F458717

General Info

Members Datasets Scaffolds Average Seq Length
521 255 1042 147

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_10035320|Ga0307405_100353204
Length 171
Sequence MPPMVSSIEIARPPAEVFAYATDPSRFAEWQHDVVRVRIQGGHPPSVGSRFTTTRRIGRVEYRLTQEITELSAPRSWAASSVDGPLRASASITVEPLDGGTRSQITFALDFQGRGLGKLLPLDVIRSIALKQAPRSYRNLKERLESSDWRGSGSAGATLDEGPGEPTGHRS

Samples

Sample ID Description Type Environment
1 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
159 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
164 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
165 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
172 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
173 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
174 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
175 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
176 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
177 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
178 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
184 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
185 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
186 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
187 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
188 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
189 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
190 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
204 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
205 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
219 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
220 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
221 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
222 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
223 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
224 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
225 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
226 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
227 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
228 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
229 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
230 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
231 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
232 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
233 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
234 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
236 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
237 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
238 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
239 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
240 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
241 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
242 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
243 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
244 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
245 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
246 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
247 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
248 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
249 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
250 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
251 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
252 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
253 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
254 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
255 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.46
Metatranscriptomes 0.38
Isolates 1.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.58
Nodule 0
Rhizoplane 4.99
Rhizosphere 93.47
Stem 0
Stem Tuber 0
Unclassified 10.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307405_10035320 3300031731 Bacteria 2984
2 JGI24738J21930_10014597 3300002075 Bacteria 1684
3 JGI25406J46586_10017926 3300003203 Bacteria 2917
4 JGI25407J50210_10013771 3300003373 Bacteria 2080
5 JGI25407J50210_10093943 3300003373 Bacteria 742
6 Ga0070658_10060442 3300005327 Bacteria 3086
7 Ga0070676_10565456 3300005328 Bacteria 816
8 Ga0070683_100042523 3300005329 Bacteria 4184
9 Ga0070683_100072621 3300005329 Bacteria 3212
10 Ga0070683_100204091 3300005329 Bacteria 1877
11 Ga0070683_101064091 3300005329 Bacteria 777
12 Ga0070690_100678093 3300005330 Bacteria 790
13 Ga0070670_100045998 3300005331 Bacteria 3752
14 Ga0070677_10038424 3300005333 Bacteria 1873
15 Ga0068869_100048837 3300005334 Bacteria 3062
16 Ga0068869_100083388 3300005334 Bacteria 2391
17 Ga0068869_100905661 3300005334 Bacteria 763
18 Ga0070666_10611884 3300005335 Bacteria 795
19 Ga0070682_100110481 3300005337 Bacteria 1831
20 Ga0070682_100163061 3300005337 Bacteria 1541
21 Ga0070682_100813328 3300005337 Bacteria 760
22 Ga0068868_100116859 3300005338 Bacteria 2172
23 Ga0070660_100031040 3300005339 Bacteria 4011
24 Ga0070660_100061135 3300005339 Bacteria 2924
25 Ga0070660_100132577 3300005339 Unclassified 1995
26 Ga0070689_100080063 3300005340 Bacteria 2563
27 Ga0070689_100325817 3300005340 Bacteria 1284
28 Ga0070687_100009991 3300005343 Bacteria 4084
29 Ga0070661_100092423 3300005344 Bacteria 2242
30 Ga0070661_100156423 3300005344 Bacteria 1725
31 Ga0070661_101390576 3300005344 Bacteria 590
32 Ga0070692_10063898 3300005345 Bacteria 1945
33 Ga0070692_10112166 3300005345 Unclassified 1509
34 Ga0070668_100000125 3300005347 Bacteria 47483
35 Ga0070668_100067382 3300005347 Bacteria 2781
36 Ga0070669_100103461 3300005353 Bacteria 2152
37 Ga0070675_100039776 3300005354 Bacteria 3838
38 Ga0070675_100159207 3300005354 Bacteria 1941
39 Ga0070675_101553367 3300005354 Bacteria 610
40 Ga0070674_100054418 3300005356 Bacteria 2768
41 Ga0070674_100087098 3300005356 Bacteria 2245
