F458682

General Info

Members Datasets Scaffolds Average Seq Length
521 263 367 490

Family's Representative Sequence

Representative Sequence 3300009011|Ga0105251_10000337|Ga0105251_1000033711
Length 525
Sequence MPIESFSPRYADGIDIARVTSYPCGKSLQKVGYTMSSLQISQGTFRLSDTKTLKIEHLTVGAGESWAFVGSNGSGKSALARALSGELTLLSGQYENRFSRVTRLSFEQLQKLVSDEWQRNNTDLLSPGEEDTGRTTEEIIQEESKDAARCARLAELFGITSLLQRRFKYLSTGETRKTLLCQALMTQPDLLILDEPFDGLDVASRQQLAGLLARLHLERLTLVLVLNRFDEIPSFVQFAGVLADCTLSETGEKQALLQQALIAQLAHSEKLAGMSLPEPDAPAARHALDAGAPRIVLRDGVVSYNDRPIIERLSWTVNPGEHWQIVGPNGAGKSTLLSLVTGDHPQGYSNDLTLFGRRRGSGETIWDIKKHIGYVSSSLHLEYRVSTTVRNVILSGYFDSIGIYQAVSDKQRKLVQNWLDILGIDKRTADAPFHSLSWGQQRLALIVRALVKHPTLLILDEPLQGLDPLNRQLVRRFVDVLISEGATQLLFVSHHAEDAPDCITHRLEFVRSGDGYTYQVGPLTD

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
3 2506520008 Serratia plymuthica AS12 Isolate Unclassified
4 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
5 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
6 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
7 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
8 2547132181 Kosakonia sacchari SP1 Isolate Stem
9 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
10 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
11 2561511199 Enterobacter sp. R4-368 Isolate Nodule
12 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
13 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
14 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
15 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
16 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
17 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
18 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
19 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
20 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
21 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
22 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
23 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
24 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
25 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
26 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
27 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
28 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
29 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
30 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
31 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
32 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
33 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
34 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
35 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
36 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
37 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
38 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
39 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
40 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
41 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
42 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
43 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
44 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
45 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
46 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
47 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
48 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
49 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
50 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
51 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
52 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
53 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
54 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
55 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
56 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
57 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
58 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
59 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
60 2636415599 Klebsiella variicola DX120E Isolate Unclassified
61 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
62 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
63 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
64 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
65 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
66 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
67 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
68 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
69 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
70 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
71 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
72 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
73 2751185917 Enterobacter sp. HK169 Isolate Unclassified
74 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
75 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
76 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
77 2775507074 Klebsiella sp. D5A Isolate Unclassified
78 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
79 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
80 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
81 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
