F458712

General Info

Members Datasets Scaffolds Average Seq Length
521 229 1042 312

Family's Representative Sequence

Representative Sequence 3300026118|Ga0207675_100363023|Ga0207675_1003630231
Length 381
Sequence MNRREFLETVAAAAVLPALTGQEPAREWGAPVFDLHFHMRPQPAANLAHLDGAGISKANLLTRGAALEQVKATQQAAPGRFTWFTSYDVSRPDAEQVLTQAVKNGARGFGEMKFHVAADGPELRRAYALAADLRVPILIHFQEVDHTPNEGTWSTGFAKTFEAILKAYPRTTFIGHADAFWANVSADYHNESVYPTGRVVRGGVTDRWLGDYPNLFGDMSAVSGNTAMVRDADFTGDFLKRHQDKLLFGSDCSCRDGHGAGYDNPVAPRMAGKCVARETLTVLKRSAPPAVFEKIAWGNAHTLLTIEAVELYQRHNLSLDWLARYGEASLDFLAELDGTSPGAAPSPVGARDERRLETSQPRDVLPQGRVSVGCFRGKNLE

Samples

Sample ID Description Type Environment
1 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
144 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
145 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
146 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
147 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
150 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
157 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
158 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
159 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
160 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
161 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
162 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
163 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
164 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
165 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
166 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
167 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
168 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
175 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
176 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
177 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
178 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
179 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
180 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
181 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
182 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
183 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
184 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
185 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
186 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
206 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
207 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
208 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
209 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
210 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
211 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
212 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
213 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
214 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
215 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
216 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
217 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
218 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
219 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
220 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
221 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
222 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
223 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
224 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
225 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
226 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
227 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
228 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
229 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0
Isolates 0.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.53
Nodule 0
Rhizoplane 5.57
Rhizosphere 87.33
Stem 0
Stem Tuber 0
Unclassified 14.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207675_100363023 3300026118 Bacteria 1421
2 Ga0065712_10068264 3300005290 Bacteria 12346
3 Ga0065712_10076173 3300005290 Bacteria 3716
4 Ga0065715_10131870 3300005293 Bacteria 2000
5 Ga0065715_10164763 3300005293 Bacteria 1596
6 Ga0065715_10171102 3300005293 Bacteria 1546
7 Ga0065707_10089170 3300005295 Unclassified 4447
8 Ga0065707_10123928 3300005295 Bacteria 2055
9 Ga0065707_10225888 3300005295 Bacteria 1204
10 Ga0070676_10123608 3300005328 Bacteria 1628
11 Ga0070676_10243043 3300005328 Unclassified 1198
12 Ga0070683_100003040 3300005329 Bacteria 13483
13 Ga0070690_100060976 3300005330 Bacteria 2429
14 Ga0070690_100199507 3300005330 Bacteria 1391
15 Ga0070690_100207179 3300005330 Bacteria 1367
16 Ga0070670_100007291 3300005331 Bacteria 9379
17 Ga0070670_100016433 3300005331 Bacteria 6355
18 Ga0068869_100023171 3300005334 Bacteria 4285
19 Ga0070666_10003190 3300005335 Bacteria 9964
20 Ga0070666_10395841 3300005335 Unclassified 992
21 Ga0068868_100174171 3300005338 Bacteria 1783
22 Ga0070691_10012595 3300005341 Bacteria 3873
23 Ga0070661_100010600 3300005344 Bacteria 6411
24 Ga0070668_100012660 3300005347 Bacteria 6279
25 Ga0070669_100000399 3300005353 Bacteria 33282
26 Ga0070669_100003900 3300005353 Bacteria 10790
27 Ga0070669_100031975 3300005353 Bacteria 3800
28 Ga0070669_100071874 3300005353 Bacteria 2561
29 Ga0070675_100006634 3300005354 Bacteria 8898
30 Ga0070675_100039614 3300005354 Bacteria 3846
