F458708

General Info

Members Datasets Scaffolds Average Seq Length
521 268 1042 176

Family's Representative Sequence

Representative Sequence 3300025929|Ga0207664_10221334|Ga0207664_102213341
Length 166
Sequence MPTARSAVPDVLAPGLRVVFCGINPGRVSAAAQAHFANPRNDFWRLLHAAGFTPRLLEPSEQFELLKEGVGVTNAAARTTPGSGDLRRGDFAGAAERLARIDARWIGFVGKEAYRGTFNERPELGVQERTLGETRLFVLPSTSPANAAVSWDERLRWFRQLAGLAV

Samples

Sample ID Description Type Environment
1 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
156 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
160 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
161 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
162 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
163 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
164 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
165 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
166 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
167 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
168 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
169 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
170 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
171 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
172 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
173 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
174 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
175 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
184 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
185 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
186 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
187 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
188 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
189 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
190 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
191 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
192 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
193 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
194 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
195 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
196 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
197 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
198 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
199 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
200 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
201 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
202 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
205 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
206 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
207 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
208 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
209 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
210 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
211 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
212 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
213 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
214 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
215 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
216 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
217 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
218 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
219 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
220 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
221 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
224 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
225 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
234 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
243 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
244 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
245 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
246 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
247 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
248 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
249 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
250 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
251 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
252 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
253 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
254 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
255 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
256 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
257 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
258 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
259 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
260 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
261 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
262 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
263 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
264 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
265 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
266 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
267 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
268 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.25
Rhizosphere 91.36
Stem 0
Stem Tuber 0
Unclassified 15.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207664_10221334 3300025929 Bacteria 1642
2 Ga0070658_10519312 3300005327 Bacteria 1029
3 Ga0070676_10229251 3300005328 Bacteria 1230
4 Ga0070683_100146638 3300005329 Bacteria 2237