82 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
83 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
84 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
85 2821118458 Enterobacter asburiae 609 Isolate Unclassified
86 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
87 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
88 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
89 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
90 2847085930 Erwinia persicina B64 Isolate Bulb
91 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
92 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
93 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
94 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
95 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
96 2865014394 Pantoea sp. R-71966 Isolate Unclassified
97 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
98 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
99 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
100 2876601092 Pantoea endophytica 596 Isolate Unclassified
101 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
102 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
103 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
104 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
105 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
106 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
107 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
108 2904504865 Serratia marcescens 1822 Isolate Unclassified
109 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
110 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
111 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
112 2919150387 Rahnella aceris 1817 Isolate Unclassified
113 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
114 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
115 2927143783 Rahnella sp. 2050 Isolate Unclassified
116 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
117 2932406140 Serratia sp. 2723 Isolate Rhizosphere
118 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
119 2937539931 Pantoea sp. LS15 Isolate Unclassified
120 2937967321 Serratia sp. YC16 Isolate Unclassified
121 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
122 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
123 2939577877 Serratia sp. 509 Isolate Rhizosphere
124 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
125 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
126 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
127 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
128 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
129 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
130 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
131 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
132 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
133 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
134 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
135 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
136 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
137 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
138 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
139 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
140 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
141 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
142 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
143 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
144 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
145 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
146 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
147 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
148 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
149 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
150 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
151 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
152 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
153 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
154 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
155 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
156 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
157 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
158 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
159 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
160 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
161 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
162 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
163 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
164 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
165 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
166 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
167 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
168 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
169 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
170 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
171 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
172 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
173 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