42 Ga0070673_100021164 3300005364 Bacteria 4708
43 Ga0070673_100085987 3300005364 Bacteria 2561
44 Ga0070688_100002230 3300005365 Bacteria 9781
45 Ga0070659_100027432 3300005366 Bacteria 4388
46 Ga0070659_100068799 3300005366 Bacteria 2809
47 Ga0070659_100119763 3300005366 Unclassified 2131
48 Ga0070667_100499708 3300005367 Unclassified 1115
49 Ga0070667_101184615 3300005367 Unclassified 715
50 Ga0070710_10252539 3300005437 Bacteria 1134
51 Ga0070701_10028294 3300005438 Bacteria 2754
52 Ga0070701_10099101 3300005438 Unclassified 1611
53 Ga0070705_100006131 3300005440 Bacteria 5887
54 Ga0070700_100057667 3300005441 Bacteria 2437
55 Ga0070700_100203010 3300005441 Unclassified 1394
56 Ga0070700_100954159 3300005441 Bacteria 702
57 Ga0070694_100204982 3300005444 Bacteria 1472
58 Ga0070663_100018899 3300005455 Bacteria 4530
59 Ga0070678_100062919 3300005456 Bacteria 2743
60 Ga0070678_100069681 3300005456 Bacteria 2626
61 Ga0070662_100022412 3300005457 Bacteria 4325
62 Ga0070662_100044063 3300005457 Bacteria 3195
63 Ga0070681_10200837 3300005458 Bacteria 1912
64 Ga0070681_10466867 3300005458 Bacteria 1175
65 Ga0068867_100102511 3300005459 Bacteria 2188
66 Ga0068867_100386453 3300005459 Unclassified 1177
67 Ga0070707_100553127 3300005468 Bacteria 1113
68 Ga0070698_100011703 3300005471 Bacteria 9305
69 Ga0070699_100671227 3300005518 Bacteria 946
70 Ga0070679_100378719 3300005530 Bacteria 1362
71 Ga0070684_100077199 3300005535 Bacteria 2941
72 Ga0070684_100226744 3300005535 Unclassified 1705
73 Ga0070684_101250149 3300005535 Bacteria 698
74 Ga0068853_100079887 3300005539 Unclassified 2861
75 Ga0068853_100090430 3300005539 Bacteria 2690
76 Ga0068853_100207310 3300005539 Bacteria 1786
77 Ga0068853_101309795 3300005539 Bacteria 700
78 Ga0070672_100078513 3300005543 Bacteria 2641
79 Ga0070672_100095789 3300005543 Bacteria 2401
80 Ga0070672_100616994 3300005543 Bacteria 945
81 Ga0070686_100235031 3300005544 Bacteria 1331
82 Ga0070686_100740888 3300005544 Bacteria 787
83 Ga0070696_100119194 3300005546 Bacteria 1908
84 Ga0070693_100054804 3300005547 Bacteria 2295
85 Ga0070665_100087348 3300005548 Bacteria 3123
86 Ga0070665_101412110 3300005548 Bacteria 705
87 Ga0070704_100071113 3300005549 Bacteria 2526
88 Ga0068855_100086798 3300005563 Bacteria 3618
89 Ga0068855_100283324 3300005563 Bacteria 1839
90 Ga0070664_100431323 3300005564 Bacteria 1208
91 Ga0070664_100559014 3300005564 Bacteria 1058
92 Ga0070664_101230880 3300005564 Bacteria 706
93 Ga0068857_100072924 3300005577 Bacteria 3059
94 Ga0068857_100544805 3300005577 Bacteria 1093
95 Ga0068857_101455941 3300005577 Bacteria 667
96 Ga0068854_100054715 3300005578 Bacteria 2871
97 Ga0068854_100484337 3300005578 Unclassified 1039
98 Ga0068856_101378741 3300005614 Bacteria 720
99 Ga0070702_100049899 3300005615 Bacteria 2388
100 Ga0068852_100034486 3300005616 Bacteria 4211
101 Ga0068852_100136890 3300005616 Unclassified 2262
102 Ga0068852_100205236 3300005616 Bacteria 1866
103 Ga0068859_100128146 3300005617 Bacteria 2608
104 Ga0068859_101569002 3300005617 Bacteria 727
105 Ga0068859_102499734 3300005617 Unclassified 569
106 Ga0068864_100095312 3300005618 Bacteria 2632
107 Ga0068864_101140278 3300005618 Bacteria 777
108 Ga0068861_100072431 3300005719 Bacteria 2673
109 Ga0068861_100179942 3300005719 Bacteria 1759
110 Ga0068861_100453983 3300005719 Unclassified 1149
111 Ga0068851_10029691 3300005834 Bacteria 2708
112 Ga0068870_10001584 3300005840 Bacteria 9259
113 Ga0068863_100033206 3300005841 Bacteria 4917
114 Ga0068863_100631261 3300005841 Bacteria 1062
115 Ga0068858_100152311 3300005842 Bacteria 2174
116 Ga0068858_101573794 3300005842 Bacteria 648
117 Ga0068860_100012562 3300005843 Bacteria 8337
118 Ga0068860_100288323 3300005843 Bacteria 1606
119 Ga0068862_100086242 3300005844 Bacteria 2729
120 Ga0081538_10000365 3300005981 Bacteria 51606
121 Ga0081538_10002003 3300005981 Bacteria 20344
122 Ga0081538_10002332 3300005981 Bacteria 18722
123 Ga0081538_10019348 3300005981 Bacteria 5065
124 Ga0081539_10000312 3300005985 Bacteria 108472
125 Ga0081539_10000896 3300005985 Bacteria 56801
126 Ga0081539_10027874 3300005985 Bacteria 3566
127 Ga0081539_10032086 3300005985 Bacteria 3223
128 Ga0081539_10071772 3300005985 Bacteria 1853
129 Ga0070717_10517792 3300006028 Unclassified 1079
130 Ga0075432_10038365 3300006058 Bacteria 1669
131 Ga0075432_10422520 3300006058 Unclassified 580
132 Ga0097621_100464789 3300006237 Bacteria 1142
133 Ga0068871_100151411 3300006358 Bacteria 1979
134 Ga0068871_101714848 3300006358 Bacteria 596
135 Ga0075428_100025725 3300006844 Bacteria 6517
136 Ga0075428_100762584 3300006844 Bacteria 1029
137 Ga0075430_100239357 3300006846 Bacteria 1504
138 Ga0075433_11344174 3300006852 Bacteria 619
139 Ga0075434_100158019 3300006871 Bacteria 2287
140 Ga0075434_100704796 3300006871 Bacteria 1027
141 Ga0075429_100395842 3300006880 Bacteria 1209
142 Ga0068865_100035988 3300006881 Bacteria 3334
143 Ga0068865_100108264 3300006881 Bacteria 2045
144 Ga0097620_100128140 3300006931 Bacteria 2608
145 Ga0097620_100674525 3300006931 Bacteria 1125
146 Ga0097620_101569268 3300006931 Bacteria 727
147 Ga0097620_102499587 3300006931 Unclassified 569
148 Ga0105244_10023252 3300009036 Bacteria 3399
149 Ga0111539_10008002 3300009094 Bacteria 13485
150 Ga0105245_10110679 3300009098 Bacteria 2554
151 Ga0105245_10180680 3300009098 Bacteria 2015
152 Ga0105245_11790211 3300009098 Archaea 667
153 Ga0105247_10048688 3300009101 Bacteria 2604
154 Ga0114129_12328229 3300009147 Unclassified 643
155 Ga0114129_12904339 3300009147 Unclassified 566
156 Ga0105243_10065886 3300009148 Bacteria 2911
157 Ga0105243_10121846 3300009148 Bacteria 2200
158 Ga0105243_10154600 3300009148 Bacteria 1971
159 Ga0105243_10485456 3300009148 Bacteria 1167
160 Ga0105243_12215915 3300009148 Unclassified 586
161 Ga0105241_10142352 3300009174 Bacteria 1954