5 Ga0070680_100069462 3300005336 Bacteria 2892
6 Ga0070682_100003427 3300005337 Bacteria 8791
7 Ga0068868_100078910 3300005338 Bacteria 2636
8 Ga0068868_100085496 3300005338 Bacteria 2535
9 Ga0068868_100302145 3300005338 Bacteria 1359
10 Ga0070660_100002178 3300005339 Bacteria 13502
11 Ga0070660_100114920 3300005339 Bacteria 2145
12 Ga0070689_100068386 3300005340 Bacteria 2770
13 Ga0070689_100108180 3300005340 Bacteria 2208
14 Ga0070691_10024214 3300005341 Bacteria 2821
15 Ga0070687_100018669 3300005343 Bacteria 3213
16 Ga0070687_100172817 3300005343 Bacteria 1288
17 Ga0070661_100471097 3300005344 Unclassified 1001
18 Ga0070692_10003291 3300005345 Bacteria 6521
19 Ga0070692_10074617 3300005345 Bacteria 1815
20 Ga0070668_100030247 3300005347 Bacteria 4117
21 Ga0070668_100124787 3300005347 Unclassified 2061
22 Ga0070669_100022174 3300005353 Bacteria 4542
23 Ga0070669_100040506 3300005353 Bacteria 3386
24 Ga0070675_100086740 3300005354 Bacteria 2616
25 Ga0070671_100112937 3300005355 Bacteria 2283
26 Ga0070674_100004345 3300005356 Bacteria 8078
27 Ga0070674_100055001 3300005356 Bacteria 2754
28 Ga0070673_100025387 3300005364 Bacteria 4361
29 Ga0070688_100141340 3300005365 Unclassified 1635
30 Ga0070659_100009139 3300005366 Bacteria 7269
31 Ga0070659_100276346 3300005366 Bacteria 1397
32 Ga0070667_100396110 3300005367 Bacteria 1256
33 Ga0070703_10009590 3300005406 Bacteria 2731
34 Ga0070709_10014742 3300005434 Bacteria 4428
35 Ga0070709_10344204 3300005434 Bacteria 1100
36 Ga0070714_100091443 3300005435 Bacteria 2666
37 Ga0070714_100786998 3300005435 Unclassified 921
38 Ga0070711_100004428 3300005439 Bacteria 8290
39 Ga0070711_100086586 3300005439 Bacteria 2247
40 Ga0070711_100157977 3300005439 Bacteria 1716
41 Ga0070705_100023777 3300005440 Bacteria 3296
42 Ga0070705_100097046 3300005440 Bacteria 1851
43 Ga0070705_100315228 3300005440 Bacteria 1126
44 Ga0070700_100000793 3300005441 Bacteria 15518
45 Ga0070700_100071463 3300005441 Bacteria 2215
46 Ga0070694_100339062 3300005444 Bacteria 1161
47 Ga0070708_100503530 3300005445 Bacteria 1142
48 Ga0070663_100130683 3300005455 Bacteria 1906
49 Ga0070678_100092759 3300005456 Bacteria 2320
50 Ga0070678_100197800 3300005456 Bacteria 1657
51 Ga0070662_100130136 3300005457 Bacteria 1939
52 Ga0070681_10059218 3300005458 Bacteria 3809
53 Ga0068867_100001828 3300005459 Bacteria 14831
54 Ga0070685_10001941 3300005466 Bacteria 10742
55 Ga0070685_10031896 3300005466 Unclassified 2947
56 Ga0070706_100353302 3300005467 Unclassified 1370
57 Ga0070707_100030516 3300005468 Bacteria 5133
58 Ga0070698_100302302 3300005471 Unclassified 1531
59 Ga0070698_100878516 3300005471 Bacteria 842
60 Ga0070699_100015598 3300005518 Bacteria 6527
61 Ga0070699_100032392 3300005518 Bacteria 4513
62 Ga0070679_100031019 3300005530 Bacteria 5281
63 Ga0070679_100090650 3300005530 Bacteria 3045
64 Ga0070679_100910143 3300005530 Unclassified 823
65 Ga0070684_100120560 3300005535 Bacteria 2360
66 Ga0070684_100166266 3300005535 Unclassified 2002
67 Ga0070684_100390310 3300005535 Bacteria 1283
68 Ga0070684_100460497 3300005535 Bacteria 1176
69 Ga0070684_100846989 3300005535 Bacteria 856
70 Ga0068853_100006599 3300005539 Bacteria 9240
71 Ga0068853_100031411 3300005539 Bacteria 4493
72 Ga0070672_100023803 3300005543 Bacteria 4518
73 Ga0070686_100000943 3300005544 Bacteria 16754
74 Ga0070686_100334848 3300005544 Unclassified 1132
75 Ga0070695_100112402 3300005545 Bacteria 1850
76 Ga0070695_100366275 3300005545 Bacteria 1084
77 Ga0070695_100710228 3300005545 Bacteria 799
78 Ga0070696_100036145 3300005546 Bacteria 3404
79 Ga0070696_100132041 3300005546 Bacteria 1818
80 Ga0070696_100152236 3300005546 Bacteria 1698
81 Ga0070696_100321710 3300005546 Unclassified 1190
82 Ga0070693_100056774 3300005547 Bacteria 2261
83 Ga0070693_100078425 3300005547 Bacteria 1963
84 Ga0070693_100190625 3300005547 Bacteria 1325
85 Ga0070693_100633386 3300005547 Unclassified 776
86 Ga0070665_100009747 3300005548 Bacteria 9712
87 Ga0070665_100127885 3300005548 Bacteria 2543
88 Ga0070704_100035028 3300005549 Bacteria 3409
89 Ga0070704_100074151 3300005549 Bacteria 2481
90 Ga0070704_100317094 3300005549 Bacteria 1305
91 Ga0070704_100602484 3300005549 Bacteria 966
92 Ga0068855_100051609 3300005563 Bacteria 4845
93 Ga0068855_100065892 3300005563 Bacteria 4223
94 Ga0068855_100140136 3300005563 Bacteria 2757
95 Ga0068855_100834414 3300005563 Bacteria 978
96 Ga0070664_100558913 3300005564 Unclassified 1058
97 Ga0070664_100763331 3300005564 Bacteria 903
98 Ga0068857_100459200 3300005577 Bacteria 1191
99 Ga0068854_100065487 3300005578 Bacteria 2642
100 Ga0068854_100138859 3300005578 Bacteria 1863
101 Ga0068854_100164443 3300005578 Bacteria 1721
102 Ga0068856_100033258 3300005614 Bacteria 5048
103 Ga0068856_100316712 3300005614 Bacteria 1577
104 Ga0070702_100032774 3300005615 Bacteria 2853
105 Ga0070702_100035653 3300005615 Bacteria 2749
106 Ga0070702_100050214 3300005615 Bacteria 2381
107 Ga0070702_100057486 3300005615 Bacteria 2250
108 Ga0068852_100067057 3300005616 Bacteria 3137
109 Ga0068852_100081570 3300005616 Unclassified 2871
110 Ga0068852_100089234 3300005616 Bacteria 2755
111 Ga0068859_100060646 3300005617 Bacteria 3812
112 Ga0068859_100120582 3300005617 Unclassified 2689
113 Ga0068864_100071551 3300005618 Bacteria 3020
114 Ga0068866_10000474 3300005718 Bacteria 18425
115 Ga0068866_10138000 3300005718 Bacteria 1396
116 Ga0068861_100149175 3300005719 Bacteria 1917
117 Ga0068861_100176073 3300005719 Bacteria 1777
118 Ga0068861_101099605 3300005719 Bacteria 764
119 Ga0068863_100210195 3300005841 Bacteria 1874