174 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
175 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
176 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
177 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
178 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
183 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
184 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
186 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
187 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
194 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
197 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
198 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
199 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
200 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
201 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
202 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
203 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
204 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
205 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
206 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
207 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
208 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
209 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
210 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
211 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
212 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
213 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
214 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
215 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
216 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
217 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
218 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
219 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
220 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
221 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
222 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
223 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
224 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
225 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
226 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
227 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
228 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
233 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
234 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
235 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
236 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
237 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
238 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
239 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
240 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
241 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
242 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
243 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
244 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
245 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
246 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
247 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
248 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
249 640753048 Serratia proteamaculans 568 Isolate Endosphere
250 8004592986 Serratia sp. S119 Isolate Unclassified
251 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
252 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
253 8018221730 Enterobacter sp. CM29 Isolate Unclassified
254 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
255 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
256 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
257 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
258 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
259 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
260 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
261 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
262 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
263 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 70.44
Metatranscriptomes 0
Isolates 29.56

Biome Distribution

Category Percentage (%)
Aerial Root 0.77
Bulb 0.19
Endosphere 4.99
Nodule 4.61
Rhizoplane 12.28
Rhizosphere 47.02
Stem 0.19
Stem Tuber 1.34
Unclassified 28.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1805141 2162886007 Bacteria 5216
2 SwRhRL2b_contig_284845 2162886007 Bacteria 8005
3 SwRhRL2b_contig_359937 2162886007 Bacteria 5577
4 JGI24739J22299_10001323 3300001989 Bacteria 9295
5 JGI25162J39368_1000003 3300002737 Bacteria 575218
6 JGI25163J39215_1000007 3300002771 Bacteria 113612
7 JGI25164J39214_1000014 3300002772 Bacteria 219691
8 rootH2_10000678 3300003320 Bacteria 22574
9 Ga0055538_1000005 3300003751 Bacteria 575218
10 Ga0055539_1000007 3300003752 Bacteria 575218
11 Ga0055533_1000009 3300003756 Bacteria 575218
12 Ga0055525_1000010 3300003759 Bacteria 575218
13 Ga0055541_1000005 3300003841 Bacteria 575218
14 Ga0058692_1000480 3300003856 Bacteria 17868
15 Ga0058692_1000727 3300003856 Bacteria 13407
16 Ga0058692_1003043 3300003856 Bacteria 5353
17 Ga0058692_1004946 3300003856 Bacteria 3872