162 Ga0105242_10105517 3300009176 Bacteria 2393
163 Ga0105242_10188513 3300009176 Unclassified 1824
164 Ga0105248_10176608 3300009177 Bacteria 2407
165 Ga0105248_10254666 3300009177 Bacteria 1976
166 Ga0105248_10625078 3300009177 Bacteria 1215
167 Ga0105237_11092909 3300009545 Bacteria 804
168 Ga0105238_10208934 3300009551 Bacteria 1928
169 Ga0105238_10394003 3300009551 Bacteria 1377
170 Ga0105249_10073328 3300009553 Bacteria 3167
171 Ga0105249_11044737 3300009553 Bacteria 886
172 Ga0105239_10069775 3300010375 Bacteria 3860
173 Ga0105239_10746680 3300010375 Bacteria 1120
174 Ga0105239_10769180 3300010375 Bacteria 1103
175 Ga0105246_10005865 3300011119 Bacteria 7493
176 Ga0105246_10066927 3300011119 Bacteria 2516
177 Ga0105246_10167230 3300011119 Archaea 1681
178 Ga0105246_11217405 3300011119 Bacteria 694
179 Ga0157371_10073851 3300013102 Bacteria 2415
180 Ga0157371_10181937 3300013102 Bacteria 1503
181 Ga0157371_10335446 3300013102 Unclassified 1099
182 Ga0157370_10216855 3300013104 Bacteria 1773
183 Ga0157369_10468371 3300013105 Bacteria 1304
184 Ga0157378_10358137 3300013297 Bacteria 1427
185 Ga0163162_10215365 3300013306 Bacteria 2051
186 Ga0157372_10155679 3300013307 Bacteria 2640
187 Ga0157372_10880816 3300013307 Bacteria 1039
188 Ga0157372_11487171 3300013307 Bacteria 780
189 Ga0157372_12004640 3300013307 Bacteria 665
190 Ga0157375_10073531 3300013308 Bacteria 3437
191 Ga0157375_12988852 3300013308 Bacteria 565
192 Ga0163163_10196618 3300014325 Bacteria 2064
193 Ga0163163_10218002 3300014325 Bacteria 1957
194 Ga0157380_10012275 3300014326 Bacteria 6208
195 Ga0157380_10026970 3300014326 Bacteria 4365
196 Ga0182008_10245865 3300014497 Bacteria 922
197 Ga0182008_10391256 3300014497 Unclassified 745
198 Ga0157379_10086184 3300014968 Bacteria 2816
199 Ga0157379_10966620 3300014968 Bacteria 811
200 Ga0157376_10141637 3300014969 Bacteria 2158
201 Ga0157376_10340176 3300014969 Bacteria 1433
202 Ga0163161_10034801 3300017792 Bacteria 3604
203 Ga0163161_11001687 3300017792 Bacteria 713
204 Ga0206350_11324546 3300020080 Bacteria 1015
205 Ga0206353_11390494 3300020082 Unclassified 1620
206 Ga0207656_10052709 3300025321 Bacteria 1763
207 Ga0207655_1011427 3300025728 Bacteria 5290
208 Ga0207642_10211624 3300025899 Bacteria 1078
209 Ga0207710_10214859 3300025900 Bacteria 953
210 Ga0207688_10036651 3300025901 Bacteria 2719
211 Ga0207645_10039710 3300025907 Bacteria 3015
212 Ga0207645_10230994 3300025907 Bacteria 1221
213 Ga0207643_10001196 3300025908 Bacteria 15333
214 Ga0207643_10718193 3300025908 Bacteria 646
215 Ga0207643_11032733 3300025908 Bacteria 531
216 Ga0207705_10374001 3300025909 Unclassified 1100
217 Ga0207662_10009997 3300025918 Bacteria 5237
218 Ga0207657_10031608 3300025919 Bacteria 4792
219 Ga0207657_10048239 3300025919 Bacteria 3719
220 Ga0207657_10090446 3300025919 Bacteria 2554
221 Ga0207649_10034948 3300025920 Bacteria 3016
222 Ga0207646_10098942 3300025922 Bacteria 2614
223 Ga0207681_10341173 3300025923 Bacteria 1197
224 Ga0207694_10324785 3300025924 Bacteria 1270
225 Ga0207694_11415621 3300025924 Unclassified 587
226 Ga0207650_10075967 3300025925 Bacteria 2537
227 Ga0207659_10232986 3300025926 Bacteria 1486
228 Ga0207659_10353703 3300025926 Bacteria 1219
229 Ga0207687_10092136 3300025927 Bacteria 2212
230 Ga0207687_10213766 3300025927 Bacteria 1514
231 Ga0207687_10945706 3300025927 Bacteria 738
232 Ga0207644_10057743 3300025931 Bacteria 2803
233 Ga0207690_10098452 3300025932 Bacteria 2083
234 Ga0207690_10208015 3300025932 Bacteria 1490
235 Ga0207706_10052484 3300025933 Bacteria 3599
236 Ga0207706_10066290 3300025933 Bacteria 3177
237 Ga0207686_10064027 3300025934 Bacteria 2340
238 Ga0207709_10048452 3300025935 Bacteria 2589
239 Ga0207709_10061120 3300025935 Bacteria 2353
240 Ga0207709_10332436 3300025935 Bacteria 1141
241 Ga0207670_10113977 3300025936 Bacteria 1953
242 Ga0207670_11129402 3300025936 Bacteria 662
243 Ga0207669_10033865 3300025937 Bacteria 2889
244 Ga0207669_10153955 3300025937 Bacteria 1614
245 Ga0207704_10071026 3300025938 Bacteria 2207
246 Ga0207704_10506082 3300025938 Bacteria 974
247 Ga0207704_10700508 3300025938 Bacteria 838
248 Ga0207691_10006616 3300025940 Bacteria 11190
249 Ga0207691_10061571 3300025940 Bacteria 3409
250 Ga0207691_10074033 3300025940 Bacteria 3072
251 Ga0207711_10175523 3300025941 Bacteria 1946
252 Ga0207711_10633935 3300025941 Bacteria 997
253 Ga0207689_10033506 3300025942 Bacteria 4269
254 Ga0207689_10047843 3300025942 Bacteria 3528
255 Ga0207661_10257867 3300025944 Bacteria 1552
256 Ga0207661_10956628 3300025944 Bacteria 789
257 Ga0207679_10095962 3300025945 Bacteria 2306
258 Ga0207667_10986472 3300025949 Bacteria 830
259 Ga0207651_10180798 3300025960 Bacteria 1673
260 Ga0207712_10076452 3300025961 Bacteria 2424
261 Ga0207712_10851468 3300025961 Bacteria 804
262 Ga0207668_10000627 3300025972 Bacteria 21888
263 Ga0207668_10170048 3300025972 Bacteria 1708
264 Ga0207640_10031819 3300025981 Bacteria 3265
265 Ga0207640_10048536 3300025981 Unclassified 2745
266 Ga0207640_10227926 3300025981 Unclassified 1431
267 Ga0207677_10242416 3300026023 Bacteria 1459
268 Ga0207677_11899086 3300026023 Bacteria 553
269 Ga0207703_10071931 3300026035 Bacteria 2857
270 Ga0207639_10190788 3300026041 Bacteria 1750
271 Ga0207639_10979079 3300026041 Bacteria 792
272 Ga0207678_10010413 3300026067 Bacteria 8163
273 Ga0207708_10005846 3300026075 Bacteria 9103
274 Ga0207708_10107499 3300026075 Bacteria 2163
275 Ga0207702_11039072 3300026078 Archaea 813
276 Ga0207648_10013723 3300026089 Bacteria 7521
277 Ga0207676_10023482 3300026095 Bacteria 4550
278 Ga0207674_10253075 3300026116 Bacteria 1708
279 Ga0207674_11431285 3300026116 Bacteria 660
280 Ga0207674_11545320 3300026116 Bacteria 632
281 Ga0207675_100022989 3300026118 Bacteria 5799
282 Ga0207675_100105342 3300026118 Bacteria 2658
283 Ga0207675_100243317 3300026118 Bacteria 1739