31 Ga0070675_100054172 3300005354 Unclassified 3300
32 Ga0070671_100014363 3300005355 Bacteria 6396
33 Ga0070671_100046722 3300005355 Unclassified 3600
34 Ga0070671_100113010 3300005355 Bacteria 2282
35 Ga0070671_100386889 3300005355 Bacteria 1196
36 Ga0070674_100037648 3300005356 Bacteria 3255
37 Ga0070673_100113750 3300005364 Bacteria 2248
38 Ga0070673_100186676 3300005364 Unclassified 1778
39 Ga0070688_100136307 3300005365 Bacteria 1662
40 Ga0070688_100167743 3300005365 Bacteria 1513
41 Ga0070659_100010394 3300005366 Bacteria 6844
42 Ga0070659_100023680 3300005366 Bacteria 4702
43 Ga0070667_100003115 3300005367 Bacteria 14253
44 Ga0070667_100173765 3300005367 Unclassified 1903
45 Ga0070667_100181016 3300005367 Bacteria 1864
46 Ga0070667_100459659 3300005367 Bacteria 1164
47 Ga0070701_10015238 3300005438 Bacteria 3545
48 Ga0070705_100011019 3300005440 Bacteria 4547
49 Ga0070700_100193990 3300005441 Bacteria 1422
50 Ga0070700_100195485 3300005441 Bacteria 1417
51 Ga0070694_100108358 3300005444 Bacteria 1975
52 Ga0070663_100134799 3300005455 Bacteria 1879
53 Ga0070678_100098970 3300005456 Unclassified 2256
54 Ga0070678_100279735 3300005456 Unclassified 1411
55 Ga0070662_100016355 3300005457 Bacteria 4980
56 Ga0070662_100343127 3300005457 Bacteria 1222
57 Ga0070681_10115060 3300005458 Bacteria 2628
58 Ga0068867_100046155 3300005459 Bacteria 3199
59 Ga0070699_100006833 3300005518 Bacteria 9928
60 Ga0070699_100028039 3300005518 Bacteria 4856
61 Ga0070699_100136266 3300005518 Bacteria 2166
62 Ga0070679_100131850 3300005530 Bacteria 2480
63 Ga0070684_100000221 3300005535 Bacteria 39898
64 Ga0070684_100016397 3300005535 Bacteria 6055
65 Ga0070684_100093195 3300005535 Bacteria 2681
66 Ga0070672_100005613 3300005543 Bacteria 8345
67 Ga0070672_100101658 3300005543 Bacteria 2332
68 Ga0070672_100108026 3300005543 Bacteria 2265
69 Ga0070672_100110306 3300005543 Bacteria 2242
70 Ga0070686_100000969 3300005544 Bacteria 16553
71 Ga0070686_100031341 3300005544 Bacteria 3250
72 Ga0070686_100043539 3300005544 Bacteria 2817
73 Ga0070686_100047390 3300005544 Unclassified 2718
74 Ga0070696_100033071 3300005546 Bacteria 3551
75 Ga0070693_100299756 3300005547 Bacteria 1083
76 Ga0070665_100014601 3300005548 Bacteria 7881
77 Ga0070665_100018633 3300005548 Bacteria 6957
78 Ga0070665_100149116 3300005548 Bacteria 2342
79 Ga0070665_100166623 3300005548 Bacteria 2205
80 Ga0070665_100530325 3300005548 Unclassified 1189
81 Ga0070704_100061746 3300005549 Bacteria 2684
82 Ga0070704_100082073 3300005549 Bacteria 2377
83 Ga0070664_100000594 3300005564 Bacteria 27619
84 Ga0070664_100124266 3300005564 Bacteria 2262
85 Ga0070664_100264080 3300005564 Unclassified 1549
86 Ga0070664_100473306 3300005564 Unclassified 1152
87 Ga0068857_100038274 3300005577 Bacteria 4248
88 Ga0068854_100021164 3300005578 Bacteria 4411
89 Ga0068854_100040191 3300005578 Bacteria 3299
90 Ga0070702_100003201 3300005615 Bacteria 7272
91 Ga0068859_100009348 3300005617 Bacteria 9897
92 Ga0068859_100171671 3300005617 Unclassified 2249
93 Ga0068859_100284054 3300005617 Bacteria 1748
94 Ga0068859_100598380 3300005617 Bacteria 1196
95 Ga0068866_10027694 3300005718 Bacteria 2692
96 Ga0068861_100018284 3300005719 Bacteria 4992
97 Ga0068861_100079929 3300005719 Bacteria 2557
98 Ga0068861_100121247 3300005719 Bacteria 2110
99 Ga0068861_100442946 3300005719 Unclassified 1162
100 Ga0068870_10091158 3300005840 Bacteria 1704
101 Ga0068870_10134653 3300005840 Unclassified 1439
102 Ga0068863_100024354 3300005841 Bacteria 5773
103 Ga0068858_100020888 3300005842 Bacteria 6119
104 Ga0068858_100170564 3300005842 Bacteria 2052
105 Ga0068858_100217085 3300005842 Unclassified 1811
106 Ga0068860_100076007 3300005843 Bacteria 3194
107 Ga0068860_100076072 3300005843 Unclassified 3193
108 Ga0068862_100195380 3300005844 Bacteria 1822
109 Ga0068862_100209106 3300005844 Bacteria 1763
110 Ga0068862_100216429 3300005844 Unclassified 1733
111 Ga0068862_100293028 3300005844 Bacteria 1495
112 Ga0081455_10153261 3300005937 Unclassified 1775
113 Ga0081539_10001702 3300005985 Bacteria 35478
114 Ga0081539_10003210 3300005985 Bacteria 20650
115 Ga0070717_10559225 3300006028 Bacteria 1036
116 Ga0075368_10030831 3300006042 Bacteria 2077
117 Ga0075368_10058388 3300006042 Bacteria 1542
118 Ga0075364_10004288 3300006051 Bacteria 8188
119 Ga0075364_10008316 3300006051 Bacteria 6195
120 Ga0075364_10107934 3300006051 Bacteria 1856
121 Ga0075364_10221408 3300006051 Unclassified 1284
122 Ga0075362_10000289 3300006177 Bacteria 14172
123 Ga0075367_10007213 3300006178 Bacteria 5676
124 Ga0075367_10010081 3300006178 Bacteria 4954
125 Ga0075367_10042372 3300006178 Bacteria 2663
126 Ga0075367_10081391 3300006178 Bacteria 1959
127 Ga0075366_10006779 3300006195 Bacteria 6292
128 Ga0075366_10007293 3300006195 Bacteria 6098
129 Ga0075366_10066262 3300006195 Bacteria 2148
130 Ga0097621_100033686 3300006237 Bacteria 4081
131 Ga0075370_10008742 3300006353 Bacteria 5225
132 Ga0075370_10009713 3300006353 Bacteria 5008
133 Ga0068871_100010948 3300006358 Bacteria 6644
134 Ga0068871_100062106 3300006358 Bacteria 3052
135 Ga0075428_100069462 3300006844 Bacteria 3851
136 Ga0075430_100042545 3300006846 Bacteria 3841
137 Ga0075430_100140301 3300006846 Bacteria 2013
138 Ga0075430_100174281 3300006846 Bacteria 1789
139 Ga0075431_100013095 3300006847 Bacteria 8379
140 Ga0075431_100017685 3300006847 Bacteria 7247
141 Ga0075431_100048190 3300006847 Bacteria 4394
142 Ga0075431_100051718 3300006847 Bacteria 4236