18 Ga0058692_1005271 3300003856 Bacteria 3712
19 Ga0058692_1009388 3300003856 Bacteria 2469
20 Ga0058692_1012284 3300003856 Bacteria 2036
21 Ga0065704_10000313 3300005289 Bacteria 61667
22 Ga0065704_10000763 3300005289 Bacteria 34745
23 Ga0065704_10002666 3300005289 Bacteria 4859
24 Ga0070668_100012019 3300005347 Bacteria 6449
25 Ga0070665_100000199 3300005548 Bacteria 105924
26 Ga0068857_100000646 3300005577 Bacteria 25684
27 Ga0075364_10004339 3300006051 Bacteria 8135
28 Ga0075364_10009002 3300006051 Bacteria 5979
29 Ga0075366_10023490 3300006195 Bacteria 3592
30 Ga0079104_1000080 3300006946 Bacteria 140677
31 Ga0079104_1000087 3300006946 Bacteria 135647
32 Ga0079104_1000250 3300006946 Bacteria 72013
33 Ga0079104_1000324 3300006946 Bacteria 58816
34 Ga0079104_1000985 3300006946 Bacteria 22197
35 Ga0079104_1001383 3300006946 Bacteria 16491
36 Ga0079104_1002462 3300006946 Bacteria 9959
37 Ga0079104_1002508 3300006946 Bacteria 9757
38 Ga0079104_1005210 3300006946 Bacteria 5261
39 Ga0079104_1009328 3300006946 Bacteria 3334
40 Ga0079104_1014918 3300006946 Bacteria 2326
41 Ga0105251_10000337 3300009011 Bacteria 47023
42 Ga0105251_10000370 3300009011 Bacteria 44149
43 Ga0105251_10000374 3300009011 Bacteria 43851
44 Ga0105251_10000511 3300009011 Bacteria 36723
45 Ga0105251_10000642 3300009011 Bacteria 32113
46 Ga0105251_10003592 3300009011 Bacteria 11159
47 Ga0105251_10007091 3300009011 Bacteria 6983
48 Ga0105251_10007735 3300009011 Bacteria 6558
49 Ga0105251_10017246 3300009011 Bacteria 3877
50 Ga0105251_10019327 3300009011 Bacteria 3601
51 Ga0105244_10000006 3300009036 Bacteria 357997
52 Ga0105244_10000183 3300009036 Bacteria 63415
53 Ga0105244_10000194 3300009036 Bacteria 61396
54 Ga0105244_10000233 3300009036 Bacteria 57433
55 Ga0105244_10000973 3300009036 Bacteria 24077
56 Ga0105244_10001016 3300009036 Bacteria 23470
57 Ga0105244_10001923 3300009036 Bacteria 16140
58 Ga0105244_10002115 3300009036 Bacteria 15266
59 Ga0105244_10002376 3300009036 Bacteria 14265
60 Ga0105244_10003362 3300009036 Bacteria 11460
61 Ga0105244_10010711 3300009036 Bacteria 5542
62 Ga0105244_10028016 3300009036 Bacteria 3027
63 Ga0105244_10044932 3300009036 Bacteria 2274
64 Ga0105250_10000003 3300009092 Bacteria 547770
65 Ga0105250_10000026 3300009092 Bacteria 213233
66 Ga0105250_10000133 3300009092 Bacteria 64415
67 Ga0105250_10000918 3300009092 Bacteria 17337
68 Ga0105250_10001673 3300009092 Bacteria 11735
69 Ga0105250_10001890 3300009092 Bacteria 10874
70 Ga0105250_10002003 3300009092 Bacteria 10553
71 Ga0105250_10014416 3300009092 Bacteria 3249
72 Ga0105250_10047031 3300009092 Bacteria 1730
73 Ga0105247_10000018 3300009101 Bacteria 259335
74 Ga0105241_10000004 3300009174 Bacteria 803007
75 Ga0105246_10017030 3300011119 Bacteria 4616
76 Ga0157373_10002765 3300013100 Bacteria 13270
77 Ga0157373_10008291 3300013100 Bacteria 7720
78 Ga0157373_10010172 3300013100 Bacteria 6931
79 Ga0157373_10062561 3300013100 Bacteria 2636
80 Ga0157371_10000167 3300013102 Bacteria 95585
81 Ga0157371_10000462 3300013102 Bacteria 49728
82 Ga0157371_10003704 3300013102 Bacteria 13707
83 Ga0157371_10008243 3300013102 Bacteria 8330
84 Ga0157371_10049497 3300013102 Bacteria 2985
85 Ga0157370_10000093 3300013104 Bacteria 101308
86 Ga0157370_10001894 3300013104 Bacteria 25738
87 Ga0163162_10032890 3300013306 Bacteria 5151
88 Ga0157372_10131886 3300013307 Bacteria 2875
89 Ga0157372_10142740 3300013307 Bacteria 2760
90 Ga0182008_10005912 3300014497 Bacteria 6912
91 Ga0182006_1000063 3300015261 Bacteria 154042
92 Ga0182006_1005872 3300015261 Bacteria 5775
93 Ga0183366_1001 3300015679 Bacteria 2743932
94 Ga0183370_1001 3300015680 Bacteria 2743932
95 Ga0183369_1001 3300015685 Bacteria 2743932
96 Ga0183368_1001 3300015687 Bacteria 2743932
97 Ga0163161_10000001 3300017792 Bacteria 2041488
98 Ga0163161_10112949 3300017792 Bacteria 2033
99 Ga0213876_10000166 3300021384 Bacteria 69611
100 Ga0209760_100001 3300025207 Bacteria 348781
101 Ga0209784_100001 3300025224 Bacteria 3600592
102 Ga0209566_100001 3300025225 Bacteria 3600765
103 Ga0209674_100002 3300025226 Bacteria 3600592
104 Ga0209563_100008 3300025230 Bacteria 1554545
105 Ga0207427_100002 3300025231 Bacteria 1355321
106 Ga0209437_100007 3300025233 Bacteria 938377
107 Ga0209437_100035 3300025233 Bacteria 481110
108 Ga0209677_100004 3300025253 Bacteria 1554545
109 Ga0209129_1000015 3300025258 Bacteria 487967
110 Ga0209233_1016721 3300025261 Bacteria 2015
111 Ga0207696_1000001 3300025711 Bacteria 2579611
112 Ga0207696_1000003 3300025711 Bacteria 860639
113 Ga0207696_1000004 3300025711 Bacteria 671626
114 Ga0207696_1000059 3300025711 Bacteria 245763
115 Ga0207696_1000312 3300025711 Bacteria 54441
116 Ga0207696_1000444 3300025711 Bacteria 36917
117 Ga0207696_1001356 3300025711 Bacteria 13444
118 Ga0207696_1003078 3300025711 Bacteria 7775
119 Ga0207696_1003854 3300025711 Bacteria 6648
120 Ga0207696_1022675 3300025711 Bacteria 1991
121 Ga0207655_1000001 3300025728 Bacteria 1866413
122 Ga0207655_1000011 3300025728 Bacteria 643321
123 Ga0207655_1000023 3300025728 Bacteria 467070
124 Ga0207655_1000032 3300025728 Bacteria 391253
125 Ga0207655_1000149 3300025728 Bacteria 129937
126 Ga0207655_1000157 3300025728 Bacteria 124885
127 Ga0207655_1000260 3300025728 Bacteria 83214
128 Ga0207655_1000334 3300025728 Bacteria 68683