284 Ga0207675_100540292 3300026118 Unclassified 1164
285 Ga0207675_101927056 3300026118 Bacteria 609
286 Ga0207683_10020529 3300026121 Bacteria 5652
287 Ga0207683_10036580 3300026121 Bacteria 4276
288 Ga0207698_10033236 3300026142 Bacteria 3746
289 Ga0268266_10178926 3300028379 Bacteria 1930
290 Ga0268266_11293284 3300028379 Bacteria 705
291 Ga0268265_10072723 3300028380 Bacteria 2683
292 Ga0268265_10234744 3300028380 Bacteria 1614
293 Ga0268264_10184920 3300028381 Bacteria 1895
294 Ga0268264_11032137 3300028381 Bacteria 829
295 Ga0307515_10008498 3300028794 Bacteria 20003
296 Ga0307515_10068153 3300028794 Bacteria 4894
297 Ga0307512_10428134 3300030522 Bacteria 543
298 Ga0307408_100080588 3300031548 Bacteria 2432
299 Ga0307408_100225922 3300031548 Bacteria 1530
300 Ga0307408_100494041 3300031548 Unclassified 1070
301 Ga0307408_100757187 3300031548 Bacteria 878
302 Ga0307408_100817545 3300031548 Bacteria 847
303 Ga0307408_101441821 3300031548 Unclassified 649
304 Ga0307405_10021632 3300031731 Bacteria 3618
305 Ga0307405_10082998 3300031731 Bacteria 2099
306 Ga0307405_10373205 3300031731 Bacteria 1108
307 Ga0307405_10406627 3300031731 Unclassified 1067
308 Ga0307405_10705093 3300031731 Bacteria 836
309 Ga0307405_11274445 3300031731 Unclassified 638
310 Ga0307413_10017647 3300031824 Bacteria 3723
311 Ga0307413_10127304 3300031824 Bacteria 1737
312 Ga0307413_10260832 3300031824 Bacteria 1292
313 Ga0307413_10263839 3300031824 Bacteria 1285
314 Ga0307413_10359582 3300031824 Bacteria 1126
315 Ga0307410_10002411 3300031852 Bacteria 9030
316 Ga0307410_10100078 3300031852 Bacteria 2076
317 Ga0307410_10110274 3300031852 Bacteria 1990
318 Ga0307410_10137963 3300031852 Bacteria 1800
319 Ga0307410_10232851 3300031852 Bacteria 1423
320 Ga0307410_10272043 3300031852 Bacteria 1325
321 Ga0307410_10880912 3300031852 Bacteria 766
322 Ga0307406_10033407 3300031901 Bacteria 3149
323 Ga0307406_10475481 3300031901 Bacteria 1008
324 Ga0307406_10830744 3300031901 Unclassified 782
325 Ga0307406_11472353 3300031901 Unclassified 598
326 Ga0307407_10005385 3300031903 Bacteria 5550
327 Ga0307407_10024878 3300031903 Bacteria 3147
328 Ga0307407_10153934 3300031903 Bacteria 1497
329 Ga0307407_10208472 3300031903 Bacteria 1314
330 Ga0307407_11268251 3300031903 Unclassified 577
331 Ga0307412_10005774 3300031911 Bacteria 6959
332 Ga0307412_10370039 3300031911 Bacteria 1157
333 Ga0307412_10618414 3300031911 Bacteria 920
334 Ga0307412_10692620 3300031911 Bacteria 874
335 Ga0307412_10728755 3300031911 Bacteria 854
336 Ga0307409_100021542 3300031995 Bacteria 4422
337 Ga0307409_100023091 3300031995 Bacteria 4302
338 Ga0307409_100032989 3300031995 Bacteria 3762
339 Ga0307409_100037717 3300031995 Bacteria 3565
340 Ga0307409_100043602 3300031995 Bacteria 3370
341 Ga0307409_100058854 3300031995 Bacteria 2986
342 Ga0307409_100103590 3300031995 Bacteria 2367
343 Ga0307409_100147387 3300031995 Bacteria 2037
344 Ga0307409_100227263 3300031995 Bacteria 1689
345 Ga0307409_100311912 3300031995 Bacteria 1468
346 Ga0307416_100009717 3300032002 Bacteria 6317
347 Ga0307416_100016643 3300032002 Bacteria 5119
348 Ga0307416_100028465 3300032002 Bacteria 4155
349 Ga0307416_100057986 3300032002 Bacteria 3136
350 Ga0307416_100093684 3300032002 Bacteria 2588
351 Ga0307416_100157494 3300032002 Bacteria 2093
352 Ga0307416_100474046 3300032002 Unclassified 1310
353 Ga0307416_100707029 3300032002 Unclassified 1097
354 Ga0307416_100758563 3300032002 Bacteria 1063
355 Ga0307416_100983457 3300032002 Bacteria 946
356 Ga0307414_10021196 3300032004 Bacteria 4071
357 Ga0307414_10024068 3300032004 Bacteria 3876
358 Ga0307414_10135543 3300032004 Bacteria 1919
359 Ga0307414_10411987 3300032004 Bacteria 1177
360 Ga0307414_10647822 3300032004 Bacteria 952
361 Ga0307414_10653569 3300032004 Bacteria 948
362 Ga0307414_11706041 3300032004 Bacteria 587
363 Ga0307411_10096548 3300032005 Bacteria 2078
364 Ga0307411_10146031 3300032005 Bacteria 1751
365 Ga0307411_10316059 3300032005 Bacteria 1259
366 Ga0307411_10539610 3300032005 Bacteria 993
367 Ga0307411_10646112 3300032005 Bacteria 915
368 Ga0307411_10759932 3300032005 Unclassified 850
369 Ga0307415_100003011 3300032126 Bacteria 8481
370 Ga0307415_100003416 3300032126 Bacteria 8077
371 Ga0307415_100007109 3300032126 Bacteria 6095
372 Ga0307415_100049107 3300032126 Bacteria 2851
373 Ga0307415_100101521 3300032126 Bacteria 2111
374 Ga0307415_100157834 3300032126 Bacteria 1754
375 Ga0307415_100192238 3300032126 Bacteria 1611
376 Ga0307415_100537087 3300032126 Bacteria 1029
377 Ga0307415_100630095 3300032126 Bacteria 958
378 Ga0307415_100861014 3300032126 Bacteria 832
379 Ga0373930_0006927 3300034816 Archaea 1933
380 Ga0373950_0022385 3300034818 Bacteria 1124
381 Ga0373959_0003717 3300034820 Bacteria 2440
382 Ga0373932_0036035 3300035112 Bacteria 1402
383 Ga0373957_0391031 3300035120 Bacteria 597
384 Ga0373942_0357198 3300035207 Unclassified 517
385 Ga0373962_0094691 3300035242 Bacteria 924
386 Ga0373935_0007361 3300035692 Bacteria 6583
387 Ga0395900_0074339 3300037418 Bacteria 3494
388 Ga0395900_0114630 3300037418 Bacteria 2766
389 Ga0395900_0532272 3300037418 Bacteria 1122
390 Ga0395900_1731499 3300037418 Unclassified 536
391 Ga0395898_0082477 3300037466 Bacteria 3099
392 Ga0395898_0526405 3300037466 Bacteria 1124
393 Ga0395898_1200832 3300037466 Unclassified 690
394 Ga0395905_0888777 3300037471 Bacteria 794
395 Ga0395901_0021239 3300038443 Bacteria 6649
396 Ga0395901_0059276 3300038443 Bacteria 3982
397 Ga0395901_0144819 3300038443 Bacteria 2498
398 Ga0395901_0405768 3300038443 Bacteria 1399
399 Ga0439451_052437 3300042009 Bacteria 817
400 Ga0439464_0099632 3300042439 Unclassified 882
401 Ga0439460_0036914 3300042461 Bacteria 1420
402 Ga0495629_0390987 3300046459 Bacteria 946
403 Ga0495618_0272389 3300046514 Bacteria 1058
404 Ga0495628_0065580 3300046516 Bacteria 2839