143 Ga0075431_100084674 3300006847 Bacteria 3273
144 Ga0075431_100217442 3300006847 Bacteria 1950
145 Ga0075433_10030214 3300006852 Unclassified 4622
146 Ga0075433_10072098 3300006852 Bacteria 3037
147 Ga0075433_10083092 3300006852 Bacteria 2826
148 Ga0075433_10158506 3300006852 Bacteria 2014
149 Ga0075433_10170805 3300006852 Bacteria 1935
150 Ga0075433_10301816 3300006852 Bacteria 1418
151 Ga0075433_10466384 3300006852 Unclassified 1113
152 Ga0075434_100000082 3300006871 Bacteria 51181
153 Ga0075434_100004513 3300006871 Bacteria 12559
154 Ga0075434_100014318 3300006871 Bacteria 7580
155 Ga0075434_100016028 3300006871 Bacteria 7201
156 Ga0075434_100016731 3300006871 Bacteria 7055
157 Ga0075434_100024631 3300006871 Bacteria 5885
158 Ga0075434_100025513 3300006871 Bacteria 5783
159 Ga0075434_100254330 3300006871 Bacteria 1776
160 Ga0075429_100020381 3300006880 Bacteria 5752
161 Ga0075429_100067160 3300006880 Bacteria 3121
162 Ga0075429_100270314 3300006880 Bacteria 1489
163 Ga0068865_100180172 3300006881 Bacteria 1627
164 Ga0068865_100280978 3300006881 Bacteria 1325
165 Ga0075436_100000504 3300006914 Bacteria 25252
166 Ga0075436_100035039 3300006914 Bacteria 3462
167 Ga0075436_100058478 3300006914 Unclassified 2662
168 Ga0075436_100106533 3300006914 Bacteria 1955
169 Ga0097620_100009348 3300006931 Bacteria 9897
170 Ga0097620_100171684 3300006931 Unclassified 2249
171 Ga0097620_100267623 3300006931 Bacteria 1801
172 Ga0097620_100284019 3300006931 Bacteria 1748
173 Ga0097620_100598464 3300006931 Bacteria 1196
174 Ga0075435_100000008 3300007076 Bacteria 115376
175 Ga0075435_100000748 3300007076 Bacteria 20130
176 Ga0075435_100008035 3300007076 Bacteria 7551
177 Ga0075435_100053096 3300007076 Bacteria 3267
178 Ga0075435_100061797 3300007076 Bacteria 3039
179 Ga0075435_100099942 3300007076 Unclassified 2403
180 Ga0075435_100224753 3300007076 Unclassified 1594
181 Ga0105240_10006874 3300009093 Bacteria 16625
182 Ga0105240_10196839 3300009093 Bacteria 2365
183 Ga0111539_10002189 3300009094 Bacteria 26092
184 Ga0111539_10005110 3300009094 Bacteria 17017
185 Ga0111539_10008895 3300009094 Bacteria 12714
186 Ga0111539_10028950 3300009094 Bacteria 6755
187 Ga0111539_10037657 3300009094 Bacteria 5840
188 Ga0111539_10048012 3300009094 Bacteria 5099
189 Ga0111539_10273520 3300009094 Bacteria 1966
190 Ga0111539_10285655 3300009094 Unclassified 1920
191 Ga0111539_10383970 3300009094 Bacteria 1635
192 Ga0111539_10744242 3300009094 Bacteria 1141
193 Ga0105245_10004043 3300009098 Bacteria 13041
194 Ga0105245_10257513 3300009098 Bacteria 1697
195 Ga0105247_10032367 3300009101 Bacteria 3177
196 Ga0114129_10000252 3300009147 Bacteria 60429
197 Ga0114129_10000310 3300009147 Bacteria 56894
198 Ga0114129_10005222 3300009147 Bacteria 18302
199 Ga0114129_10017323 3300009147 Bacteria 10256
200 Ga0114129_10037622 3300009147 Bacteria 6832
201 Ga0114129_10038253 3300009147 Bacteria 6769
202 Ga0114129_10059897 3300009147 Bacteria 5323
203 Ga0114129_10073288 3300009147 Bacteria 4770
204 Ga0114129_10103378 3300009147 Unclassified 3939
205 Ga0114129_10186666 3300009147 Unclassified 2817
206 Ga0114129_10236914 3300009147 Bacteria 2455
207 Ga0114129_10379678 3300009147 Bacteria 1866
208 Ga0105242_10035603 3300009176 Bacteria 3991
209 Ga0105248_10001596 3300009177 Bacteria 25232
210 Ga0105248_10092759 3300009177 Bacteria 3401
211 Ga0105248_10820449 3300009177 Bacteria 1050
212 Ga0105237_10002393 3300009545 Bacteria 23297
213 Ga0105237_10054125 3300009545 Bacteria 4021
214 Ga0105249_10003179 3300009553 Bacteria 14205
215 Ga0105249_10031197 3300009553 Bacteria 4819
216 Ga0105249_10602860 3300009553 Unclassified 1153
217 Ga0105249_10843737 3300009553 Unclassified 982
218 Ga0105239_10407680 3300010375 Unclassified 1539
219 Ga0105239_10553809 3300010375 Bacteria 1310
220 Ga0105246_10119192 3300011119 Bacteria 1952
221 Ga0105246_10252040 3300011119 Bacteria 1401
222 Ga0157374_10023084 3300013296 Bacteria 5559
223 Ga0157374_10422619 3300013296 Bacteria 1332
224 Ga0157378_10204094 3300013297 Bacteria 1871
225 Ga0157378_10287647 3300013297 Bacteria 1586
226 Ga0157378_10304570 3300013297 Bacteria 1543
227 Ga0163162_10061369 3300013306 Unclassified 3797
228 Ga0163162_10201828 3300013306 Bacteria 2117
229 Ga0157375_10015088 3300013308 Bacteria 6911
230 Ga0157375_10136541 3300013308 Bacteria 2577
231 Ga0157375_10505152 3300013308 Unclassified 1373
232 Ga0163163_10057591 3300014325 Bacteria 3843
233 Ga0163163_10105589 3300014325 Bacteria 2842
234 Ga0163163_10233337 3300014325 Unclassified 1889
235 Ga0157380_10098978 3300014326 Bacteria 2424
236 Ga0157380_10283906 3300014326 Unclassified 1516
237 Ga0157380_10332864 3300014326 Bacteria 1413
238 Ga0157377_10084154 3300014745 Bacteria 1865
239 Ga0157379_10022582 3300014968 Bacteria 5574
240 Ga0157379_10245262 3300014968 Bacteria 1625
241 Ga0157376_10028685 3300014969 Bacteria 4426
242 Ga0157376_10103483 3300014969 Bacteria 2493
243 Ga0157376_10206651 3300014969 Bacteria 1810
244 Ga0213876_10004950 3300021384 Bacteria 7369
245 Ga0209233_1019579 3300025261 Unclassified 1797
246 Ga0207697_10020567 3300025315 Bacteria 2701
247 Ga0207697_10042643 3300025315 Bacteria 1865
248 Ga0207697_10050290 3300025315 Bacteria 1721
249 Ga0207653_10010807 3300025885 Bacteria 2848
250 Ga0207642_10011965 3300025899 Bacteria 3116
251 Ga0207642_10055947 3300025899 Unclassified 1807
252 Ga0207680_10130939 3300025903 Unclassified 1653