120 Ga0068860_100237655 3300005843 Bacteria 1772
121 Ga0068860_100723731 3300005843 Bacteria 1006
122 Ga0068862_100024427 3300005844 Bacteria 5071
123 Ga0068862_100452890 3300005844 Bacteria 1210
124 Ga0081455_10055607 3300005937 Unclassified 3366
125 Ga0081540_1002674 3300005983 Bacteria 14506
126 Ga0081540_1015841 3300005983 Bacteria 4752
127 Ga0081540_1020783 3300005983 Bacteria 3933
128 Ga0081539_10002547 3300005985 Bacteria 25323
129 Ga0081539_10052764 3300005985 Bacteria 2281
130 Ga0075432_10025065 3300006058 Bacteria 2045
131 Ga0070716_100060226 3300006173 Bacteria 2192
132 Ga0070712_100003615 3300006175 Bacteria 9533
133 Ga0070712_100327938 3300006175 Bacteria 1246
134 Ga0070712_100338380 3300006175 Bacteria 1228
135 Ga0070712_100452436 3300006175 Bacteria 1069
136 Ga0097621_100002348 3300006237 Bacteria 12972
137 Ga0097621_100325089 3300006237 Bacteria 1363
138 Ga0068871_100052391 3300006358 Bacteria 3305
139 Ga0068871_101135148 3300006358 Unclassified 732
140 Ga0075428_100452356 3300006844 Bacteria 1375
141 Ga0075430_100000493 3300006846 Bacteria 29659
142 Ga0075431_100060380 3300006847 Bacteria 3912
143 Ga0075429_100026977 3300006880 Bacteria 4988
144 Ga0068865_100001504 3300006881 Bacteria 13602
145 Ga0068865_100317439 3300006881 Unclassified 1252
146 Ga0097620_100060647 3300006931 Bacteria 3812
147 Ga0097620_100120586 3300006931 Unclassified 2689
148 Ga0105244_10293148 3300009036 Unclassified 753
149 Ga0105240_10565134 3300009093 Bacteria 1257
150 Ga0111539_10016684 3300009094 Bacteria 9102
151 Ga0111539_10416277 3300009094 Bacteria 1565
152 Ga0111539_11096568 3300009094 Bacteria 925
153 Ga0111539_11845415 3300009094 Bacteria 701
154 Ga0105245_10015468 3300009098 Bacteria 6652
155 Ga0105245_10038391 3300009098 Bacteria 4261
156 Ga0105245_10407030 3300009098 Unclassified 1361
157 Ga0105245_10477458 3300009098 Bacteria 1259
158 Ga0105245_10490961 3300009098 Bacteria 1242
159 Ga0114129_10028938 3300009147 Bacteria 7849
160 Ga0114129_10033847 3300009147 Bacteria 7218
161 Ga0114129_10117229 3300009147 Bacteria 3669
162 Ga0114129_10249717 3300009147 Unclassified 2382
163 Ga0114129_10668124 3300009147 Bacteria 1339
164 Ga0114129_11203189 3300009147 Bacteria 944
165 Ga0114129_11254325 3300009147 Bacteria 921
166 Ga0114129_11730430 3300009147 Bacteria 762
167 Ga0105243_10261797 3300009148 Bacteria 1549
168 Ga0105243_10330082 3300009148 Bacteria 1393
169 Ga0105243_11296072 3300009148 Bacteria 745
170 Ga0105242_10013668 3300009176 Bacteria 6278
171 Ga0105242_10084740 3300009176 Bacteria 2656
172 Ga0105242_10121684 3300009176 Bacteria 2241
173 Ga0105242_10442455 3300009176 Bacteria 1223
174 Ga0105248_10087843 3300009177 Bacteria 3499
175 Ga0105248_10849219 3300009177 Bacteria 1030
176 Ga0105237_10357938 3300009545 Unclassified 1464
177 Ga0105238_10926850 3300009551 Bacteria 890
178 Ga0105249_10003122 3300009553 Bacteria 14318
179 Ga0105249_10385168 3300009553 Bacteria 1429
180 Ga0105249_10442943 3300009553 Bacteria 1336
181 Ga0105239_10067585 3300010375 Bacteria 3926
182 Ga0105239_10487871 3300010375 Bacteria 1400
183 Ga0105246_10456472 3300011119 Bacteria 1075
184 Ga0157373_10099334 3300013100 Bacteria 2048
185 Ga0157371_10031088 3300013102 Bacteria 3847
186 Ga0157371_10251432 3300013102 Bacteria 1273
187 Ga0157378_10141598 3300013297 Bacteria 2234
188 Ga0157378_10184642 3300013297 Bacteria 1963
189 Ga0163162_10250073 3300013306 Bacteria 1905
190 Ga0163162_10373031 3300013306 Bacteria 1560
191 Ga0157372_10368450 3300013307 Bacteria 1674
192 Ga0157372_10429188 3300013307 Bacteria 1540
193 Ga0157372_10449562 3300013307 Bacteria 1502
194 Ga0157372_10687990 3300013307 Unclassified 1190
195 Ga0157375_10035258 3300013308 Bacteria 4774
196 Ga0157375_10244772 3300013308 Bacteria 1953
197 Ga0157375_11268080 3300013308 Bacteria 866
198 Ga0157380_10145357 3300014326 Bacteria 2043
199 Ga0157377_10319799 3300014745 Unclassified 1031
200 Ga0157377_10894691 3300014745 Bacteria 663
201 Ga0157376_10150849 3300014969 Bacteria 2096
202 Ga0163161_10017439 3300017792 Bacteria 5025
203 Ga0163161_10065022 3300017792 Bacteria 2661
204 Ga0163161_10109563 3300017792 Bacteria 2063
205 Ga0207692_10033919 3300025898 Bacteria 2467
206 Ga0207642_10005315 3300025899 Bacteria 4194
207 Ga0207688_10281289 3300025901 Bacteria 1014
208 Ga0207680_10397517 3300025903 Unclassified 973
209 Ga0207699_10095652 3300025906 Bacteria 1874
210 Ga0207645_10091910 3300025907 Unclassified 1952
211 Ga0207645_10098396 3300025907 Bacteria 1886
212 Ga0207643_10205776 3300025908 Bacteria 1200
213 Ga0207643_10416200 3300025908 Bacteria 851
214 Ga0207684_10012564 3300025910 Bacteria 7360
215 Ga0207707_10056782 3300025912 Bacteria 3406
216 Ga0207671_10288277 3300025914 Unclassified 1296
217 Ga0207693_10001256 3300025915 Bacteria 22567
218 Ga0207693_10018442 3300025915 Bacteria 5559
219 Ga0207663_10036737 3300025916 Bacteria 2948
220 Ga0207663_10078267 3300025916 Bacteria 2155
221 Ga0207660_10061300 3300025917 Bacteria 2707
222 Ga0207660_10081713 3300025917 Bacteria 2376
223 Ga0207662_10016416 3300025918 Bacteria 4179
224 Ga0207662_10033184 3300025918 Bacteria 3007
225 Ga0207657_10002716 3300025919 Bacteria 19059
226 Ga0207657_10008026 3300025919 Bacteria 10765
227 Ga0207657_10033070 3300025919 Bacteria 4666
228 Ga0207646_10024412 3300025922 Bacteria 5539
229 Ga0207694_10055033 3300025924 Bacteria 3088
230 Ga0207694_10264205 3300025924 Bacteria 1410
231 Ga0207687_10015306 3300025927 Bacteria 5026
232 Ga0207687_10016688 3300025927 Bacteria 4826
233 Ga0207687_10271442 3300025927 Unclassified 1356