405 Ga0495634_0098190 3300046642 Bacteria 1895
406 Ga0495615_0204834 3300048090 Unclassified 610
407 Ga0496100_0398116 3300048903 Bacteria 1048
408 Ga0496101_0245709 3300048904 Bacteria 1393
409 Ga0496101_0293103 3300048904 Bacteria 1273
410 Ga0496103_0083608 3300048906 Bacteria 2010
411 Ga0496104_0209512 3300048907 Bacteria 1861
412 Ga0496104_0761553 3300048907 Bacteria 875
413 Ga0496104_1157003 3300048907 Bacteria 677
414 Ga0496105_0148832 3300048908 Bacteria 1925
415 Ga0496105_0200191 3300048908 Bacteria 1630
416 Ga0496105_0916484 3300048908 Bacteria 660
417 Ga0496106_0519123 3300048909 Bacteria 956
418 Ga0496107_0063437 3300048910 Bacteria 2677
419 Ga0496107_0114482 3300048910 Bacteria 1984
420 Ga0496107_1083953 3300048910 Bacteria 579
421 Ga0496109_0271604 3300048912 Bacteria 1597
422 Ga0496109_0389872 3300048912 Unclassified 1316
423 Ga0496110_0064944 3300048913 Bacteria 3226
424 Ga0496110_0229931 3300048913 Bacteria 1686
425 Ga0496111_0141648 3300048914 Bacteria 1781
426 Ga0496111_0169240 3300048914 Bacteria 1623
427 Ga0496113_0118725 3300048916 Bacteria 2066
428 Ga0496114_0091311 3300048917 Bacteria 2586
429 Ga0496114_0382101 3300048917 Unclassified 1247
430 Ga0496114_1025629 3300048917 Unclassified 709
431 Ga0496115_0701089 3300048918 Bacteria 796
432 Ga0496115_0916815 3300048918 Unclassified 675
433 Ga0501291_008087 3300049514 Bacteria 1444
434 Ga0501031_0041605 3300049568 Bacteria 2999
435 Ga0501031_0403265 3300049568 Bacteria 884
436 Ga0501032_0021278 3300049569 Bacteria 4510
437 Ga0501033_0154924 3300049570 Bacteria 1651
438 Ga0501033_0232308 3300049570 Bacteria 1310
439 Ga0501033_0568175 3300049570 Unclassified 780
440 Ga0501034_0683312 3300049571 Unclassified 926
441 Ga0501036_0075736 3300049572 Bacteria 2846
442 Ga0501036_0160430 3300049572 Bacteria 1896
443 Ga0501037_0064328 3300049573 Bacteria 2673
444 Ga0501038_0049742 3300049574 Bacteria 3624
445 Ga0501038_0065869 3300049574 Bacteria 3086
446 Ga0501039_0037875 3300049575 Bacteria 3724
447 Ga0501039_0097038 3300049575 Bacteria 2298
448 Ga0501039_0118695 3300049575 Bacteria 2072
449 Ga0501040_0058048 3300049576 Bacteria 2658
450 Ga0501040_0064200 3300049576 Bacteria 2528
451 Ga0501040_0065623 3300049576 Bacteria 2500
452 Ga0501040_0072803 3300049576 Bacteria 2373
453 Ga0501040_0548462 3300049576 Bacteria 834
454 Ga0501040_0692964 3300049576 Unclassified 737
455 Ga0501041_0002021 3300049577 Bacteria 11416
456 Ga0501041_0039007 3300049577 Bacteria 2881
457 Ga0501042_0145055 3300049578 Bacteria 1711
458 Ga0501042_0172920 3300049578 Bacteria 1558
459 Ga0501043_0009200 3300049579 Bacteria 7764
460 Ga0501048_0106890 3300049582 Bacteria 1975
461 Ga0501068_0069545 3300049584 Bacteria 2147
462 Ga0501068_0363649 3300049584 Unclassified 930
463 Ga0501070_0029095 3300049586 Bacteria 4633
464 Ga0501070_0192526 3300049586 Bacteria 1676
465 Ga0501070_1465740 3300049586 Bacteria 517
466 Ga0501071_0056196 3300049587 Bacteria 2842
467 Ga0501071_0113868 3300049587 Bacteria 2000
468 Ga0501071_0119102 3300049587 Bacteria 1956
469 Ga0501072_0003678 3300049588 Bacteria 11565
470 Ga0501072_0113102 3300049588 Bacteria 2161
471 Ga0501072_0245364 3300049588 Bacteria 1426
472 Ga0501073_0035609 3300049589 Bacteria 3537
473 Ga0501074_0045909 3300049590 Bacteria 3159
474 Ga0501074_0210167 3300049590 Bacteria 1386
475 Ga0501074_0415618 3300049590 Bacteria 954
476 Ga0501075_0010769 3300049591 Bacteria 6442
477 Ga0501075_0028569 3300049591 Bacteria 4117
478 Ga0501075_0047940 3300049591 Bacteria 3210
479 Ga0501076_0011395 3300049592 Bacteria 6619
480 Ga0501076_0068036 3300049592 Bacteria 2844
481 Ga0501076_0472216 3300049592 Unclassified 1033
482 Ga0501077_0018255 3300049593 Bacteria 4438
483 Ga0501243_032169 3300049675 Bacteria 899
484 Ga0501079_0046047 3300049741 Bacteria 3365
485 Ga0501079_0221438 3300049741 Bacteria 1478
486 Ga0501079_0249830 3300049741 Bacteria 1386
487 Ga0501080_0001056 3300049742 Bacteria 22640
488 Ga0501080_0061150 3300049742 Bacteria 3507
489 Ga0501081_0013252 3300049743 Bacteria 5422
490 Ga0501083_0079253 3300049744 Bacteria 2178
491 Ga0501270_049920 3300049767 Bacteria 755
492 Ga0501271_020858 3300049768 Bacteria 759
493 Ga0501035_0084195 3300049822 Bacteria 2805
494 Ga0501035_0479894 3300049822 Unclassified 1025
495 Ga0501045_0130859 3300049824 Bacteria 1865
496 Ga0501045_0278590 3300049824 Bacteria 1245
497 nmdc:mga03n38_551079_c1 3300050490 Unclassified 652
498 nmdc:mga0qj67_635542_c1 3300050509 Bacteria 852
499 nmdc:mga06r32_87824_c1 3300050510 Bacteria 3034
500 nmdc:mga08y16_7593_c1 3300050511 Bacteria 11352
501 nmdc:mga08y16_800931_c1 3300050511 Bacteria 935
502 nmdc:mga0a205_1412147_c1 3300050515 Bacteria 544
503 nmdc:mga0a205_197549_c1 3300050515 Bacteria 1902
504 Ga0495601_0000138 3300053077 Bacteria 41055
505 Ga0495612_0026527 3300053078 Bacteria 2328
506 Ga0500559_0523659 3300053136 Unclassified 543
507 Ga0500630_162108 3300053159 Bacteria 930
508 Ga0501084_0010572 3300054114 Bacteria 7636
509 Ga0501084_0088262 3300054114 Bacteria 2603
510 Ga0590071_007005 3300059421 Bacteria 2670
511 Ga0590075_005352 3300059424 Bacteria 3031
512 Ga0590077_003747 3300059426 Bacteria 3138
513 Ga0501082_0054594 3300060353 Bacteria 3443
514 Ga0501082_0140473 3300060353 Bacteria 2096
515 Ga0530510_0049103 3300061734 Bacteria 3049
516 2558914374 2558860112 Bacteria 9931328
517 2623587523 2622736626 Bacteria 7181580
518 2808875430 2808606365 Bacteria 4301966
519 2919059343 2919059106 Bacteria 4991624
520 2919059352 2919059106 Bacteria 4991624
521 2939650555 2939647034 Bacteria 4681660
522 Ga0307405_10035320
523 JGI24738J21930_10014597
524 JGI25406J46586_10017926
525 JGI25407J50210_10013771
526 JGI25407J50210_10093943
527 Ga0070658_10060442
528 Ga0070676_10565456
529 Ga0070683_100042523
530 Ga0070683_100072621
531 Ga0070683_100204091
532 Ga0070683_101064091
533 Ga0070690_100678093
534 Ga0070670_100045998
535 Ga0070677_10038424