129 Ga0207655_1000370 3300025728 Bacteria 63426
130 Ga0207655_1003730 3300025728 Bacteria 11184
131 Ga0207655_1009645 3300025728 Bacteria 5969
132 Ga0207655_1015472 3300025728 Bacteria 4235
133 Ga0207655_1039075 3300025728 Bacteria 2066
134 Ga0207655_1041595 3300025728 Bacteria 1968
135 Ga0207713_1000001 3300025735 Bacteria 2295391
136 Ga0207713_1000005 3300025735 Bacteria 649958
137 Ga0207713_1000006 3300025735 Bacteria 586163
138 Ga0207713_1000024 3300025735 Bacteria 339156
139 Ga0207713_1000059 3300025735 Bacteria 214031
140 Ga0207713_1000316 3300025735 Bacteria 54767
141 Ga0207713_1001778 3300025735 Bacteria 16486
142 Ga0207713_1011731 3300025735 Bacteria 4735
143 Ga0207713_1020370 3300025735 Bacteria 3214
144 Ga0207713_1031556 3300025735 Bacteria 2339
145 Ga0207710_10000049 3300025900 Bacteria 186492
146 Ga0207654_10000006 3300025911 Bacteria 815027
147 Ga0207674_10002213 3300026116 Bacteria 24638
148 Ga0209281_1000001 3300027111 Bacteria 1933496
149 Ga0209281_1000008 3300027111 Bacteria 867470
150 Ga0209281_1000021 3300027111 Bacteria 541033
151 Ga0209281_1000101 3300027111 Bacteria 222707
152 Ga0209281_1000201 3300027111 Bacteria 135580
153 Ga0209281_1000291 3300027111 Bacteria 91918
154 Ga0209281_1000634 3300027111 Bacteria 38645
155 Ga0209281_1000780 3300027111 Bacteria 30266
156 Ga0209281_1000799 3300027111 Bacteria 29348
157 Ga0209281_1001293 3300027111 Bacteria 16035
158 Ga0209281_1005326 3300027111 Bacteria 3596
159 Ga0209281_1009227 3300027111 Bacteria 2329
160 Ga0209371_1000001 3300027312 Bacteria 2771503
161 Ga0209371_1000010 3300027312 Bacteria 922021
162 Ga0209371_1000047 3300027312 Bacteria 304732
163 Ga0209371_1000056 3300027312 Bacteria 242255
164 Ga0209371_1000170 3300027312 Bacteria 97312
165 Ga0209371_1000590 3300027312 Bacteria 32510
166 Ga0209371_1000614 3300027312 Bacteria 31800
167 Ga0209371_1000677 3300027312 Bacteria 29460
168 Ga0209371_1001163 3300027312 Bacteria 19255
169 Ga0209371_1001201 3300027312 Bacteria 18740
170 Ga0209371_1001494 3300027312 Bacteria 15582
171 Ga0209371_1001767 3300027312 Bacteria 13558
172 Ga0209371_1003169 3300027312 Bacteria 8322
173 Ga0209371_1003558 3300027312 Bacteria 7468
174 Ga0209371_1005003 3300027312 Bacteria 5471
175 Ga0268266_10000571 3300028379 Bacteria 50834
176 Ga0268256_1000001 3300030500 Bacteria 2771065
177 Ga0268256_1000003 3300030500 Bacteria 1289401
178 Ga0268256_1000022 3300030500 Bacteria 531115
179 Ga0268256_1000071 3300030500 Bacteria 187591
180 Ga0268256_1000142 3300030500 Bacteria 97311
181 Ga0268256_1000438 3300030500 Bacteria 37140
182 Ga0268256_1000494 3300030500 Bacteria 33549
183 Ga0268256_1000514 3300030500 Bacteria 32518
184 Ga0268256_1000981 3300030500 Bacteria 19387
185 Ga0268256_1001031 3300030500 Bacteria 18740
186 Ga0268256_1001547 3300030500 Bacteria 13558
187 Ga0268256_1002134 3300030500 Bacteria 10541
188 Ga0268256_1003261 3300030500 Bacteria 7468
189 Ga0268256_1004464 3300030500 Bacteria 5790
190 Ga0268256_1004813 3300030500 Bacteria 5471
191 Ga0268256_1006298 3300030500 Bacteria 4441
192 Ga0268256_1010870 3300030500 Bacteria 2923
193 Ga0436365_0105401 3300039437 Bacteria 69559
194 Ga0439438_000001 3300041405 Bacteria 1263568
195 Ga0439438_000958 3300041405 Bacteria 12865
196 Ga0439447_005502 3300041407 Bacteria 4202
197 Ga0439466_0000003 3300041411 Bacteria 486229
198 Ga0439452_000001 3300042010 Bacteria 1725439
199 Ga0439452_000003 3300042010 Bacteria 942815
200 Ga0439452_000030 3300042010 Bacteria 197288
201 Ga0439452_000220 3300042010 Bacteria 40289
202 Ga0450902_003005 3300042137 Bacteria 2431
203 Ga0450907_000116 3300042146 Bacteria 30358
204 Ga0439464_0005303 3300042439 Bacteria 3329
205 Ga0466981_0000023 3300044669 Bacteria 78984
206 Ga0495627_000028 3300046453 Bacteria 234737
207 Ga0495591_000011 3300046458 Bacteria 309685
208 Ga0495591_000080 3300046458 Bacteria 107876
209 Ga0495591_000380 3300046458 Bacteria 37698
210 Ga0495638_0007167 3300046460 Bacteria 8029
211 Ga0495650_0000016 3300046471 Bacteria 554693
212 Ga0495650_0000021 3300046471 Bacteria 531242
213 Ga0495650_0001723 3300046471 Bacteria 20035
214 Ga0495650_0008194 3300046471 Bacteria 6141
215 Ga0495585_0015936 3300046492 Bacteria 4360
216 Ga0495606_0000172 3300046507 Bacteria 114645
217 Ga0495631_0037675 3300046518 Bacteria 2153
218 Ga0495643_0032533 3300046522 Bacteria 2895
219 Ga0495644_0034851 3300046523 Bacteria 1900
220 Ga0495648_0001111 3300046524 Bacteria 27283
221 Ga0495648_0002038 3300046524 Bacteria 19163
222 Ga0495654_0000125 3300046530 Bacteria 85809
223 Ga0495654_0000358 3300046530 Bacteria 39515
224 Ga0495654_0000733 3300046530 Bacteria 25478
225 Ga0495597_0001380 3300046542 Bacteria 17545
226 Ga0495668_0017944 3300046616 Bacteria 4098
227 Ga0495625_0005102 3300046660 Bacteria 12153
228 Ga0495671_0001141 3300046692 Bacteria 18240
229 Ga0495649_0019661 3300046694 Bacteria 3793
230 Ga0495649_0030690 3300046694 Bacteria 2967
231 Ga0495589_0000002 3300046794 Bacteria 758846
232 Ga0495660_0000007 3300046810 Bacteria 485295
233 Ga0495660_0000074 3300046810 Bacteria 108390
234 Ga0495660_0004991 3300046810 Bacteria 7984
235 Ga0495672_0000004 3300047320 Bacteria 631810
236 Ga0495672_0000009 3300047320 Bacteria 557755
237 Ga0495672_0000012 3300047320 Bacteria 519975
238 Ga0495683_0014800 3300047323 Bacteria 4062