234 Ga0207664_10043391 3300025929 Bacteria 3516
235 Ga0207664_10162214 3300025929 Bacteria 1907
236 Ga0207664_10699662 3300025929 Bacteria 911
237 Ga0207644_10039049 3300025931 Bacteria 3349
238 Ga0207644_10098344 3300025931 Bacteria 2193
239 Ga0207690_10498684 3300025932 Unclassified 984
240 Ga0207706_10004673 3300025933 Bacteria 12839
241 Ga0207706_10007297 3300025933 Bacteria 10217
242 Ga0207706_10087678 3300025933 Bacteria 2737
243 Ga0207686_10051304 3300025934 Bacteria 2570
244 Ga0207686_10465312 3300025934 Bacteria 975
245 Ga0207709_10000790 3300025935 Bacteria 24700
246 Ga0207709_10563157 3300025935 Unclassified 898
247 Ga0207670_10181815 3300025936 Bacteria 1584
248 Ga0207670_10645648 3300025936 Unclassified 872
249 Ga0207669_10024283 3300025937 Bacteria 3255
250 Ga0207669_10789518 3300025937 Bacteria 787
251 Ga0207704_10122629 3300025938 Bacteria 1782
252 Ga0207704_10320339 3300025938 Unclassified 1196
253 Ga0207665_10000494 3300025939 Bacteria 26650
254 Ga0207665_10131017 3300025939 Bacteria 1780
255 Ga0207691_10161839 3300025940 Bacteria 1963
256 Ga0207691_10224141 3300025940 Bacteria 1629
257 Ga0207691_10224680 3300025940 Bacteria 1627
258 Ga0207711_10298107 3300025941 Bacteria 1486
259 Ga0207689_10212311 3300025942 Bacteria 1599
260 Ga0207689_10374433 3300025942 Bacteria 1185
261 Ga0207661_10041126 3300025944 Bacteria 3638
262 Ga0207661_10112151 3300025944 Bacteria 2308
263 Ga0207661_10144181 3300025944 Bacteria 2052
264 Ga0207661_10218099 3300025944 Unclassified 1685
265 Ga0207661_10414937 3300025944 Unclassified 1222
266 Ga0207679_10739957 3300025945 Bacteria 894
267 Ga0207679_11252001 3300025945 Bacteria 681
268 Ga0207667_10113373 3300025949 Bacteria 2795
269 Ga0207667_10122858 3300025949 Bacteria 2675
270 Ga0207667_10193912 3300025949 Bacteria 2084
271 Ga0207651_10045043 3300025960 Bacteria 2957
272 Ga0207651_10077428 3300025960 Bacteria 2381
273 Ga0207712_10002935 3300025961 Bacteria 10891
274 Ga0207712_10014547 3300025961 Bacteria 5066
275 Ga0207712_10255727 3300025961 Unclassified 1418
276 Ga0207668_10232607 3300025972 Unclassified 1487
277 Ga0207640_10065760 3300025981 Bacteria 2420
278 Ga0207677_10101655 3300026023 Bacteria 2117
279 Ga0207677_10293831 3300026023 Bacteria 1340
280 Ga0207639_10033927 3300026041 Bacteria 3769
281 Ga0207678_10028168 3300026067 Bacteria 4905
282 Ga0207678_10163273 3300026067 Bacteria 1902
283 Ga0207708_10000415 3300026075 Bacteria 33470
284 Ga0207708_10053391 3300026075 Bacteria 3079
285 Ga0207708_10123428 3300026075 Bacteria 2020
286 Ga0207708_10135399 3300026075 Bacteria 1929
287 Ga0207702_10085454 3300026078 Bacteria 2749
288 Ga0207702_10329110 3300026078 Bacteria 1457
289 Ga0207641_10979006 3300026088 Bacteria 842
290 Ga0207648_10000705 3300026089 Bacteria 37489
291 Ga0207648_10018457 3300026089 Bacteria 6315
292 Ga0207676_10396060 3300026095 Bacteria 1289
293 Ga0207675_100007079 3300026118 Bacteria 10599
294 Ga0207675_100030064 3300026118 Bacteria 5058
295 Ga0207675_100077343 3300026118 Bacteria 3117
296 Ga0207683_10001271 3300026121 Bacteria 22865
297 Ga0207683_10239012 3300026121 Bacteria 1657
298 Ga0207683_10260157 3300026121 Unclassified 1584
299 Ga0207698_10101546 3300026142 Bacteria 2385
300 Ga0207698_10176944 3300026142 Bacteria 1885
301 Ga0209998_10026986 3300027717 Unclassified 1256
302 Ga0207428_10005188 3300027907 Bacteria 12188
303 Ga0207428_10014315 3300027907 Bacteria 6902
304 Ga0207428_10202205 3300027907 Bacteria 1494
305 Ga0268266_10062393 3300028379 Bacteria 3217
306 Ga0268265_10108556 3300028380 Bacteria 2260
307 Ga0268265_10383281 3300028380 Unclassified 1294
308 Ga0268265_10644887 3300028380 Bacteria 1017
309 Ga0268264_10619332 3300028381 Unclassified 1068
310 Ga0265325_10064263 3300031241 Bacteria 1855
311 Ga0265313_10021666 3300031595 Bacteria 3508
312 Ga0307409_100015022 3300031995 Bacteria 5064
313 Ga0307416_100946707 3300032002 Bacteria 963
314 Ga0373930_0078330 3300034816 Unclassified 761
315 Ga0373948_0016607 3300034817 Unclassified 1363
316 Ga0373958_0002201 3300034819 Bacteria 2708
317 Ga0373944_0004534 3300035089 Bacteria 3624
318 Ga0373944_0255604 3300035089 Unclassified 648
319 Ga0373949_0006529 3300035090 Bacteria 2565
320 Ga0373952_0004143 3300035092 Bacteria 2621
321 Ga0373952_0031011 3300035092 Unclassified 1187
322 Ga0373932_0027951 3300035112 Bacteria 1547
323 Ga0373939_0031704 3300035114 Bacteria 1530
324 Ga0373941_0072042 3300035115 Bacteria 1149
325 Ga0373945_0001806 3300035116 Bacteria 6608
326 Ga0373960_0309070 3300035121 Unclassified 590
327 Ga0373943_0006617 3300035170 Bacteria 5196
328 Ga0373946_0024020 3300035171 Bacteria 2386
329 Ga0373955_0014022 3300035172 Bacteria 3891
330 Ga0373962_0060931 3300035242 Unclassified 1108
331 Ga0373931_0566158 3300035691 Bacteria 740
332 Ga0373947_0015034 3300035725 Bacteria 4443
333 Ga0373937_0015252 3300036401 Bacteria 6793
334 Ga0373937_0258906 3300036401 Bacteria 1641
335 Ga0373925_0006938 3300037068 Bacteria 8287
336 Ga0373925_0093455 3300037068 Bacteria 2302
337 Ga0395899_0000775 3300037312 Bacteria 31562
338 Ga0395900_0032979 3300037418 Bacteria 5329
339 Ga0395900_0402851 3300037418 Unclassified 1332
340 Ga0395898_0007486 3300037466 Bacteria 11596
341 Ga0395898_0010278 3300037466 Bacteria 9794
342 Ga0395905_0005632 3300037471 Bacteria 12741
343 Ga0395905_0007567 3300037471 Bacteria 10792
344 Ga0395901_0001042 3300038443 Bacteria 29911
345 Ga0395901_0031712 3300038443 Bacteria 5448
346 Ga0395901_0546537 3300038443 Bacteria 1174
347 Ga0451802_0001768 3300041460 Unclassified 1546