536 Ga0068869_100048837
537 Ga0068869_100083388
538 Ga0068869_100905661
539 Ga0070666_10611884
540 Ga0070682_100110481
541 Ga0070682_100163061
542 Ga0070682_100813328
543 Ga0068868_100116859
544 Ga0070660_100031040
545 Ga0070660_100061135
546 Ga0070660_100132577
547 Ga0070689_100080063
548 Ga0070689_100325817
549 Ga0070687_100009991
550 Ga0070661_100092423
551 Ga0070661_100156423
552 Ga0070661_101390576
553 Ga0070692_10063898
554 Ga0070692_10112166
555 Ga0070668_100000125
556 Ga0070668_100067382
557 Ga0070669_100103461
558 Ga0070675_100039776
559 Ga0070675_100159207
560 Ga0070675_101553367
561 Ga0070674_100054418
562 Ga0070674_100087098
563 Ga0070673_100021164
564 Ga0070673_100085987
565 Ga0070688_100002230
566 Ga0070659_100027432
567 Ga0070659_100068799
568 Ga0070659_100119763
569 Ga0070667_100499708
570 Ga0070667_101184615
571 Ga0070710_10252539
572 Ga0070701_10028294
573 Ga0070701_10099101
574 Ga0070705_100006131
575 Ga0070700_100057667
576 Ga0070700_100203010
577 Ga0070700_100954159
578 Ga0070694_100204982
579 Ga0070663_100018899
580 Ga0070678_100062919
581 Ga0070678_100069681
582 Ga0070662_100022412
583 Ga0070662_100044063
584 Ga0070681_10200837
585 Ga0070681_10466867
586 Ga0068867_100102511
587 Ga0068867_100386453
588 Ga0070707_100553127
589 Ga0070698_100011703
590 Ga0070699_100671227
591 Ga0070679_100378719
592 Ga0070684_100077199
593 Ga0070684_100226744
594 Ga0070684_101250149
595 Ga0068853_100079887
596 Ga0068853_100090430
597 Ga0068853_100207310
598 Ga0068853_101309795
599 Ga0070672_100078513
600 Ga0070672_100095789
601 Ga0070672_100616994
602 Ga0070686_100235031
603 Ga0070686_100740888
604 Ga0070696_100119194
605 Ga0070693_100054804
606 Ga0070665_100087348
607 Ga0070665_101412110
608 Ga0070704_100071113
609 Ga0068855_100086798
610 Ga0068855_100283324
611 Ga0070664_100431323
612 Ga0070664_100559014
613 Ga0070664_101230880
614 Ga0068857_100072924
615 Ga0068857_100544805
616 Ga0068857_101455941
617 Ga0068854_100054715
618 Ga0068854_100484337
619 Ga0068856_101378741
620 Ga0070702_100049899
621 Ga0068852_100034486
622 Ga0068852_100136890
623 Ga0068852_100205236
624 Ga0068859_100128146
625 Ga0068859_101569002
626 Ga0068859_102499734
627 Ga0068864_100095312
628 Ga0068864_101140278
629 Ga0068861_100072431
630 Ga0068861_100179942
631 Ga0068861_100453983
632 Ga0068851_10029691
633 Ga0068870_10001584
634 Ga0068863_100033206
635 Ga0068863_100631261
636 Ga0068858_100152311
637 Ga0068858_101573794
638 Ga0068860_100012562
639 Ga0068860_100288323
640 Ga0068862_100086242
641 Ga0081538_10000365
642 Ga0081538_10002003
643 Ga0081538_10002332
644 Ga0081538_10019348
645 Ga0081539_10000312
646 Ga0081539_10000896
647 Ga0081539_10027874
648 Ga0081539_10032086
649 Ga0081539_10071772
650 Ga0070717_10517792
651 Ga0075432_10038365
652 Ga0075432_10422520
653 Ga0097621_100464789
654 Ga0068871_100151411
655 Ga0068871_101714848
656 Ga0075428_100025725
657 Ga0075428_100762584
658 Ga0075430_100239357
659 Ga0075433_11344174
660 Ga0075434_100158019
661 Ga0075434_100704796
662 Ga0075429_100395842
663 Ga0068865_100035988
664 Ga0068865_100108264
665 Ga0097620_100128140
666 Ga0097620_100674525
667 Ga0097620_101569268
668 Ga0097620_102499587
669 Ga0105244_10023252
670 Ga0111539_10008002
671 Ga0105245_10110679
672 Ga0105245_10180680
673 Ga0105245_11790211
674 Ga0105247_10048688
675 Ga0114129_12328229
676 Ga0114129_12904339
677 Ga0105243_10065886
678 Ga0105243_10121846
679 Ga0105243_10154600
680 Ga0105243_10485456
681 Ga0105243_12215915
682 Ga0105241_10142352
683 Ga0105242_10105517
684 Ga0105242_10188513
685 Ga0105248_10176608
686 Ga0105248_10254666
687 Ga0105248_10625078
688 Ga0105237_11092909
689 Ga0105238_10208934
690 Ga0105238_10394003
691 Ga0105249_10073328
692 Ga0105249_11044737
693 Ga0105239_10069775
694 Ga0105239_10746680
695 Ga0105239_10769180
696 Ga0105246_10005865
697 Ga0105246_10066927
698 Ga0105246_10167230
699 Ga0105246_11217405
700 Ga0157371_10073851
701 Ga0157371_10181937
702 Ga0157371_10335446
703 Ga0157370_10216855
704 Ga0157369_10468371
705 Ga0157378_10358137
706 Ga0163162_10215365
707 Ga0157372_10155679
708 Ga0157372_10880816
709 Ga0157372_11487171
710 Ga0157372_12004640
711 Ga0157375_10073531
712 Ga0157375_12988852
713 Ga0163163_10196618
714 Ga0163163_10218002
715 Ga0157380_10012275
716 Ga0157380_10026970
717 Ga0182008_10245865
718 Ga0182008_10391256
719 Ga0157379_10086184
720 Ga0157379_10966620
721 Ga0157376_10141637
722 Ga0157376_10340176
723 Ga0163161_10034801
724 Ga0163161_11001687
725 Ga0206350_11324546
726 Ga0206353_11390494
727 Ga0207656_10052709
728 Ga0207655_1011427
729 Ga0207642_10211624
730 Ga0207710_10214859
731 Ga0207688_10036651
732 Ga0207645_10039710
733 Ga0207645_10230994
734 Ga0207643_10001196
735 Ga0207643_10718193
736 Ga0207643_11032733
737 Ga0207705_10374001
738 Ga0207662_10009997
739 Ga0207657_10031608
740 Ga0207657_10048239
741 Ga0207657_10090446
742 Ga0207649_10034948
743 Ga0207646_10098942
744 Ga0207681_10341173
745 Ga0207694_10324785
746 Ga0207694_11415621
747 Ga0207650_10075967
748 Ga0207659_10232986
749 Ga0207659_10353703
750 Ga0207687_10092136
751 Ga0207687_10213766
752 Ga0207687_10945706
753 Ga0207644_10057743
754 Ga0207690_10098452
755 Ga0207690_10208015
756 Ga0207706_10052484
757 Ga0207706_10066290
758 Ga0207686_10064027
759 Ga0207709_10048452
760 Ga0207709_10061120
761 Ga0207709_10332436
762 Ga0207670_10113977
763 Ga0207670_11129402
764 Ga0207669_10033865
765 Ga0207669_10153955
766 Ga0207704_10071026
767 Ga0207704_10506082
768 Ga0207704_10700508
769 Ga0207691_10006616
770 Ga0207691_10061571
771 Ga0207691_10074033
772 Ga0207711_10175523
773 Ga0207711_10633935
774 Ga0207689_10033506
775 Ga0207689_10047843
776 Ga0207661_10257867
777 Ga0207661_10956628
778 Ga0207679_10095962
779 Ga0207667_10986472
780 Ga0207651_10180798
781 Ga0207712_10076452
782 Ga0207712_10851468
783 Ga0207668_10000627
784 Ga0207668_10170048