253 Ga0207645_10000804 3300025907 Bacteria 26273
254 Ga0207645_10127125 3300025907 Bacteria 1657
255 Ga0207643_10123926 3300025908 Bacteria 1533
256 Ga0207643_10192232 3300025908 Bacteria 1239
257 Ga0207684_10176323 3300025910 Bacteria 1843
258 Ga0207695_10005122 3300025913 Bacteria 17554
259 Ga0207671_10013289 3300025914 Bacteria 6566
260 Ga0207671_10051197 3300025914 Bacteria 3060
261 Ga0207663_10142523 3300025916 Unclassified 1671
262 Ga0207662_10071820 3300025918 Bacteria 2096
263 Ga0207662_10198220 3300025918 Bacteria 1298
264 Ga0207649_10030243 3300025920 Bacteria 3206
265 Ga0207646_10016862 3300025922 Bacteria 6850
266 Ga0207646_10393515 3300025922 Bacteria 1252
267 Ga0207681_10025279 3300025923 Bacteria 3818
268 Ga0207681_10030400 3300025923 Bacteria 3521
269 Ga0207681_10081155 3300025923 Bacteria 2289
270 Ga0207681_10182018 3300025923 Unclassified 1601
271 Ga0207650_10003679 3300025925 Bacteria 10485
272 Ga0207650_10026061 3300025925 Bacteria 4167
273 Ga0207650_10037884 3300025925 Unclassified 3517
274 Ga0207659_10005994 3300025926 Bacteria 7417
275 Ga0207659_10066222 3300025926 Bacteria 2621
276 Ga0207659_10067756 3300025926 Bacteria 2594
277 Ga0207659_10071434 3300025926 Bacteria 2534
278 Ga0207659_10208373 3300025926 Bacteria 1565
279 Ga0207687_10006338 3300025927 Bacteria 7820
280 Ga0207687_10379211 3300025927 Bacteria 1158
281 Ga0207644_10033982 3300025931 Unclassified 3568
282 Ga0207644_10195946 3300025931 Bacteria 1591
283 Ga0207644_10528030 3300025931 Bacteria 975
284 Ga0207690_10005377 3300025932 Bacteria 7547
285 Ga0207690_10046927 3300025932 Bacteria 2864
286 Ga0207706_10081915 3300025933 Bacteria 2836
287 Ga0207706_10161132 3300025933 Bacteria 1972
288 Ga0207706_10212742 3300025933 Unclassified 1694
289 Ga0207706_10329730 3300025933 Bacteria 1328
290 Ga0207706_10358880 3300025933 Bacteria 1266
291 Ga0207686_10086673 3300025934 Bacteria 2057
292 Ga0207709_10041625 3300025935 Bacteria 2758
293 Ga0207670_10113803 3300025936 Bacteria 1954
294 Ga0207670_10139198 3300025936 Bacteria 1788
295 Ga0207669_10012276 3300025937 Bacteria 4207
296 Ga0207669_10325309 3300025937 Unclassified 1178
297 Ga0207704_10383644 3300025938 Bacteria 1104
298 Ga0207691_10010489 3300025940 Bacteria 8889
299 Ga0207691_10027883 3300025940 Bacteria 5292
300 Ga0207691_10103756 3300025940 Bacteria 2535
301 Ga0207691_10169390 3300025940 Bacteria 1913
302 Ga0207691_10170541 3300025940 Bacteria 1906
303 Ga0207691_10449072 3300025940 Bacteria 1097
304 Ga0207711_10065908 3300025941 Bacteria 3131
305 Ga0207711_10157548 3300025941 Bacteria 2053
306 Ga0207711_10231606 3300025941 Bacteria 1692
307 Ga0207711_10319158 3300025941 Bacteria 1435
308 Ga0207689_10024666 3300025942 Bacteria 5043
309 Ga0207689_10065710 3300025942 Bacteria 2983
310 Ga0207689_10141081 3300025942 Bacteria 1985
311 Ga0207661_10351541 3300025944 Bacteria 1330
312 Ga0207679_10024433 3300025945 Bacteria 4143
313 Ga0207679_10057722 3300025945 Bacteria 2872
314 Ga0207679_10479825 3300025945 Bacteria 1107
315 Ga0207651_10098452 3300025960 Bacteria 2163
316 Ga0207651_10266059 3300025960 Unclassified 1410
317 Ga0207651_10267185 3300025960 Unclassified 1407
318 Ga0207712_10021744 3300025961 Bacteria 4215
319 Ga0207712_10057080 3300025961 Bacteria 2753
320 Ga0207668_10020661 3300025972 Bacteria 4189
321 Ga0207668_10071757 3300025972 Bacteria 2475
322 Ga0207640_10044366 3300025981 Bacteria 2848
323 Ga0207658_10084622 3300025986 Bacteria 2441
324 Ga0207658_10089253 3300025986 Bacteria 2386
325 Ga0207658_10100520 3300025986 Bacteria 2264
326 Ga0207703_10035124 3300026035 Bacteria 3983
327 Ga0207703_10044000 3300026035 Bacteria 3586
328 Ga0207703_10081312 3300026035 Bacteria 2700
329 Ga0207703_10188251 3300026035 Bacteria 1826
330 Ga0207703_10248801 3300026035 Bacteria 1601
331 Ga0207678_10047182 3300026067 Bacteria 3725
332 Ga0207678_10076650 3300026067 Bacteria 2864
333 Ga0207678_10158056 3300026067 Bacteria 1936
334 Ga0207708_10003824 3300026075 Bacteria 11093
335 Ga0207708_10020342 3300026075 Bacteria 5006
336 Ga0207708_10337872 3300026075 Unclassified 1233
337 Ga0207641_10004085 3300026088 Bacteria 12730
338 Ga0207641_10141404 3300026088 Bacteria 2172
339 Ga0207641_10302556 3300026088 Unclassified 1511
340 Ga0207648_10014545 3300026089 Bacteria 7267
341 Ga0207648_10185321 3300026089 Bacteria 1843
342 Ga0207648_10243931 3300026089 Bacteria 1600
343 Ga0207676_10039911 3300026095 Bacteria 3595
344 Ga0207674_10049905 3300026116 Bacteria 4277
345 Ga0207675_100029241 3300026118 Bacteria 5135
346 Ga0207675_100030141 3300026118 Bacteria 5052
347 Ga0207675_100165722 3300026118 Bacteria 2110
348 Ga0207683_10058533 3300026121 Unclassified 3383
349 Ga0207683_10093453 3300026121 Bacteria 2680
350 Ga0207683_10252192 3300026121 Bacteria 1611
351 Ga0207683_10351557 3300026121 Bacteria 1353
352 Ga0207428_10001837 3300027907 Bacteria 21694
353 Ga0207428_10001904 3300027907 Bacteria 21126
354 Ga0207428_10007449 3300027907 Bacteria 9978
355 Ga0207428_10029539 3300027907 Bacteria 4542
356 Ga0207428_10085796 3300027907 Bacteria 2451
357 Ga0268266_10079221 3300028379 Bacteria 2860
358 Ga0268266_10380330 3300028379 Bacteria 1331
359 Ga0268265_10025525 3300028380 Bacteria 4196
360 Ga0268265_10040852 3300028380 Bacteria 3427
361 Ga0268265_10086542 3300028380 Bacteria 2491
362 Ga0268265_10368701 3300028380 Bacteria 1317
363 Ga0268264_10025268 3300028381 Bacteria 4852
364 Ga0268264_10108916 3300028381 Unclassified 2422