348 Ga0451849_0249066 3300041505 Bacteria 861
349 Ga0451851_0487612 3300041507 Bacteria 1318
350 Ga0439448_0017308 3300042005 Bacteria 2200
351 Ga0439463_044457 3300042016 Unclassified 1131
352 Ga0439446_0018555 3300042156 Bacteria 1950
353 Ga0439458_0005488 3300042157 Bacteria 2851
354 Ga0450909_028575 3300042185 Unclassified 843
355 Ga0439440_0054117 3300042993 Bacteria 1010
356 Ga0451576_0006071 3300045051 Bacteria 14903
357 Ga0495603_0000062 3300046455 Bacteria 46880
358 Ga0495641_0001703 3300046461 Bacteria 18371
359 Ga0495651_0015981 3300046462 Bacteria 5814
360 Ga0495653_0114817 3300046463 Bacteria 1929
361 Ga0495582_0026753 3300046473 Bacteria 3162
362 Ga0495582_0226876 3300046473 Bacteria 1069
363 Ga0495662_0052833 3300046476 Bacteria 1962
364 Ga0495584_0173679 3300046491 Bacteria 1095
365 Ga0495594_0016528 3300046499 Bacteria 3888
366 Ga0495594_0065054 3300046499 Bacteria 2022
367 Ga0495607_0326778 3300046501 Bacteria 714
368 Ga0495608_0005502 3300046511 Bacteria 9047
369 Ga0495608_0452548 3300046511 Bacteria 781
370 Ga0495630_0476833 3300046517 Unclassified 956
371 Ga0495637_0200758 3300046520 Bacteria 733
372 Ga0495652_0358382 3300046529 Bacteria 1043
373 Ga0495665_0016492 3300046531 Bacteria 3980
374 Ga0495640_0099031 3300046533 Bacteria 1916
375 Ga0495640_0483452 3300046533 Unclassified 754
376 Ga0495609_0302709 3300046538 Unclassified 651
377 Ga0495634_0051392 3300046642 Bacteria 2765
378 Ga0495635_0036174 3300046663 Bacteria 3423
379 Ga0495635_0125193 3300046663 Bacteria 1752
380 Ga0495588_0017942 3300046674 Bacteria 3445
381 Ga0495657_0025486 3300046675 Bacteria 4198
382 Ga0495658_0041765 3300046683 Bacteria 2557
383 Ga0495660_0235109 3300046810 Bacteria 857
384 Ga0495581_0004207 3300047315 Bacteria 8298
385 Ga0495604_0205331 3300047317 Unclassified 1364
386 Ga0495676_0000253 3300047321 Bacteria 43107
387 Ga0495676_0017366 3300047321 Bacteria 6363
388 Ga0495680_0002766 3300047322 Bacteria 17688
389 Ga0495680_0523514 3300047322 Bacteria 802
390 Ga0496100_0011856 3300048903 Bacteria 4976
391 Ga0496100_0077845 3300048903 Bacteria 2231
392 Ga0496100_0138485 3300048903 Bacteria 1722
393 Ga0496101_0013654 3300048904 Bacteria 5448
394 Ga0496101_0069154 3300048904 Unclassified 2583
395 Ga0496101_0539511 3300048904 Bacteria 922
396 Ga0496101_0774767 3300048904 Bacteria 757
397 Ga0496102_0094830 3300048905 Bacteria 2765
398 Ga0496102_0117136 3300048905 Bacteria 2486
399 Ga0496102_0504534 3300048905 Unclassified 1132
400 Ga0496104_0000904 3300048907 Bacteria 25446
401 Ga0496104_0002508 3300048907 Bacteria 15797
402 Ga0496104_0006333 3300048907 Bacteria 10411
403 Ga0496105_0000042 3300048908 Bacteria 114886
404 Ga0496105_0000889 3300048908 Bacteria 20439
405 Ga0496105_0064287 3300048908 Bacteria 3027
406 Ga0496106_0101360 3300048909 Bacteria 2233
407 Ga0496107_0022662 3300048910 Bacteria 4439
408 Ga0496107_0278047 3300048910 Unclassified 1246
409 Ga0496108_0006789 3300048911 Bacteria 9266
410 Ga0496109_0001909 3300048912 Bacteria 17319
411 Ga0496109_0011551 3300048912 Bacteria 7595
412 Ga0496109_0073873 3300048912 Bacteria 3134
413 Ga0496109_0082358 3300048912 Bacteria 2965
414 Ga0496109_0410606 3300048912 Bacteria 1279
415 Ga0496110_0000050 3300048913 Bacteria 59023
416 Ga0496110_0004716 3300048913 Bacteria 10608
417 Ga0496110_0058012 3300048913 Bacteria 3410
418 Ga0496110_0169511 3300048913 Bacteria 1980
419 Ga0496111_0000220 3300048914 Bacteria 27215
420 Ga0496111_0000439 3300048914 Bacteria 21067
421 Ga0496111_0015545 3300048914 Bacteria 5227
422 Ga0496111_0796766 3300048914 Bacteria 684
423 Ga0496112_0002189 3300048915 Bacteria 15555
424 Ga0496112_0013716 3300048915 Bacteria 7491
425 Ga0496112_0350346 3300048915 Bacteria 1419
426 Ga0496113_0000517 3300048916 Bacteria 19082
427 Ga0496113_0007286 3300048916 Bacteria 7099
428 Ga0496114_0092763 3300048917 Bacteria 2566
429 Ga0496114_0339901 3300048917 Bacteria 1327
430 Ga0496114_0989024 3300048917 Viruses 724
431 Ga0496115_0032723 3300048918 Bacteria 4103
432 Ga0501031_0070893 3300049568 Bacteria 2270
433 Ga0501036_0020325 3300049572 Bacteria 5577
434 Ga0501038_0567263 3300049574 Unclassified 862
435 Ga0501038_0585626 3300049574 Bacteria 845
436 Ga0501038_1042132 3300049574 Unclassified 599
437 Ga0501039_0024529 3300049575 Bacteria 4633
438 Ga0501039_0235722 3300049575 Unclassified 1439
439 Ga0501039_0276992 3300049575 Unclassified 1319
440 Ga0501039_0930349 3300049575 Bacteria 676
441 Ga0501040_0072170 3300049576 Bacteria 2384
442 Ga0501040_0107424 3300049576 Unclassified 1950
443 Ga0501041_0008684 3300049577 Bacteria 5985
444 Ga0501041_0031737 3300049577 Bacteria 3193
445 Ga0501042_0022138 3300049578 Bacteria 4439
446 Ga0501042_0029093 3300049578 Bacteria 3897
447 Ga0501042_0328657 3300049578 Bacteria 1105
448 Ga0501046_0024764 3300049580 Bacteria 4919
449 Ga0501046_0890405 3300049580 Bacteria 621
450 Ga0501067_0391864 3300049583 Bacteria 774
451 Ga0501068_0056745 3300049584 Bacteria 2374
452 Ga0501068_0127463 3300049584 Unclassified 1590
453 Ga0501068_0497694 3300049584 Unclassified 790
454 Ga0501068_0702482 3300049584 Unclassified 661
455 Ga0501070_0443333 3300049586 Unclassified 1047
456 Ga0501071_0009096 3300049587 Bacteria 6595
457 Ga0501071_0252595 3300049587 Unclassified 1331
458 Ga0501071_1033190 3300049587 Bacteria 635
459 Ga0501072_0004023 3300049588 Bacteria 11121
460 Ga0501072_0044621 3300049588 Bacteria 3485
461 Ga0501072_0052201 3300049588 Bacteria 3219
462 Ga0501072_0695933 3300049588 Bacteria 799
463 Ga0501072_0884755 3300049588 Unclassified 698
464 Ga0501074_0108775 3300049590 Bacteria 1984