785 Ga0207640_10031819
786 Ga0207640_10048536
787 Ga0207640_10227926
788 Ga0207677_10242416
789 Ga0207677_11899086
790 Ga0207703_10071931
791 Ga0207639_10190788
792 Ga0207639_10979079
793 Ga0207678_10010413
794 Ga0207708_10005846
795 Ga0207708_10107499
796 Ga0207702_11039072
797 Ga0207648_10013723
798 Ga0207676_10023482
799 Ga0207674_10253075
800 Ga0207674_11431285
801 Ga0207674_11545320
802 Ga0207675_100022989
803 Ga0207675_100105342
804 Ga0207675_100243317
805 Ga0207675_100540292
806 Ga0207675_101927056
807 Ga0207683_10020529
808 Ga0207683_10036580
809 Ga0207698_10033236
810 Ga0268266_10178926
811 Ga0268266_11293284
812 Ga0268265_10072723
813 Ga0268265_10234744
814 Ga0268264_10184920
815 Ga0268264_11032137
816 Ga0307515_10008498
817 Ga0307515_10068153
818 Ga0307512_10428134
819 Ga0307408_100080588
820 Ga0307408_100225922
821 Ga0307408_100494041
822 Ga0307408_100757187
823 Ga0307408_100817545
824 Ga0307408_101441821
825 Ga0307405_10021632
826 Ga0307405_10082998
827 Ga0307405_10373205
828 Ga0307405_10406627
829 Ga0307405_10705093
830 Ga0307405_11274445
831 Ga0307413_10017647
832 Ga0307413_10127304
833 Ga0307413_10260832
834 Ga0307413_10263839
835 Ga0307413_10359582
836 Ga0307410_10002411
837 Ga0307410_10100078
838 Ga0307410_10110274
839 Ga0307410_10137963
840 Ga0307410_10232851
841 Ga0307410_10272043
842 Ga0307410_10880912
843 Ga0307406_10033407
844 Ga0307406_10475481
845 Ga0307406_10830744
846 Ga0307406_11472353
847 Ga0307407_10005385
848 Ga0307407_10024878
849 Ga0307407_10153934
850 Ga0307407_10208472
851 Ga0307407_11268251
852 Ga0307412_10005774
853 Ga0307412_10370039
854 Ga0307412_10618414
855 Ga0307412_10692620
856 Ga0307412_10728755
857 Ga0307409_100021542
858 Ga0307409_100023091
859 Ga0307409_100032989
860 Ga0307409_100037717
861 Ga0307409_100043602
862 Ga0307409_100058854
863 Ga0307409_100103590
864 Ga0307409_100147387
865 Ga0307409_100227263
866 Ga0307409_100311912
867 Ga0307416_100009717
868 Ga0307416_100016643
869 Ga0307416_100028465
870 Ga0307416_100057986
871 Ga0307416_100093684
872 Ga0307416_100157494
873 Ga0307416_100474046
874 Ga0307416_100707029
875 Ga0307416_100758563
876 Ga0307416_100983457
877 Ga0307414_10021196
878 Ga0307414_10024068
879 Ga0307414_10135543
880 Ga0307414_10411987
881 Ga0307414_10647822
882 Ga0307414_10653569
883 Ga0307414_11706041
884 Ga0307411_10096548
885 Ga0307411_10146031
886 Ga0307411_10316059
887 Ga0307411_10539610
888 Ga0307411_10646112
889 Ga0307411_10759932
890 Ga0307415_100003011
891 Ga0307415_100003416
892 Ga0307415_100007109
893 Ga0307415_100049107
894 Ga0307415_100101521
895 Ga0307415_100157834
896 Ga0307415_100192238
897 Ga0307415_100537087
898 Ga0307415_100630095
899 Ga0307415_100861014
900 Ga0373930_0006927
901 Ga0373950_0022385
902 Ga0373959_0003717
903 Ga0373932_0036035
904 Ga0373957_0391031
905 Ga0373942_0357198
906 Ga0373962_0094691
907 Ga0373935_0007361
908 Ga0395900_0074339
909 Ga0395900_0114630
910 Ga0395900_0532272
911 Ga0395900_1731499
912 Ga0395898_0082477
913 Ga0395898_0526405
914 Ga0395898_1200832
915 Ga0395905_0888777
916 Ga0395901_0021239
917 Ga0395901_0059276
918 Ga0395901_0144819
919 Ga0395901_0405768
920 Ga0439451_052437
921 Ga0439464_0099632
922 Ga0439460_0036914
923 Ga0495629_0390987
924 Ga0495618_0272389
925 Ga0495628_0065580
926 Ga0495634_0098190
927 Ga0495615_0204834
928 Ga0496100_0398116
929 Ga0496101_0245709
930 Ga0496101_0293103
931 Ga0496103_0083608
932 Ga0496104_0209512
933 Ga0496104_0761553
934 Ga0496104_1157003
935 Ga0496105_0148832
936 Ga0496105_0200191
937 Ga0496105_0916484
938 Ga0496106_0519123
939 Ga0496107_0063437
940 Ga0496107_0114482
941 Ga0496107_1083953
942 Ga0496109_0271604
943 Ga0496109_0389872
944 Ga0496110_0064944
945 Ga0496110_0229931
946 Ga0496111_0141648
947 Ga0496111_0169240
948 Ga0496113_0118725
949 Ga0496114_0091311
950 Ga0496114_0382101
951 Ga0496114_1025629
952 Ga0496115_0701089
953 Ga0496115_0916815
954 Ga0501291_008087
955 Ga0501031_0041605
956 Ga0501031_0403265
957 Ga0501032_0021278
958 Ga0501033_0154924
959 Ga0501033_0232308
960 Ga0501033_0568175
961 Ga0501034_0683312
962 Ga0501036_0075736
963 Ga0501036_0160430
964 Ga0501037_0064328
965 Ga0501038_0049742
966 Ga0501038_0065869
967 Ga0501039_0037875
968 Ga0501039_0097038
969 Ga0501039_0118695
970 Ga0501040_0058048
971 Ga0501040_0064200
972 Ga0501040_0065623
973 Ga0501040_0072803
974 Ga0501040_0548462
975 Ga0501040_0692964
976 Ga0501041_0002021
977 Ga0501041_0039007
978 Ga0501042_0145055
979 Ga0501042_0172920
980 Ga0501043_0009200
981 Ga0501048_0106890
982 Ga0501068_0069545
983 Ga0501068_0363649
984 Ga0501070_0029095
985 Ga0501070_0192526
986 Ga0501070_1465740
987 Ga0501071_0056196
988 Ga0501071_0113868
989 Ga0501071_0119102
990 Ga0501072_0003678
991 Ga0501072_0113102
992 Ga0501072_0245364
993 Ga0501073_0035609
994 Ga0501074_0045909
995 Ga0501074_0210167
996 Ga0501074_0415618
997 Ga0501075_0010769
998 Ga0501075_0028569
999 Ga0501075_0047940
1000 Ga0501076_0011395
1001 Ga0501076_0068036
1002 Ga0501076_0472216
1003 Ga0501077_0018255
1004 Ga0501243_032169
1005 Ga0501079_0046047
1006 Ga0501079_0221438
1007 Ga0501079_0249830
1008 Ga0501080_0001056
1009 Ga0501080_0061150
1010 Ga0501081_0013252
1011 Ga0501083_0079253
1012 Ga0501270_049920
1013 Ga0501271_020858
1014 Ga0501035_0084195
1015 Ga0501035_0479894
1016 Ga0501045_0130859
1017 Ga0501045_0278590
1018 nmdc:mga03n38_551079_c1
1019 nmdc:mga0qj67_635542_c1
1020 nmdc:mga06r32_87824_c1
1021 nmdc:mga08y16_7593_c1
1022 nmdc:mga08y16_800931_c1
1023 nmdc:mga0a205_1412147_c1
1024 nmdc:mga0a205_197549_c1
1025 Ga0495601_0000138
1026 Ga0495612_0026527
1027 Ga0500559_0523659
1028 Ga0500630_162108
1029 Ga0501084_0010572
1030 Ga0501084_0088262
1031 Ga0590071_007005
1032 Ga0590075_005352
1033 Ga0590077_003747
1034 Ga0501082_0054594
1035 Ga0501082_0140473
1036 Ga0530510_0049103
1037 2558914374
1038 2623587523
1039 2808875430
1040 2919059343
1041 2919059352
1042 2939650555