365 Ga0268264_10114073 3300028381 Bacteria 2372
366 Ga0265318_10004009 3300028577 Bacteria 7237
367 Ga0265332_10039805 3300031238 Bacteria 2036
368 Ga0265325_10027723 3300031241 Bacteria 3059
369 Ga0265331_10054564 3300031250 Bacteria 1903
370 Ga0265327_10001437 3300031251 Bacteria 30049
371 Ga0307408_100081907 3300031548 Bacteria 2414
372 Ga0265313_10001152 3300031595 Bacteria 25241
373 Ga0265313_10001905 3300031595 Bacteria 18928
374 Ga0265314_10016561 3300031711 Bacteria 5816
375 Ga0265314_10240943 3300031711 Bacteria 1043
376 Ga0307405_10121033 3300031731 Unclassified 1791
377 Ga0307406_10179768 3300031901 Bacteria 1539
378 Ga0307412_10057475 3300031911 Bacteria 2597
379 Ga0307412_10209875 3300031911 Bacteria 1485
380 Ga0307409_100113691 3300031995 Bacteria 2276
381 Ga0307409_100179175 3300031995 Bacteria 1874
382 Ga0307416_100068300 3300032002 Bacteria 2936
383 Ga0307416_100128895 3300032002 Unclassified 2272
384 Ga0307416_100327664 3300032002 Bacteria 1537
385 Ga0373930_0021218 3300034816 Unclassified 1273
386 Ga0373948_0001611 3300034817 Bacteria 3176
387 Ga0373958_0002224 3300034819 Bacteria 2698
388 Ga0373929_0008401 3300035085 Bacteria 1902
389 Ga0373940_0000583 3300035088 Bacteria 5782
390 Ga0373949_0011597 3300035090 Bacteria 1942
391 Ga0373951_0005351 3300035091 Bacteria 2988
392 Ga0373952_0011301 3300035092 Unclassified 1739
393 Ga0373932_0008069 3300035112 Bacteria 2513
394 Ga0373939_0002246 3300035114 Bacteria 4574
395 Ga0373960_0003013 3300035121 Bacteria 3804
396 Ga0373942_0007510 3300035207 Bacteria 2530
397 Ga0373961_0005703 3300035241 Bacteria 2990
398 Ga0373937_0006222 3300036401 Bacteria 10289
399 Ga0373925_0199463 3300037068 Bacteria 1591
400 Ga0436365_0244169 3300039437 Bacteria 18531
401 Ga0436365_0871216 3300039437 Bacteria 3063
402 Ga0439460_0023878 3300042461 Bacteria 1689
403 Ga0451576_0006732 3300045051 Bacteria 14000
404 Ga0495629_0176010 3300046459 Bacteria 1484
405 Ga0495641_0012535 3300046461 Bacteria 4731
406 Ga0495582_0046100 3300046473 Unclassified 2401
407 Ga0495618_0107152 3300046514 Bacteria 1790
408 Ga0495630_0214809 3300046517 Bacteria 1468
409 Ga0495640_0075967 3300046533 Bacteria 2242
410 Ga0495586_0002638 3300046535 Bacteria 9700
411 Ga0495598_0014620 3300046537 Bacteria 1966
412 Ga0495658_0040296 3300046683 Bacteria 2596
413 Ga0495613_0012126 3300046689 Bacteria 6406
414 Ga0495676_0017461 3300047321 Bacteria 6344
415 Ga0495675_0059623 3300047444 Bacteria 2420
416 Ga0496101_0284193 3300048904 Unclassified 1294
417 Ga0496102_0112830 3300048905 Unclassified 2536
418 Ga0496102_0373169 3300048905 Unclassified 1342
419 Ga0496103_0044769 3300048906 Bacteria 2728
420 Ga0496103_0199181 3300048906 Bacteria 1288
421 Ga0496104_0003957 3300048907 Bacteria 12830
422 Ga0496104_0078549 3300048907 Bacteria 3145
423 Ga0496104_0170336 3300048907 Bacteria 2088
424 Ga0496104_0339669 3300048907 Bacteria 1415
425 Ga0496105_0087496 3300048908 Bacteria 2574
426 Ga0496106_0164312 3300048909 Bacteria 1757
427 Ga0496106_0327574 3300048909 Unclassified 1229
428 Ga0496107_0013489 3300048910 Bacteria 5714
429 Ga0496109_0007788 3300048912 Bacteria 9071
430 Ga0496109_0164732 3300048912 Bacteria 2078
431 Ga0496109_0184963 3300048912 Bacteria 1958
432 Ga0496109_0447058 3300048912 Unclassified 1221
433 Ga0496110_0000770 3300048913 Bacteria 22239
434 Ga0496111_0026936 3300048914 Bacteria 4062
435 Ga0496112_0001715 3300048915 Bacteria 17118
436 Ga0496112_0056716 3300048915 Bacteria 3856
437 Ga0496112_0101067 3300048915 Bacteria 2853
438 Ga0496112_0183834 3300048915 Bacteria 2054
439 Ga0496112_0268590 3300048915 Unclassified 1654
440 Ga0496113_0101228 3300048916 Bacteria 2233
441 Ga0496114_0099554 3300048917 Bacteria 2480
442 Ga0496114_0140405 3300048917 Bacteria 2091
443 Ga0496115_0021415 3300048918 Bacteria 4995
444 Ga0496115_0252726 3300048918 Bacteria 1451
445 Ga0501034_0031758 3300049571 Bacteria 5364
446 Ga0501046_0002445 3300049580 Bacteria 17413
447 Ga0501047_0012036 3300049581 Bacteria 8187
448 Ga0501073_0032333 3300049589 Bacteria 3729
449 Ga0501080_0012281 3300049742 Bacteria 7847
450 Ga0501044_0072369 3300049823 Bacteria 3504
451 nmdc:mga03683_20733_c1 3300050489 Unclassified 2526
452 nmdc:mga03n38_185096_c1 3300050490 Bacteria 1069
453 nmdc:mga00v17_22756_c1 3300050491 Bacteria 3620
454 nmdc:mga00v17_5958_c1 3300050491 Bacteria 6448
455 nmdc:mga0yw44_146865_c1 3300050492 Bacteria 1536
456 nmdc:mga0yw44_52241_c1 3300050492 Bacteria 2477
457 nmdc:mga0k408_5358_c1 3300050493 Bacteria 6820
458 nmdc:mga0k408_6908_c1 3300050493 Bacteria 6056
459 nmdc:mga06z11_4207_c1 3300050494 Bacteria 5638
460 nmdc:mga07m45_24660_c1 3300050496 Bacteria 3296
461 nmdc:mga07m45_7248_c2 3300050496 Bacteria 3368
462 nmdc:mga05p37_115886_c1 3300050507 Bacteria 3293
463 nmdc:mga05p37_1392_c1 3300050507 Bacteria 28148
464 nmdc:mga05p37_15351_c1 3300050507 Bacteria 9203
465 nmdc:mga05p37_190330_c1 3300050507 Bacteria 2492
466 nmdc:mga05p37_33240_c1 3300050507 Bacteria 6316
467 nmdc:mga05p37_54887_c1 3300050507 Bacteria 4900
468 nmdc:mga05p37_5848_c1 3300050507 Bacteria 14463
469 nmdc:mga05p37_60627_c1 3300050507 Bacteria 4658
470 nmdc:mga05p37_618516_c1 3300050507 Unclassified 1219
471 nmdc:mga09592_115136_c1 3300050508 Unclassified 2308
472 nmdc:mga09592_427963_c1 3300050508 Unclassified 1143
473 nmdc:mga0qj67_39239_c1 3300050509 Bacteria 3718
474 nmdc:mga0qj67_43381_c1 3300050509 Bacteria 3542
475 nmdc:mga0qj67_96495_c1 3300050509 Bacteria 2380