465 Ga0501075_0019585 3300049591 Bacteria 4913
466 Ga0501075_0163402 3300049591 Unclassified 1699
467 Ga0501075_0414386 3300049591 Unclassified 1027
468 Ga0501075_0803855 3300049591 Unclassified 716
469 Ga0501076_0007689 3300049592 Bacteria 7850
470 Ga0501076_0016501 3300049592 Bacteria 5599
471 Ga0501076_0539893 3300049592 Unclassified 961
472 Ga0501077_0016935 3300049593 Bacteria 4597
473 Ga0501077_0122028 3300049593 Bacteria 1652
474 Ga0501077_0193787 3300049593 Bacteria 1291
475 Ga0501079_0021044 3300049741 Bacteria 4986
476 Ga0501079_0038973 3300049741 Bacteria 3665
477 Ga0501080_0117875 3300049742 Bacteria 2461
478 Ga0501080_0398657 3300049742 Unclassified 1238
479 Ga0501080_0581951 3300049742 Bacteria 995
480 Ga0501045_0022741 3300049824 Bacteria 4490
481 Ga0501045_0137083 3300049824 Bacteria 1819
482 nmdc:mga05p37_233149_c1 3300050507 Bacteria 2217
483 nmdc:mga05p37_518112_c1 3300050507 Bacteria 1365
484 nmdc:mga05p37_586256_c1 3300050507 Bacteria 1262
485 nmdc:mga09592_13818_c1 3300050508 Bacteria 6597
486 nmdc:mga09592_93193_c1 3300050508 Bacteria 2575
487 nmdc:mga0qj67_6269_c1 3300050509 Bacteria 8723
488 nmdc:mga06r32_55414_c1 3300050510 Bacteria 3803
489 nmdc:mga06r32_618949_c1 3300050510 Bacteria 1053
490 nmdc:mga08y16_109599_c1 3300050511 Bacteria 2875
491 nmdc:mga08y16_1150113_c1 3300050511 Bacteria 749
492 nmdc:mga08y16_1672065_c1 3300050511 Unclassified 593
493 nmdc:mga08y16_177869_c1 3300050511 Bacteria 2210
494 nmdc:mga08y16_190793_c1 3300050511 Bacteria 2125
495 nmdc:mga08y16_496309_c1 3300050511 Bacteria 1241
496 nmdc:mga0n895_146191_c1 3300050512 Bacteria 2394
497 nmdc:mga0n895_571734_c1 3300050512 Bacteria 1135
498 nmdc:mga0n895_695945_c1 3300050512 Bacteria 1013
499 nmdc:mga0n895_757016_c1 3300050512 Unclassified 964
500 nmdc:mga0rr50_1461849_c1 3300050513 Bacteria 578
501 nmdc:mga0rr50_150117_c1 3300050513 Bacteria 1882
502 nmdc:mga0rr50_474899_c1 3300050513 Bacteria 1062
503 nmdc:mga08x19_161364_c1 3300050514 Bacteria 1522
504 nmdc:mga08x19_235982_c1 3300050514 Bacteria 1260
505 nmdc:mga08x19_966629_c1 3300050514 Unclassified 605
506 nmdc:mga0a205_266728_c1 3300050515 Bacteria 1590
507 nmdc:mga0a205_432163_c1 3300050515 Bacteria 1178
508 Ga0495601_0088196 3300053077 Unclassified 1995
509 Ga0495595_0052116 3300053084 Bacteria 1898
510 Ga0495595_0156000 3300053084 Bacteria 1125
511 Ga0495619_0080376 3300053085 Bacteria 2194
512 Ga0495619_0182793 3300053085 Bacteria 1450
513 Ga0501084_0005031 3300054114 Bacteria 10814
514 Ga0501084_0015552 3300054114 Bacteria 6311
515 Ga0501084_0372585 3300054114 Bacteria 1206
516 Ga0501082_0123048 3300060353 Bacteria 2249
517 Ga0501082_0142726 3300060353 Bacteria 2078
518 Ga0501082_0430476 3300060353 Unclassified 1152
519 Ga0530510_0073330 3300061734 Bacteria 2485
520 Ga0530510_0096288 3300061734 Unclassified 2163
521 Ga0530510_0511455 3300061734 Bacteria 911
522 Ga0207664_10221334
523 Ga0070658_10519312
524 Ga0070676_10229251
525 Ga0070683_100146638
526 Ga0070680_100069462
527 Ga0070682_100003427
528 Ga0068868_100078910
529 Ga0068868_100085496
530 Ga0068868_100302145
531 Ga0070660_100002178
532 Ga0070660_100114920
533 Ga0070689_100068386
534 Ga0070689_100108180
535 Ga0070691_10024214
536 Ga0070687_100018669
537 Ga0070687_100172817
538 Ga0070661_100471097
539 Ga0070692_10003291
540 Ga0070692_10074617
541 Ga0070668_100030247
542 Ga0070668_100124787
543 Ga0070669_100022174
544 Ga0070669_100040506
545 Ga0070675_100086740
546 Ga0070671_100112937
547 Ga0070674_100004345
548 Ga0070674_100055001
549 Ga0070673_100025387
550 Ga0070688_100141340
551 Ga0070659_100009139
552 Ga0070659_100276346
553 Ga0070667_100396110
554 Ga0070703_10009590
555 Ga0070709_10014742
556 Ga0070709_10344204
557 Ga0070714_100091443
558 Ga0070714_100786998
559 Ga0070711_100004428
560 Ga0070711_100086586
561 Ga0070711_100157977
562 Ga0070705_100023777
563 Ga0070705_100097046
564 Ga0070705_100315228
565 Ga0070700_100000793
566 Ga0070700_100071463
567 Ga0070694_100339062
568 Ga0070708_100503530
569 Ga0070663_100130683
570 Ga0070678_100092759
571 Ga0070678_100197800
572 Ga0070662_100130136
573 Ga0070681_10059218
574 Ga0068867_100001828
575 Ga0070685_10001941
576 Ga0070685_10031896
577 Ga0070706_100353302
578 Ga0070707_100030516
579 Ga0070698_100302302
580 Ga0070698_100878516
581 Ga0070699_100015598
582 Ga0070699_100032392
583 Ga0070679_100031019
584 Ga0070679_100090650
585 Ga0070679_100910143
586 Ga0070684_100120560
587 Ga0070684_100166266
588 Ga0070684_100390310
589 Ga0070684_100460497
590 Ga0070684_100846989
591 Ga0068853_100006599
592 Ga0068853_100031411
593 Ga0070672_100023803
594 Ga0070686_100000943
595 Ga0070686_100334848
596 Ga0070695_100112402
597 Ga0070695_100366275
598 Ga0070695_100710228
599 Ga0070696_100036145
600 Ga0070696_100132041
601 Ga0070696_100152236
602 Ga0070696_100321710
603 Ga0070693_100056774
604 Ga0070693_100078425
605 Ga0070693_100190625
606 Ga0070693_100633386
607 Ga0070665_100009747
608 Ga0070665_100127885
609 Ga0070704_100035028
610 Ga0070704_100074151
611 Ga0070704_100317094
612 Ga0070704_100602484
613 Ga0068855_100051609
614 Ga0068855_100065892
615 Ga0068855_100140136
616 Ga0068855_100834414
617 Ga0070664_100558913
618 Ga0070664_100763331
619 Ga0068857_100459200
620 Ga0068854_100065487
621 Ga0068854_100138859
622 Ga0068854_100164443
623 Ga0068856_100033258
624 Ga0068856_100316712
625 Ga0070702_100032774
626 Ga0070702_100035653
627 Ga0070702_100050214
628 Ga0070702_100057486
629 Ga0068852_100067057
630 Ga0068852_100081570
631 Ga0068852_100089234
632 Ga0068859_100060646