239 Ga0495679_000113 3300047446 Bacteria 72806
240 Ga0495679_004007 3300047446 Bacteria 6928
241 Ga0495673_0000022 3300047469 Bacteria 544086
242 Ga0495673_0000023 3300047469 Bacteria 539904
243 Ga0495681_0045964 3300047470 Bacteria 2085
244 Ga0496100_0045576 3300048903 Bacteria 2815
245 Ga0496100_0070126 3300048903 Bacteria 2336
246 Ga0496101_0000098 3300048904 Bacteria 90945
247 Ga0496101_0007632 3300048904 Bacteria 7024
248 Ga0496102_0006081 3300048905 Bacteria 10293
249 Ga0496104_0000256 3300048907 Bacteria 47237
250 Ga0496104_0000940 3300048907 Bacteria 25017
251 Ga0496105_0012322 3300048908 Bacteria 6770
252 Ga0496105_0031185 3300048908 Bacteria 4369
253 Ga0496116_0000023 3300048919 Bacteria 475792
254 Ga0496116_0000127 3300048919 Bacteria 158773
255 Ga0496116_0000180 3300048919 Bacteria 126589
256 Ga0496116_0000385 3300048919 Bacteria 64735
257 Ga0496116_0001717 3300048919 Bacteria 23960
258 Ga0496116_0006112 3300048919 Bacteria 11012
259 Ga0496116_0014320 3300048919 Bacteria 6339
260 Ga0496116_0063169 3300048919 Bacteria 2386
261 Ga0496117_0000004 3300048920 Bacteria 877131
262 Ga0496117_0000131 3300048920 Bacteria 162788
263 Ga0496117_0001660 3300048920 Bacteria 31182
264 Ga0496117_0001907 3300048920 Bacteria 27984
265 Ga0496117_0003668 3300048920 Bacteria 17652
266 Ga0496117_0004360 3300048920 Bacteria 15698
267 Ga0496117_0004601 3300048920 Bacteria 15071
268 Ga0496117_0012155 3300048920 Bacteria 7625
269 Ga0496117_0014206 3300048920 Bacteria 6878
270 Ga0496117_0016478 3300048920 Bacteria 6237
271 Ga0496117_0027333 3300048920 Bacteria 4448
272 Ga0496117_0036179 3300048920 Bacteria 3697
273 Ga0496117_0036669 3300048920 Bacteria 3665
274 Ga0496118_0000024 3300048921 Bacteria 385236
275 Ga0496118_0000782 3300048921 Bacteria 51003
276 Ga0496118_0005561 3300048921 Bacteria 14274
277 Ga0496118_0006845 3300048921 Bacteria 12371
278 Ga0496118_0013885 3300048921 Bacteria 7577
279 Ga0496118_0016916 3300048921 Bacteria 6660
280 Ga0496118_0024150 3300048921 Bacteria 5255
281 Ga0496118_0043510 3300048921 Bacteria 3528
282 Ga0496119_0000056 3300048922 Bacteria 174042
283 Ga0496119_0000068 3300048922 Bacteria 158748
284 Ga0496119_0000529 3300048922 Bacteria 52025
285 Ga0496119_0000607 3300048922 Bacteria 48405
286 Ga0496119_0001991 3300048922 Bacteria 23154
287 Ga0496119_0002583 3300048922 Bacteria 19688
288 Ga0496119_0005046 3300048922 Bacteria 12830
289 Ga0496119_0005304 3300048922 Bacteria 12404
290 Ga0496119_0005988 3300048922 Bacteria 11423
291 Ga0496119_0012955 3300048922 Bacteria 6705
292 Ga0496119_0014151 3300048922 Bacteria 6267
293 Ga0496119_0017415 3300048922 Bacteria 5404
294 Ga0496119_0030578 3300048922 Bacteria 3626
295 Ga0496119_0039501 3300048922 Bacteria 3031
296 Ga0496119_0044744 3300048922 Bacteria 2783
297 Ga0496120_0000046 3300048923 Bacteria 190675
298 Ga0496120_0000063 3300048923 Bacteria 170325
299 Ga0496120_0000193 3300048923 Bacteria 104145
300 Ga0496120_0000194 3300048923 Bacteria 104142
301 Ga0496120_0000290 3300048923 Bacteria 84735
302 Ga0496120_0000859 3300048923 Bacteria 42978
303 Ga0496120_0001066 3300048923 Bacteria 36242
304 Ga0496120_0001162 3300048923 Bacteria 33709
305 Ga0496120_0003077 3300048923 Bacteria 15726
306 Ga0496120_0004966 3300048923 Bacteria 10804
307 Ga0496120_0007704 3300048923 Bacteria 7973
308 Ga0496120_0014222 3300048923 Bacteria 5312
309 Ga0496120_0033806 3300048923 Bacteria 3069
310 Ga0496121_0000185 3300048924 Bacteria 138586
311 Ga0496121_0004683 3300048924 Bacteria 18139
312 Ga0496121_0006847 3300048924 Bacteria 13936
313 Ga0496121_0006950 3300048924 Bacteria 13780
314 Ga0496121_0007043 3300048924 Bacteria 13656
315 Ga0496121_0008679 3300048924 Bacteria 11871
316 Ga0496121_0017719 3300048924 Bacteria 7249
317 Ga0496121_0025740 3300048924 Bacteria 5570
318 Ga0496122_0000013 3300048925 Bacteria 501039
319 Ga0496122_0000099 3300048925 Bacteria 198412
320 Ga0496122_0000796 3300048925 Bacteria 60440
321 Ga0496122_0001096 3300048925 Bacteria 46958
322 Ga0496122_0017293 3300048925 Bacteria 6752
323 Ga0496122_0018246 3300048925 Bacteria 6496
324 Ga0496122_0019926 3300048925 Bacteria 6098
325 Ga0496122_0028049 3300048925 Bacteria 4793
326 Ga0496122_0042408 3300048925 Bacteria 3581
327 Ga0496122_0113634 3300048925 Bacteria 1768
328 Ga0496123_0000005 3300048926 Bacteria 658131
329 Ga0496123_0000010 3300048926 Bacteria 501039
330 Ga0496123_0000599 3300048926 Bacteria 61266
331 Ga0496123_0000808 3300048926 Bacteria 50515
332 Ga0496123_0000876 3300048926 Bacteria 47752
333 Ga0496123_0002225 3300048926 Bacteria 24606
334 Ga0496123_0003321 3300048926 Bacteria 18220
335 Ga0496123_0009152 3300048926 Bacteria 8955
336 Ga0496123_0014580 3300048926 Bacteria 6503
337 Ga0496123_0022475 3300048926 Bacteria 4858
338 Ga0496123_0035477 3300048926 Bacteria 3552
339 Ga0496124_0000039 3300048927 Bacteria 307831
340 Ga0496124_0000515 3300048927 Bacteria 66726
341 Ga0496124_0001415 3300048927 Bacteria 35637
342 Ga0496124_0003498 3300048927 Bacteria 19129
343 Ga0496124_0003869 3300048927 Bacteria 17895
344 Ga0496124_0004405 3300048927 Bacteria 16433
345 Ga0496124_0009263 3300048927 Bacteria 10157
346 Ga0496124_0009444 3300048927 Bacteria 10046
347 Ga0496124_0010143 3300048927 Bacteria 9587
348 Ga0496124_0027511 3300048927 Bacteria 5103
349 Ga0496124_0049486 3300048927 Bacteria 3585