476 nmdc:mga06r32_107201_c1 3300050510 Bacteria 2745
477 nmdc:mga06r32_108140_c1 3300050510 Bacteria 2733
478 nmdc:mga06r32_140144_c2 3300050510 Bacteria 2060
479 nmdc:mga06r32_205987_c1 3300050510 Bacteria 1955
480 nmdc:mga06r32_79812_c1 3300050510 Bacteria 3184
481 nmdc:mga08y16_2864_c1 3300050511 Bacteria 17742
482 nmdc:mga08y16_310093_c1 3300050511 Bacteria 1625
483 nmdc:mga08y16_37445_c1 3300050511 Bacteria 5094
484 nmdc:mga08y16_76333_c1 3300050511 Unclassified 3493
485 nmdc:mga08y16_77458_c1 3300050511 Bacteria 3467
486 nmdc:mga08y16_9182_c1 3300050511 Bacteria 10379
487 nmdc:mga08y16_9595_c1 3300050511 Bacteria 10162
488 nmdc:mga0n895_106997_c1 3300050512 Bacteria 2810
489 nmdc:mga0n895_16021_c1 3300050512 Bacteria 6865
490 nmdc:mga0n895_2025_c1 3300050512 Bacteria 15592
491 nmdc:mga0n895_211348_c1 3300050512 Unclassified 1970
492 nmdc:mga0n895_275385_c1 3300050512 Bacteria 1707
493 nmdc:mga0n895_377_c1 3300050512 Bacteria 30222
494 nmdc:mga0n895_488513_c1 3300050512 Bacteria 1241
495 nmdc:mga0n895_53298_c1 3300050512 Unclassified 3974
496 nmdc:mga0rr50_212597_c1 3300050513 Unclassified 1594
497 nmdc:mga0rr50_3_c1 3300050513 Bacteria 353622
498 nmdc:mga0rr50_46223_c1 3300050513 Bacteria 3205
499 nmdc:mga0rr50_613_c1 3300050513 Bacteria 19109
500 nmdc:mga0rr50_62382_c1 3300050513 Bacteria 2812
501 nmdc:mga0rr50_88724_c1 3300050513 Unclassified 2403
502 nmdc:mga08x19_31027_c1 3300050514 Bacteria 3360
503 nmdc:mga08x19_6905_c1 3300050514 Bacteria 6744
504 nmdc:mga0a205_103211_c1 3300050515 Unclassified 2750
505 nmdc:mga0a205_105709_c1 3300050515 Bacteria 2714
506 nmdc:mga0a205_127483_c1 3300050515 Bacteria 2445
507 nmdc:mga0a205_19233_c1 3300050515 Bacteria 6436
508 nmdc:mga0a205_206211_c1 3300050515 Bacteria 1855
509 nmdc:mga0a205_282537_c1 3300050515 Bacteria 1535
510 nmdc:mga0a205_34776_c1 3300050515 Bacteria 4091
511 nmdc:mga0a205_48049_c1 3300050515 Unclassified 4118
512 nmdc:mga0a205_81970_c1 3300050515 Bacteria 3116
513 Ga0495601_0090282 3300053077 Archaea 1971
514 Ga0500641_0054314 3300053096 Bacteria 1656
515 Ga0500555_022119 3300053103 Unclassified 1829
516 Ga0500555_030032 3300053103 Bacteria 1543
517 Ga0500562_040984 3300053108 Bacteria 1231
518 Ga0500628_008261 3300053129 Unclassified 1806
519 Ga0500627_0064849 3300053158 Bacteria 1611
520 2522550731 2522125168 Bacteria 7376607
521 2852630843 2852627209 Bacteria 5896285
522 Ga0207675_100363023
523 Ga0065712_10068264
524 Ga0065712_10076173
525 Ga0065715_10131870
526 Ga0065715_10164763
527 Ga0065715_10171102
528 Ga0065707_10089170
529 Ga0065707_10123928
530 Ga0065707_10225888
531 Ga0070676_10123608
532 Ga0070676_10243043
533 Ga0070683_100003040
534 Ga0070690_100060976
535 Ga0070690_100199507
536 Ga0070690_100207179
537 Ga0070670_100007291
538 Ga0070670_100016433
539 Ga0068869_100023171
540 Ga0070666_10003190
541 Ga0070666_10395841
542 Ga0068868_100174171
543 Ga0070691_10012595
544 Ga0070661_100010600
545 Ga0070668_100012660
546 Ga0070669_100000399
547 Ga0070669_100003900
548 Ga0070669_100031975
549 Ga0070669_100071874
550 Ga0070675_100006634
551 Ga0070675_100039614
552 Ga0070675_100054172
553 Ga0070671_100014363
554 Ga0070671_100046722
555 Ga0070671_100113010
556 Ga0070671_100386889
557 Ga0070674_100037648
558 Ga0070673_100113750
559 Ga0070673_100186676
560 Ga0070688_100136307
561 Ga0070688_100167743
562 Ga0070659_100010394
563 Ga0070659_100023680
564 Ga0070667_100003115
565 Ga0070667_100173765
566 Ga0070667_100181016
567 Ga0070667_100459659
568 Ga0070701_10015238
569 Ga0070705_100011019
570 Ga0070700_100193990
571 Ga0070700_100195485
572 Ga0070694_100108358
573 Ga0070663_100134799
574 Ga0070678_100098970
575 Ga0070678_100279735
576 Ga0070662_100016355
577 Ga0070662_100343127
578 Ga0070681_10115060
579 Ga0068867_100046155
580 Ga0070699_100006833
581 Ga0070699_100028039
582 Ga0070699_100136266
583 Ga0070679_100131850
584 Ga0070684_100000221
585 Ga0070684_100016397
586 Ga0070684_100093195
587 Ga0070672_100005613
588 Ga0070672_100101658
589 Ga0070672_100108026
590 Ga0070672_100110306
591 Ga0070686_100000969
592 Ga0070686_100031341
593 Ga0070686_100043539
594 Ga0070686_100047390
595 Ga0070696_100033071
596 Ga0070693_100299756
597 Ga0070665_100014601
598 Ga0070665_100018633
599 Ga0070665_100149116
600 Ga0070665_100166623
601 Ga0070665_100530325
602 Ga0070704_100061746
603 Ga0070704_100082073
604 Ga0070664_100000594
605 Ga0070664_100124266
606 Ga0070664_100264080
607 Ga0070664_100473306
608 Ga0068857_100038274
609 Ga0068854_100021164
610 Ga0068854_100040191
611 Ga0070702_100003201
612 Ga0068859_100009348
613 Ga0068859_100171671
614 Ga0068859_100284054
615 Ga0068859_100598380
616 Ga0068866_10027694
617 Ga0068861_100018284
618 Ga0068861_100079929
619 Ga0068861_100121247
620 Ga0068861_100442946
621 Ga0068870_10091158
622 Ga0068870_10134653
623 Ga0068863_100024354
624 Ga0068858_100020888
625 Ga0068858_100170564
626 Ga0068858_100217085
627 Ga0068860_100076007
628 Ga0068860_100076072
629 Ga0068862_100195380
630 Ga0068862_100209106
631 Ga0068862_100216429
632 Ga0068862_100293028
633 Ga0081455_10153261
634 Ga0081539_10001702
635 Ga0081539_10003210
636 Ga0070717_10559225
637 Ga0075368_10030831
638 Ga0075368_10058388
639 Ga0075364_10004288
640 Ga0075364_10008316
641 Ga0075364_10107934
642 Ga0075364_10221408
643 Ga0075362_10000289
644 Ga0075367_10007213
645 Ga0075367_10010081
646 Ga0075367_10042372
647 Ga0075367_10081391
648 Ga0075366_10006779
649 Ga0075366_10007293