633 Ga0068859_100120582
634 Ga0068864_100071551
635 Ga0068866_10000474
636 Ga0068866_10138000
637 Ga0068861_100149175
638 Ga0068861_100176073
639 Ga0068861_101099605
640 Ga0068863_100210195
641 Ga0068860_100237655
642 Ga0068860_100723731
643 Ga0068862_100024427
644 Ga0068862_100452890
645 Ga0081455_10055607
646 Ga0081540_1002674
647 Ga0081540_1015841
648 Ga0081540_1020783
649 Ga0081539_10002547
650 Ga0081539_10052764
651 Ga0075432_10025065
652 Ga0070716_100060226
653 Ga0070712_100003615
654 Ga0070712_100327938
655 Ga0070712_100338380
656 Ga0070712_100452436
657 Ga0097621_100002348
658 Ga0097621_100325089
659 Ga0068871_100052391
660 Ga0068871_101135148
661 Ga0075428_100452356
662 Ga0075430_100000493
663 Ga0075431_100060380
664 Ga0075429_100026977
665 Ga0068865_100001504
666 Ga0068865_100317439
667 Ga0097620_100060647
668 Ga0097620_100120586
669 Ga0105244_10293148
670 Ga0105240_10565134
671 Ga0111539_10016684
672 Ga0111539_10416277
673 Ga0111539_11096568
674 Ga0111539_11845415
675 Ga0105245_10015468
676 Ga0105245_10038391
677 Ga0105245_10407030
678 Ga0105245_10477458
679 Ga0105245_10490961
680 Ga0114129_10028938
681 Ga0114129_10033847
682 Ga0114129_10117229
683 Ga0114129_10249717
684 Ga0114129_10668124
685 Ga0114129_11203189
686 Ga0114129_11254325
687 Ga0114129_11730430
688 Ga0105243_10261797
689 Ga0105243_10330082
690 Ga0105243_11296072
691 Ga0105242_10013668
692 Ga0105242_10084740
693 Ga0105242_10121684
694 Ga0105242_10442455
695 Ga0105248_10087843
696 Ga0105248_10849219
697 Ga0105237_10357938
698 Ga0105238_10926850
699 Ga0105249_10003122
700 Ga0105249_10385168
701 Ga0105249_10442943
702 Ga0105239_10067585
703 Ga0105239_10487871
704 Ga0105246_10456472
705 Ga0157373_10099334
706 Ga0157371_10031088
707 Ga0157371_10251432
708 Ga0157378_10141598
709 Ga0157378_10184642
710 Ga0163162_10250073
711 Ga0163162_10373031
712 Ga0157372_10368450
713 Ga0157372_10429188
714 Ga0157372_10449562
715 Ga0157372_10687990
716 Ga0157375_10035258
717 Ga0157375_10244772
718 Ga0157375_11268080
719 Ga0157380_10145357
720 Ga0157377_10319799
721 Ga0157377_10894691
722 Ga0157376_10150849
723 Ga0163161_10017439
724 Ga0163161_10065022
725 Ga0163161_10109563
726 Ga0207692_10033919
727 Ga0207642_10005315
728 Ga0207688_10281289
729 Ga0207680_10397517
730 Ga0207699_10095652
731 Ga0207645_10091910
732 Ga0207645_10098396
733 Ga0207643_10205776
734 Ga0207643_10416200
735 Ga0207684_10012564
736 Ga0207707_10056782
737 Ga0207671_10288277
738 Ga0207693_10001256
739 Ga0207693_10018442
740 Ga0207663_10036737
741 Ga0207663_10078267
742 Ga0207660_10061300
743 Ga0207660_10081713
744 Ga0207662_10016416
745 Ga0207662_10033184
746 Ga0207657_10002716
747 Ga0207657_10008026
748 Ga0207657_10033070
749 Ga0207646_10024412
750 Ga0207694_10055033
751 Ga0207694_10264205
752 Ga0207687_10015306
753 Ga0207687_10016688
754 Ga0207687_10271442
755 Ga0207664_10043391
756 Ga0207664_10162214
757 Ga0207664_10699662
758 Ga0207644_10039049
759 Ga0207644_10098344
760 Ga0207690_10498684
761 Ga0207706_10004673
762 Ga0207706_10007297
763 Ga0207706_10087678
764 Ga0207686_10051304
765 Ga0207686_10465312
766 Ga0207709_10000790
767 Ga0207709_10563157
768 Ga0207670_10181815
769 Ga0207670_10645648
770 Ga0207669_10024283
771 Ga0207669_10789518
772 Ga0207704_10122629
773 Ga0207704_10320339
774 Ga0207665_10000494
775 Ga0207665_10131017
776 Ga0207691_10161839
777 Ga0207691_10224141
778 Ga0207691_10224680
779 Ga0207711_10298107
780 Ga0207689_10212311
781 Ga0207689_10374433
782 Ga0207661_10041126
783 Ga0207661_10112151
784 Ga0207661_10144181
785 Ga0207661_10218099
786 Ga0207661_10414937
787 Ga0207679_10739957
788 Ga0207679_11252001
789 Ga0207667_10113373
790 Ga0207667_10122858
791 Ga0207667_10193912
792 Ga0207651_10045043
793 Ga0207651_10077428
794 Ga0207712_10002935
795 Ga0207712_10014547
796 Ga0207712_10255727
797 Ga0207668_10232607
798 Ga0207640_10065760
799 Ga0207677_10101655
800 Ga0207677_10293831
801 Ga0207639_10033927
802 Ga0207678_10028168
803 Ga0207678_10163273
804 Ga0207708_10000415
805 Ga0207708_10053391
806 Ga0207708_10123428
807 Ga0207708_10135399
808 Ga0207702_10085454
809 Ga0207702_10329110
810 Ga0207641_10979006
811 Ga0207648_10000705
812 Ga0207648_10018457
813 Ga0207676_10396060
814 Ga0207675_100007079
815 Ga0207675_100030064
816 Ga0207675_100077343
817 Ga0207683_10001271
818 Ga0207683_10239012
819 Ga0207683_10260157
820 Ga0207698_10101546
821 Ga0207698_10176944
822 Ga0209998_10026986
823 Ga0207428_10005188
824 Ga0207428_10014315
825 Ga0207428_10202205
826 Ga0268266_10062393
827 Ga0268265_10108556
828 Ga0268265_10383281
829 Ga0268265_10644887
830 Ga0268264_10619332
831 Ga0265325_10064263
832 Ga0265313_10021666
833 Ga0307409_100015022
834 Ga0307416_100946707
835 Ga0373930_0078330
836 Ga0373948_0016607
837 Ga0373958_0002201
838 Ga0373944_0004534
839 Ga0373944_0255604
840 Ga0373949_0006529
841 Ga0373952_0004143
842 Ga0373952_0031011
843 Ga0373932_0027951
844 Ga0373939_0031704
845 Ga0373941_0072042
846 Ga0373945_0001806
847 Ga0373960_0309070
848 Ga0373943_0006617
849 Ga0373946_0024020
850 Ga0373955_0014022
851 Ga0373962_0060931
852 Ga0373931_0566158
853 Ga0373947_0015034
854 Ga0373937_0015252
855 Ga0373937_0258906
856 Ga0373925_0006938
857 Ga0373925_0093455
858 Ga0395899_0000775
859 Ga0395900_0032979
860 Ga0395900_0402851
861 Ga0395898_0007486
862 Ga0395898_0010278
863 Ga0395905_0005632
864 Ga0395905_0007567
865 Ga0395901_0001042
866 Ga0395901_0031712
867 Ga0395901_0546537
868 Ga0451802_0001768
869 Ga0451849_0249066
870 Ga0451851_0487612
871 Ga0439448_0017308
872 Ga0439463_044457
873 Ga0439446_0018555
874 Ga0439458_0005488