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

1

145

0.85

PF03364

Polyketide_cyc

Polyketide cyclase / dehydrase and lipid transport

10

133

0.84

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

11

145

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wa9-assembly1.cif.gz_A crystal structure of msmeg_5634 from mycobacterium smegmatis 0.8701 1 139
3neg-assembly2.cif.gz_B pyrabactin-bound pyl1 structure in the open and close forms 0.861 2 142
2res-assembly1.cif.gz_A tetracenomycin aro/cyc mutant r69a 0.8527 2 142
3nj0-assembly1.cif.gz_A x-ray crystal structure of the pyl2-pyrabactin a complex 0.8505 2 138
3neg-assembly2.cif.gz_B pyrabactin-bound pyl1 structure in the open and close forms 0.8446 2 142
ID Description Score Start End Superfamily
af_I6Y1P2_6_156_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8584 3 143 3.30.530.20
af_L7N657_19_160_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8564 3 142 3.30.530.20
af_I6X9Y7_1_146_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8559 1 142 3.30.530.20
2resA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8527 2 142 3.30.530.20
af_I6Y1P2_6_156_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8417 3 143 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A4Q8UEG4-F1-model_v4 SRPBCC family protein 0.945 2 142
AF-A0A2W4MKQ3-F1-model_v4 SRPBCC family protein 0.9431 2 143
AF-A0A354NTK8-F1-model_v4 SRPBCC family protein 0.9421 1 103
AF-A0A7V9SGP5-F1-model_v4 SRPBCC family protein 0.9406 1 141
AF-A0A2W6B7F7-F1-model_v4 SRPBCC family protein 0.94 2 142

Map