650 Ga0075366_10066262
651 Ga0097621_100033686
652 Ga0075370_10008742
653 Ga0075370_10009713
654 Ga0068871_100010948
655 Ga0068871_100062106
656 Ga0075428_100069462
657 Ga0075430_100042545
658 Ga0075430_100140301
659 Ga0075430_100174281
660 Ga0075431_100013095
661 Ga0075431_100017685
662 Ga0075431_100048190
663 Ga0075431_100051718
664 Ga0075431_100084674
665 Ga0075431_100217442
666 Ga0075433_10030214
667 Ga0075433_10072098
668 Ga0075433_10083092
669 Ga0075433_10158506
670 Ga0075433_10170805
671 Ga0075433_10301816
672 Ga0075433_10466384
673 Ga0075434_100000082
674 Ga0075434_100004513
675 Ga0075434_100014318
676 Ga0075434_100016028
677 Ga0075434_100016731
678 Ga0075434_100024631
679 Ga0075434_100025513
680 Ga0075434_100254330
681 Ga0075429_100020381
682 Ga0075429_100067160
683 Ga0075429_100270314
684 Ga0068865_100180172
685 Ga0068865_100280978
686 Ga0075436_100000504
687 Ga0075436_100035039
688 Ga0075436_100058478
689 Ga0075436_100106533
690 Ga0097620_100009348
691 Ga0097620_100171684
692 Ga0097620_100267623
693 Ga0097620_100284019
694 Ga0097620_100598464
695 Ga0075435_100000008
696 Ga0075435_100000748
697 Ga0075435_100008035
698 Ga0075435_100053096
699 Ga0075435_100061797
700 Ga0075435_100099942
701 Ga0075435_100224753
702 Ga0105240_10006874
703 Ga0105240_10196839
704 Ga0111539_10002189
705 Ga0111539_10005110
706 Ga0111539_10008895
707 Ga0111539_10028950
708 Ga0111539_10037657
709 Ga0111539_10048012
710 Ga0111539_10273520
711 Ga0111539_10285655
712 Ga0111539_10383970
713 Ga0111539_10744242
714 Ga0105245_10004043
715 Ga0105245_10257513
716 Ga0105247_10032367
717 Ga0114129_10000252
718 Ga0114129_10000310
719 Ga0114129_10005222
720 Ga0114129_10017323
721 Ga0114129_10037622
722 Ga0114129_10038253
723 Ga0114129_10059897
724 Ga0114129_10073288
725 Ga0114129_10103378
726 Ga0114129_10186666
727 Ga0114129_10236914
728 Ga0114129_10379678
729 Ga0105242_10035603
730 Ga0105248_10001596
731 Ga0105248_10092759
732 Ga0105248_10820449
733 Ga0105237_10002393
734 Ga0105237_10054125
735 Ga0105249_10003179
736 Ga0105249_10031197
737 Ga0105249_10602860
738 Ga0105249_10843737
739 Ga0105239_10407680
740 Ga0105239_10553809
741 Ga0105246_10119192
742 Ga0105246_10252040
743 Ga0157374_10023084
744 Ga0157374_10422619
745 Ga0157378_10204094
746 Ga0157378_10287647
747 Ga0157378_10304570
748 Ga0163162_10061369
749 Ga0163162_10201828
750 Ga0157375_10015088
751 Ga0157375_10136541
752 Ga0157375_10505152
753 Ga0163163_10057591
754 Ga0163163_10105589
755 Ga0163163_10233337
756 Ga0157380_10098978
757 Ga0157380_10283906
758 Ga0157380_10332864
759 Ga0157377_10084154
760 Ga0157379_10022582
761 Ga0157379_10245262
762 Ga0157376_10028685
763 Ga0157376_10103483
764 Ga0157376_10206651
765 Ga0213876_10004950
766 Ga0209233_1019579
767 Ga0207697_10020567
768 Ga0207697_10042643
769 Ga0207697_10050290
770 Ga0207653_10010807
771 Ga0207642_10011965
772 Ga0207642_10055947
773 Ga0207680_10130939
774 Ga0207645_10000804
775 Ga0207645_10127125
776 Ga0207643_10123926
777 Ga0207643_10192232
778 Ga0207684_10176323
779 Ga0207695_10005122
780 Ga0207671_10013289
781 Ga0207671_10051197
782 Ga0207663_10142523
783 Ga0207662_10071820
784 Ga0207662_10198220
785 Ga0207649_10030243
786 Ga0207646_10016862
787 Ga0207646_10393515
788 Ga0207681_10025279
789 Ga0207681_10030400
790 Ga0207681_10081155
791 Ga0207681_10182018
792 Ga0207650_10003679
793 Ga0207650_10026061
794 Ga0207650_10037884
795 Ga0207659_10005994
796 Ga0207659_10066222
797 Ga0207659_10067756
798 Ga0207659_10071434
799 Ga0207659_10208373
800 Ga0207687_10006338
801 Ga0207687_10379211
802 Ga0207644_10033982
803 Ga0207644_10195946
804 Ga0207644_10528030
805 Ga0207690_10005377
806 Ga0207690_10046927
807 Ga0207706_10081915
808 Ga0207706_10161132
809 Ga0207706_10212742
810 Ga0207706_10329730
811 Ga0207706_10358880
812 Ga0207686_10086673
813 Ga0207709_10041625
814 Ga0207670_10113803
815 Ga0207670_10139198
816 Ga0207669_10012276
817 Ga0207669_10325309
818 Ga0207704_10383644
819 Ga0207691_10010489
820 Ga0207691_10027883
821 Ga0207691_10103756
822 Ga0207691_10169390
823 Ga0207691_10170541
824 Ga0207691_10449072
825 Ga0207711_10065908
826 Ga0207711_10157548
827 Ga0207711_10231606
828 Ga0207711_10319158
829 Ga0207689_10024666
830 Ga0207689_10065710
831 Ga0207689_10141081
832 Ga0207661_10351541
833 Ga0207679_10024433
834 Ga0207679_10057722
835 Ga0207679_10479825
836 Ga0207651_10098452
837 Ga0207651_10266059
838 Ga0207651_10267185
839 Ga0207712_10021744
840 Ga0207712_10057080
841 Ga0207668_10020661
842 Ga0207668_10071757
843 Ga0207640_10044366
844 Ga0207658_10084622
845 Ga0207658_10089253
846 Ga0207658_10100520
847 Ga0207703_10035124
848 Ga0207703_10044000
849 Ga0207703_10081312
850 Ga0207703_10188251
851 Ga0207703_10248801
852 Ga0207678_10047182
853 Ga0207678_10076650
854 Ga0207678_10158056
855 Ga0207708_10003824
856 Ga0207708_10020342
857 Ga0207708_10337872
858 Ga0207641_10004085
859 Ga0207641_10141404
860 Ga0207641_10302556
861 Ga0207648_10014545
862 Ga0207648_10185321
863 Ga0207648_10243931
864 Ga0207676_10039911
865 Ga0207674_10049905
866 Ga0207675_100029241
867 Ga0207675_100030141
868 Ga0207675_100165722
869 Ga0207683_10058533
870 Ga0207683_10093453
871 Ga0207683_10252192
872 Ga0207683_10351557
873 Ga0207428_10001837
874 Ga0207428_10001904
875 Ga0207428_10007449
876 Ga0207428_10029539
877 Ga0207428_10085796
878 Ga0268266_10079221
879 Ga0268266_10380330
880 Ga0268265_10025525
881 Ga0268265_10040852
882 Ga0268265_10086542
883 Ga0268265_10368701