875 Ga0450909_028575
876 Ga0439440_0054117
877 Ga0451576_0006071
878 Ga0495603_0000062
879 Ga0495641_0001703
880 Ga0495651_0015981
881 Ga0495653_0114817
882 Ga0495582_0026753
883 Ga0495582_0226876
884 Ga0495662_0052833
885 Ga0495584_0173679
886 Ga0495594_0016528
887 Ga0495594_0065054
888 Ga0495607_0326778
889 Ga0495608_0005502
890 Ga0495608_0452548
891 Ga0495630_0476833
892 Ga0495637_0200758
893 Ga0495652_0358382
894 Ga0495665_0016492
895 Ga0495640_0099031
896 Ga0495640_0483452
897 Ga0495609_0302709
898 Ga0495634_0051392
899 Ga0495635_0036174
900 Ga0495635_0125193
901 Ga0495588_0017942
902 Ga0495657_0025486
903 Ga0495658_0041765
904 Ga0495660_0235109
905 Ga0495581_0004207
906 Ga0495604_0205331
907 Ga0495676_0000253
908 Ga0495676_0017366
909 Ga0495680_0002766
910 Ga0495680_0523514
911 Ga0496100_0011856
912 Ga0496100_0077845
913 Ga0496100_0138485
914 Ga0496101_0013654
915 Ga0496101_0069154
916 Ga0496101_0539511
917 Ga0496101_0774767
918 Ga0496102_0094830
919 Ga0496102_0117136
920 Ga0496102_0504534
921 Ga0496104_0000904
922 Ga0496104_0002508
923 Ga0496104_0006333
924 Ga0496105_0000042
925 Ga0496105_0000889
926 Ga0496105_0064287
927 Ga0496106_0101360
928 Ga0496107_0022662
929 Ga0496107_0278047
930 Ga0496108_0006789
931 Ga0496109_0001909
932 Ga0496109_0011551
933 Ga0496109_0073873
934 Ga0496109_0082358
935 Ga0496109_0410606
936 Ga0496110_0000050
937 Ga0496110_0004716
938 Ga0496110_0058012
939 Ga0496110_0169511
940 Ga0496111_0000220
941 Ga0496111_0000439
942 Ga0496111_0015545
943 Ga0496111_0796766
944 Ga0496112_0002189
945 Ga0496112_0013716
946 Ga0496112_0350346
947 Ga0496113_0000517
948 Ga0496113_0007286
949 Ga0496114_0092763
950 Ga0496114_0339901
951 Ga0496114_0989024
952 Ga0496115_0032723
953 Ga0501031_0070893
954 Ga0501036_0020325
955 Ga0501038_0567263
956 Ga0501038_0585626
957 Ga0501038_1042132
958 Ga0501039_0024529
959 Ga0501039_0235722
960 Ga0501039_0276992
961 Ga0501039_0930349
962 Ga0501040_0072170
963 Ga0501040_0107424
964 Ga0501041_0008684
965 Ga0501041_0031737
966 Ga0501042_0022138
967 Ga0501042_0029093
968 Ga0501042_0328657
969 Ga0501046_0024764
970 Ga0501046_0890405
971 Ga0501067_0391864
972 Ga0501068_0056745
973 Ga0501068_0127463
974 Ga0501068_0497694
975 Ga0501068_0702482
976 Ga0501070_0443333
977 Ga0501071_0009096
978 Ga0501071_0252595
979 Ga0501071_1033190
980 Ga0501072_0004023
981 Ga0501072_0044621
982 Ga0501072_0052201
983 Ga0501072_0695933
984 Ga0501072_0884755
985 Ga0501074_0108775
986 Ga0501075_0019585
987 Ga0501075_0163402
988 Ga0501075_0414386
989 Ga0501075_0803855
990 Ga0501076_0007689
991 Ga0501076_0016501
992 Ga0501076_0539893
993 Ga0501077_0016935
994 Ga0501077_0122028
995 Ga0501077_0193787
996 Ga0501079_0021044
997 Ga0501079_0038973
998 Ga0501080_0117875
999 Ga0501080_0398657
1000 Ga0501080_0581951
1001 Ga0501045_0022741
1002 Ga0501045_0137083
1003 nmdc:mga05p37_233149_c1
1004 nmdc:mga05p37_518112_c1
1005 nmdc:mga05p37_586256_c1
1006 nmdc:mga09592_13818_c1
1007 nmdc:mga09592_93193_c1
1008 nmdc:mga0qj67_6269_c1
1009 nmdc:mga06r32_55414_c1
1010 nmdc:mga06r32_618949_c1
1011 nmdc:mga08y16_109599_c1
1012 nmdc:mga08y16_1150113_c1
1013 nmdc:mga08y16_1672065_c1
1014 nmdc:mga08y16_177869_c1
1015 nmdc:mga08y16_190793_c1
1016 nmdc:mga08y16_496309_c1
1017 nmdc:mga0n895_146191_c1
1018 nmdc:mga0n895_571734_c1
1019 nmdc:mga0n895_695945_c1
1020 nmdc:mga0n895_757016_c1
1021 nmdc:mga0rr50_1461849_c1
1022 nmdc:mga0rr50_150117_c1
1023 nmdc:mga0rr50_474899_c1
1024 nmdc:mga08x19_161364_c1
1025 nmdc:mga08x19_235982_c1
1026 nmdc:mga08x19_966629_c1
1027 nmdc:mga0a205_266728_c1
1028 nmdc:mga0a205_432163_c1
1029 Ga0495601_0088196
1030 Ga0495595_0052116
1031 Ga0495595_0156000
1032 Ga0495619_0080376
1033 Ga0495619_0182793
1034 Ga0501084_0005031
1035 Ga0501084_0015552
1036 Ga0501084_0372585
1037 Ga0501082_0123048
1038 Ga0501082_0142726
1039 Ga0501082_0430476
1040 Ga0530510_0073330
1041 Ga0530510_0096288
1042 Ga0530510_0511455

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03167

UDG

Uracil DNA glycosylase superfamily

9

162

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mwj-assembly1.cif.gz_A crystal structure of a mug-dna pseudo substrate complex 0.94 2 160
1mwj-assembly1.cif.gz_A crystal structure of a mug-dna pseudo substrate complex 0.9288 2 160
1mtl-assembly1.cif.gz_A non-productive mug-dna complex 0.918 2 160
1mtl-assembly1.cif.gz_B non-productive mug-dna complex 0.9154 2 160
1mtl-assembly1.cif.gz_A non-productive mug-dna complex 0.8904 2 160
ID Description Score Start End Superfamily
1mtlA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.918 2 160 3.40.470.10
af_Q9V4D8_761_956_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9175 2 159 3.40.470.10
af_Q9V4D8_761_956_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9015 2 159 3.40.470.10
af_O59825_127_324_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8944 2 159 3.40.470.10
1mtlA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8904 2 160 3.40.470.10
ID Description Score Start End GO Terms
AF-A0A538E6F7-F1-model_v4 Mismatch-specific DNA-glycosylase 0.9852 1 160 GO:0004844
GO:0006285
GO:0008263
AF-A0A7V8YS81-F1-model_v4 Mismatch-specific DNA-glycosylase 0.9849 1 160 GO:0004844
GO:0006285
GO:0008263
AF-A0A538EG92-F1-model_v4 Mismatch-specific DNA-glycosylase 0.9847 1 160 GO:0004844
GO:0006285
GO:0008263
AF-A0A1Q7UMB8-F1-model_v4 Uracil-DNA glycosylase-like domain-containing protein 0.9844 1 160 GO:0004844
GO:0006285
GO:0008263
AF-A0A1F8SBU0-F1-model_v4 Uracil-DNA glycosylase-like domain-containing protein 0.9839 1 159 GO:0004844
GO:0006285
GO:0008263

Map