2958137001
1035 2958186884
1036 2961085385
1037 2961118638
1038 2968115361
1039 2977849898
1040 8004395275
1041 8004644444
1042 8004721596

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07080

DUF1348

Protein of unknown function (DUF1348)

38

161

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2imj-assembly2.cif.gz_D x-ray crystal structure of protein pfl_3262 from pseudomonas fluorescens. northeast structural genomics consortium target plr14. 0.9985 6 155
2imj-assembly2.cif.gz_D x-ray crystal structure of protein pfl_3262 from pseudomonas fluorescens. northeast structural genomics consortium target plr14. 0.9725 6 155
6f4y-assembly2.cif.gz_B crystal structure of ketosteroid isomerase variant d103s 0.8967 17 126
6f53-assembly1.cif.gz_A crystal structure of ketosteroid isomerase quadruple variant v88i/l99v/d103s/v101a 0.8955 17 126
3sed-assembly1.cif.gz_A crystal structure of ketosteroid isomerase variant m105a from pseudomonos putida 0.8899 17 126
ID Description Score Start End Superfamily
2imjD01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9999 15 155 3.10.450.50
2imjD01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9857 15 155 3.10.450.50
af_A0A1D8PLG7_39_140_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.891 42 129 3.10.450.50
af_A0A1D8PD11_9_180_2.40.160.20 Mainly Beta;Beta Barrel;Porin; 0.8881 87 117 2.40.160.20
5aigB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.869 19 129 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A529HV08-F1-model_v4 deleted 1.005 8 95
AF-A0A2V8P671-F1-model_v4 DUF1348 domain-containing protein 1.004 8 116
AF-A0A3C0EGT8-F1-model_v4 DUF1348 domain-containing protein 1.004 41 141
AF-A0A1H7CD02-F1-model_v4 DUF1348 domain-containing protein 1.004 63 159
AF-A0A6D1RZ34-F1-model_v4 Protein of uncharacterized function (DUF1348) 1.004 55 159

Map