884 Ga0268264_10025268
885 Ga0268264_10108916
886 Ga0268264_10114073
887 Ga0265318_10004009
888 Ga0265332_10039805
889 Ga0265325_10027723
890 Ga0265331_10054564
891 Ga0265327_10001437
892 Ga0307408_100081907
893 Ga0265313_10001152
894 Ga0265313_10001905
895 Ga0265314_10016561
896 Ga0265314_10240943
897 Ga0307405_10121033
898 Ga0307406_10179768
899 Ga0307412_10057475
900 Ga0307412_10209875
901 Ga0307409_100113691
902 Ga0307409_100179175
903 Ga0307416_100068300
904 Ga0307416_100128895
905 Ga0307416_100327664
906 Ga0373930_0021218
907 Ga0373948_0001611
908 Ga0373958_0002224
909 Ga0373929_0008401
910 Ga0373940_0000583
911 Ga0373949_0011597
912 Ga0373951_0005351
913 Ga0373952_0011301
914 Ga0373932_0008069
915 Ga0373939_0002246
916 Ga0373960_0003013
917 Ga0373942_0007510
918 Ga0373961_0005703
919 Ga0373937_0006222
920 Ga0373925_0199463
921 Ga0436365_0244169
922 Ga0436365_0871216
923 Ga0439460_0023878
924 Ga0451576_0006732
925 Ga0495629_0176010
926 Ga0495641_0012535
927 Ga0495582_0046100
928 Ga0495618_0107152
929 Ga0495630_0214809
930 Ga0495640_0075967
931 Ga0495586_0002638
932 Ga0495598_0014620
933 Ga0495658_0040296
934 Ga0495613_0012126
935 Ga0495676_0017461
936 Ga0495675_0059623
937 Ga0496101_0284193
938 Ga0496102_0112830
939 Ga0496102_0373169
940 Ga0496103_0044769
941 Ga0496103_0199181
942 Ga0496104_0003957
943 Ga0496104_0078549
944 Ga0496104_0170336
945 Ga0496104_0339669
946 Ga0496105_0087496
947 Ga0496106_0164312
948 Ga0496106_0327574
949 Ga0496107_0013489
950 Ga0496109_0007788
951 Ga0496109_0164732
952 Ga0496109_0184963
953 Ga0496109_0447058
954 Ga0496110_0000770
955 Ga0496111_0026936
956 Ga0496112_0001715
957 Ga0496112_0056716
958 Ga0496112_0101067
959 Ga0496112_0183834
960 Ga0496112_0268590
961 Ga0496113_0101228
962 Ga0496114_0099554
963 Ga0496114_0140405
964 Ga0496115_0021415
965 Ga0496115_0252726
966 Ga0501034_0031758
967 Ga0501046_0002445
968 Ga0501047_0012036
969 Ga0501073_0032333
970 Ga0501080_0012281
971 Ga0501044_0072369
972 nmdc:mga03683_20733_c1
973 nmdc:mga03n38_185096_c1
974 nmdc:mga00v17_22756_c1
975 nmdc:mga00v17_5958_c1
976 nmdc:mga0yw44_146865_c1
977 nmdc:mga0yw44_52241_c1
978 nmdc:mga0k408_5358_c1
979 nmdc:mga0k408_6908_c1
980 nmdc:mga06z11_4207_c1
981 nmdc:mga07m45_24660_c1
982 nmdc:mga07m45_7248_c2
983 nmdc:mga05p37_115886_c1
984 nmdc:mga05p37_1392_c1
985 nmdc:mga05p37_15351_c1
986 nmdc:mga05p37_190330_c1
987 nmdc:mga05p37_33240_c1
988 nmdc:mga05p37_54887_c1
989 nmdc:mga05p37_5848_c1
990 nmdc:mga05p37_60627_c1
991 nmdc:mga05p37_618516_c1
992 nmdc:mga09592_115136_c1
993 nmdc:mga09592_427963_c1
994 nmdc:mga0qj67_39239_c1
995 nmdc:mga0qj67_43381_c1
996 nmdc:mga0qj67_96495_c1
997 nmdc:mga06r32_107201_c1
998 nmdc:mga06r32_108140_c1
999 nmdc:mga06r32_140144_c2
1000 nmdc:mga06r32_205987_c1
1001 nmdc:mga06r32_79812_c1
1002 nmdc:mga08y16_2864_c1
1003 nmdc:mga08y16_310093_c1
1004 nmdc:mga08y16_37445_c1
1005 nmdc:mga08y16_76333_c1
1006 nmdc:mga08y16_77458_c1
1007 nmdc:mga08y16_9182_c1
1008 nmdc:mga08y16_9595_c1
1009 nmdc:mga0n895_106997_c1
1010 nmdc:mga0n895_16021_c1
1011 nmdc:mga0n895_2025_c1
1012 nmdc:mga0n895_211348_c1
1013 nmdc:mga0n895_275385_c1
1014 nmdc:mga0n895_377_c1
1015 nmdc:mga0n895_488513_c1
1016 nmdc:mga0n895_53298_c1
1017 nmdc:mga0rr50_212597_c1
1018 nmdc:mga0rr50_3_c1
1019 nmdc:mga0rr50_46223_c1
1020 nmdc:mga0rr50_613_c1
1021 nmdc:mga0rr50_62382_c1
1022 nmdc:mga0rr50_88724_c1
1023 nmdc:mga08x19_31027_c1
1024 nmdc:mga08x19_6905_c1
1025 nmdc:mga0a205_103211_c1
1026 nmdc:mga0a205_105709_c1
1027 nmdc:mga0a205_127483_c1
1028 nmdc:mga0a205_19233_c1
1029 nmdc:mga0a205_206211_c1
1030 nmdc:mga0a205_282537_c1
1031 nmdc:mga0a205_34776_c1
1032 nmdc:mga0a205_48049_c1
1033 nmdc:mga0a205_81970_c1
1034 Ga0495601_0090282
1035 Ga0500641_0054314
1036 Ga0500555_022119
1037 Ga0500555_030032
1038 Ga0500562_040984
1039 Ga0500628_008261
1040 Ga0500627_0064849
1041 2522550731
1042 2852630843

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1x2e-assembly1.cif.gz_A the crystal structure of prolyl aminopeptidase complexed with ala-tboda 0.6717 44 93
1yix-assembly2.cif.gz_B crystal structure of ycfh, tatd homolog from escherichia coli k12, at 1.9 a resolution 0.6572 31 310
1zzm-assembly1.cif.gz_A crystal structure of yjjv, tatd homolog from escherichia coli k12, at 1.8 a resolution 0.6482 33 311
2gzx-assembly2.cif.gz_B crystal structure of the tatd deoxyribonuclease mw0446 from staphylococcus aureus. northeast structural genomics consortium target zr237. 0.6423 33 307
4jd0-assembly1.cif.gz_A structure of the inositol-1-phosphate ctp transferase from t. maritima. 0.638 44 96
ID Description Score Start End Superfamily
af_I6Y3Q7_2_272_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7674 43 312 3.20.20.140
af_Q50662_37_305_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7283 40 310 3.20.20.140
3cjpA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7064 33 310 3.20.20.140
3cjpA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7014 33 310 3.20.20.140
4jd0A00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.6873 44 86 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A2U3LW58-F1-model_v4 Amidohydrolase 2 0.9764 34 312 GO:0016787
GO:0016829
AF-A0A2U3LW58-F1-model_v4 Amidohydrolase 2 0.9626 34 312 GO:0016787
GO:0016829
AF-A0A831LXP0-F1-model_v4 Amidohydrolase 0.9481 14 311 GO:0016787
AF-A0A2V8EPR0-F1-model_v4 Amidohydrolase 0.9391 1 302 GO:0016787
AF-A0A355G789-F1-model_v4 Amidohydrolase 0.9237 109 312 GO:0016787

Map