350 Ga0496124_0123796 3300048927 Bacteria 2063
351 Ga0496125_0000016 3300048928 Bacteria 512512
352 Ga0496125_0000019 3300048928 Bacteria 474989
353 Ga0496125_0004463 3300048928 Bacteria 16129
354 Ga0496125_0004856 3300048928 Bacteria 15262
355 Ga0496125_0009553 3300048928 Bacteria 9943
356 Ga0496125_0099216 3300048928 Bacteria 2152
357 Ga0496125_0147449 3300048928 Bacteria 1623
358 Ga0496126_0000346 3300048929 Bacteria 96927
359 Ga0496126_0001396 3300048929 Bacteria 38235
360 Ga0496126_0008127 3300048929 Bacteria 11357
361 Ga0496126_0027407 3300048929 Bacteria 5442
362 Ga0496126_0066040 3300048929 Bacteria 3235
363 Ga0496126_0074618 3300048929 Bacteria 3011
364 Ga0495682_0000026 3300049460 Bacteria 144529
365 nmdc:mga00v17_15027_c1 3300050491 Bacteria 4338
366 nmdc:mga0k408_9791_c2 3300050493 Bacteria 4466
367 Ga0500621_000001 3300053126 Bacteria 1049698

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2547132416 2548649072 430
2 3300048925 Ga0496122_0113634 Ga0496122_0113634_43_1446 467
3 3300027312 Ga0209371_1001767 Ga0209371_10017676 470
4 3300030500 Ga0268256_1001547 Ga0268256_10015476 470
5 iso_pu_bacteria 2923525760 2923528946 473
6 3300003856 Ga0058692_1000727 Ga0058692_10007272 479
7 3300027312 Ga0209371_1005003 Ga0209371_10050032 479
8 3300030500 Ga0268256_1004813 Ga0268256_10048136 479
9 iso_pu_bacteria 2609459761 2609914309 483
10 iso_pu_bacteria 2945874760 2945878909 483
11 3300009011 Ga0105251_10000370 Ga0105251_100003701 484
12 3300025735 Ga0207713_1000006 Ga0207713_1000006396 484
13 iso_pu_bacteria 2908669403 2908670952 484
14 iso_pu_bacteria 8055693939 8055696989 484
15 iso_pu_bacteria 2547132181 2547694550 485
16 iso_pu_bacteria 2561511199 2562466624 485
17 iso_pu_bacteria 2585427591 2585826964 485
18 iso_pu_bacteria 2585427592 2585831078 485
19 iso_pu_bacteria 2599185299 2599927303 485
20 iso_pu_bacteria 2648501693 2650896651 485
21 iso_pu_bacteria 2667528173 2671108188 485
22 iso_pu_bacteria 2684622997 2686352649 485
23 iso_pu_bacteria 2706794495 2707099786 485
24 iso_pu_bacteria 2711768156 2712470312 485
25 iso_pu_bacteria 2791354903 2791923251 485
26 iso_pu_bacteria 2791355010 2792312430 485
27 iso_pu_bacteria 2808606414 2809127537 485
28 iso_pu_bacteria 2847085930 2847088468 485
29 iso_pu_bacteria 2847797336 2847800672 485
30 iso_pu_bacteria 2852103415 2852103833 485
31 iso_pu_bacteria 2854601825 2854604591 485
32 iso_pu_bacteria 2884086401 2884089803 485
33 iso_pu_bacteria 2904474040 2904475140 485
34 iso_pu_bacteria 2919150387 2919151486 485
35 iso_pu_bacteria 2927143783 2927146360 485
36 iso_pu_bacteria 2935625433 2935627427 485
37 iso_pu_bacteria 2939607340 2939608307 485
38 iso_pu_bacteria 2939617950 2939621444 485
39 iso_pu_bacteria 2974435778 2974437650 485
40 iso_pu_bacteria 2984494565 2984495869 485
41 iso_pu_bacteria 2990261002 2990262557 485
42 iso_pu_bacteria 3000376612 3000379891 485
43 iso_pu_bacteria 8019504834 8019508414 485
44 iso_pu_bacteria 8054849141 8054854026 485
45 iso_pu_bacteria 8055087960 8055088879 485
46 iso_pu_bacteria 8055092621 8055093834 485
47 iso_pu_bacteria 8055097453 8055102130 485
48 iso_pu_bacteria 8057304971 8057305869 485
49 3300048919 Ga0496116_0000180 Ga0496116_0000180_109596_111059 486
50 3300048922 Ga0496119_0001991 Ga0496119_0001991_15577_17040 486
51 3300048923 Ga0496120_0000046 Ga0496120_0000046_173616_175079 486
52 iso_pu_bacteria 2506520007 2506577326 486
53 iso_pu_bacteria 2506520008 2506582464 486
54 iso_pu_bacteria 2508501071 2508851254 486
55 iso_pu_bacteria 2511231025 2511382110 486
56 iso_pu_bacteria 2537561728 2538427380 486
57 iso_pu_bacteria 2554235234 2555261533 486
58 iso_pu_bacteria 2599185169 2599410522 486
59 iso_pu_bacteria 2600255254 2601523834 486
60 iso_pu_bacteria 2600255255 2601528993 486
61 iso_pu_bacteria 2600255256 2601532132 486
62 iso_pu_bacteria 2600255257 2601537502 486
63 iso_pu_bacteria 2600255280 2601615827 486
64 iso_pu_bacteria 2600255281 2601620453 486
65 iso_pu_bacteria 2600255287 2601646570 486
66 iso_pu_bacteria 2600255288 2601648851 486
67 iso_pu_bacteria 2600255289 2601653877 486
68 iso_pu_bacteria 2600255290 2601659297 486
69 iso_pu_bacteria 2600255291 2601665294 486
70 iso_pu_bacteria 2600255298 2601698156 486
71 iso_pu_bacteria 2600255299 2601703298 486
72 iso_pu_bacteria 2600255300 2601708541 486
73 iso_pu_bacteria 2600255301 2601712605 486
74 iso_pu_bacteria 2600255302 2601717137 486
75 iso_pu_bacteria 2600255303 2601724355 486
76 iso_pu_bacteria 2600255304 2601724701 486
77 iso_pu_bacteria 2600255305 2601731984 486
78 iso_pu_bacteria 2600255306 2601738389 486
79 iso_pu_bacteria 2600255307 2601742711 486
80 iso_pu_bacteria 2600255309 2601751906 486
81 iso_pu_bacteria 2600255310 2601755849 486
82 iso_pu_bacteria 2600255311 2601761218 486
83 iso_pu_bacteria 2600255392 2602020193 486
84 iso_pu_bacteria 2602042046 2603638757 486
85 iso_pu_bacteria 2602042047 2603643289 486
86 iso_pu_bacteria 2602042052 2603663413 486
87 iso_pu_bacteria 2602042053 2603668023 486
88 iso_pu_bacteria 2602042066 2603699887 486
89 iso_pu_bacteria 2602042067 2603703864 486
90 iso_pu_bacteria 2602042103 2603839483 486
91 iso_pu_bacteria 2602042104 2603844462 486
92 iso_pu_bacteria 2602042105 2603849639 486
93 iso_pu_bacteria 2602042106 2603854707 486
94 iso_pu_bacteria 2602042109 2603866012 486
95 iso_pu_bacteria 2602042110 2603869879 486
96 iso_pu_bacteria 2602042111 2603878991 486
97 iso_pu_bacteria 2603880178 2606047070 486
98 iso_pu_bacteria 2603880184 2606072448 486
99 iso_pu_bacteria 2603880202 2606146428 486
100 iso_pu_bacteria 2603880211 2606177354 486
101 iso_pu_bacteria 2608642108 2608668720 486
102 iso_pu_bacteria 2636415599 2637226371 486
103 iso_pu_bacteria 2654587920 2656277605 486
104 iso_pu_bacteria 2667528172 2671102555 486
105 iso_pu_bacteria 2671180115 2671586577 486
106 iso_pu_bacteria 2675903046 2676407472 486
107 iso_pu_bacteria 2681812866 2681995624 486
108 iso_pu_bacteria 2681812869 2682007418 486
109 iso_pu_bacteria 2687453601 2689443786 486
110 iso_pu_bacteria 2751185917 2753855194 486
111 iso_pu_bacteria 2765235842 2765588131 486
112 iso_pu_bacteria 2772190666 2772437825 486
113 iso_pu_bacteria 2775506706 2775541546 486
114 iso_pu_bacteria 2775507074 2777020312 486
115 iso_pu_bacteria 2791355275 2793406204 486
116 iso_pu_bacteria 2806310673 2807180447 486
117 iso_pu_bacteria 2811995292 2813729816 486
118 iso_pu_bacteria 2814123068 2814697311 486
119 iso_pu_bacteria 2821118458 2821118970 486
120 iso_pu_bacteria 2823373977 2823376780 486
121 iso_pu_bacteria 2844425489 2844426728 486
122 iso_pu_bacteria 2844528606 2844531505 486
123 iso_pu_bacteria 2846540461 2846542180 486
124 iso_pu_bacteria 2855195626 2855198753 486
125 iso_pu_bacteria 2858466076 2858470134 486
126 iso_pu_bacteria 2865014394 2865017695 486
127 iso_pu_bacteria 2869551831 2869553188 486
128 iso_pu_bacteria 2871272651 2871272967 486
129 iso_pu_bacteria 2871282230 2871286645 486
130 iso_pu_bacteria 2876601092 2876602681 486
131 iso_pu_bacteria 2881609920 2881610187 486
132 iso_pu_bacteria 2888366609 2888367819 486
133 iso_pu_bacteria 2888373701 2888374498 486
134 iso_pu_bacteria 2891670763 2891671540 486
135 iso_pu_bacteria 2900051742 2900054049 486
136 iso_pu_bacteria 2900051742 2900055714 486
137 iso_pu_bacteria 2904504865 2904505459 486
138 iso_pu_bacteria 2904513164 2904517373 486
139 iso_pu_bacteria 2919108558 2919111912 486
140 iso_pu_bacteria 2923634449 2923638620 486
141 iso_pu_bacteria 2927833300 2927834881 486
142 iso_pu_bacteria 2937539931 2937543487 486
143 iso_pu_bacteria 2937967321 2937969555 486
144 iso_pu_bacteria 2939568625 2939570433 486
145 iso_pu_bacteria 2939573065 2939574569 486
146 iso_pu_bacteria 2939642701 2939644536 486
147 iso_pu_bacteria 2945951305 2945953766 486
148 iso_pu_bacteria 2969079654 2969083352 486
149 iso_pu_bacteria 2971820967 2971824785 486
150 iso_pu_bacteria 2974310843 2974312947 486
151 iso_pu_bacteria 2978975091 2978976265 486
152 iso_pu_bacteria 2984559226 2984560368 486
153 iso_pu_bacteria 2984595703 2984598446 486
154 iso_pu_bacteria 640753048 640936827 486
155 iso_pu_bacteria 8004592986 8004594966 486
156 iso_pu_bacteria 8015394850 8015399520 486
157 iso_pu_bacteria 8016733728 8016736670 486
158 iso_pu_bacteria 8018221730 8018225332 486
159 iso_pu_bacteria 8018405270 8018408081 486
160 iso_pu_bacteria 8019499862 8019501906 486
161 iso_pu_bacteria 8054844752 8054847052 486
162 3300003856 Ga0058692_1009388 Ga0058692_10093881 487
163 3300009036 Ga0105244_10001923 Ga0105244_100019237 487
164 3300021384 Ga0213876_10000166 Ga0213876_1000016666 487
165 3300027312 Ga0209371_1001494 Ga0209371_100149416 487
166 3300030500 Ga0268256_1002134 Ga0268256_100213412 487
167 3300039437 Ga0436365_0105401 Ga0436365_0105401_66672_68135 487
168 3300041405 Ga0439438_000958 Ga0439438_000958_6557_8020 487
169 3300048925 Ga0496122_0001096 Ga0496122_0001096_1849_3312 487
170 3300048925 Ga0496122_0042408 Ga0496122_0042408_44_1519 487
171 3300048926 Ga0496123_0000808 Ga0496123_0000808_38471_39946 487
172 3300048926 Ga0496123_0000876 Ga0496123_0000876_43940_45403 487
173 3300013102 Ga0157371_10000462 Ga0157371_1000046214 488
174 3300041405 Ga0439438_000001 Ga0439438_000001_152828_154306 488
175 2162886007 SwRhRL2b_contig_359937 SwRhRL2b_0884.00003480 489
176 3300001989 JGI24739J22299_10001323 JGI24739J22299_100013235 489
177 3300002737 JGI25162J39368_1000003 JGI25162J39368_1000003476 489
178 3300002771 JGI25163J39215_1000007 JGI25163J39215_1000007106 489
179 3300002772 JGI25164J39214_1000014 JGI25164J39214_100001432 489
180 3300003751 Ga0055538_1000005 Ga0055538_1000005476 489
181 3300003752 Ga0055539_1000007 Ga0055539_1000007476 489
182 3300003756 Ga0055533_1000009 Ga0055533_1000009476 489
183 3300003759 Ga0055525_1000010 Ga0055525_1000010476 489
184 3300003841 Ga0055541_1000005 Ga0055541_100000589 489
185 3300005289 Ga0065704_10000763 Ga0065704_1000076326 489
186 3300006946 Ga0079104_1002462 Ga0079104_10024627 489
187 3300009011 Ga0105251_10007091 Ga0105251_100070915 489
188 3300009011 Ga0105251_10019327 Ga0105251_100193272 489
189 3300009036 Ga0105244_10000006 Ga0105244_10000006318 489
190 3300009036 Ga0105244_10000183 Ga0105244_1000018361 489
191 3300009036 Ga0105244_10000194 Ga0105244_1000019416 489
192 3300009036 Ga0105244_10000233 Ga0105244_1000023312 489
193 3300009036 Ga0105244_10001016 Ga0105244_1000101611 489
194 3300009092 Ga0105250_10000918 Ga0105250_100009183 489
195 3300013100 Ga0157373_10062561 Ga0157373_100625612 489
196 3300013102 Ga0157371_10000167 Ga0157371_1000016775 489
197 3300013102 Ga0157371_10003704 Ga0157371_100037048 489
198 3300013104 Ga0157370_10000093 Ga0157370_1000009389 489
199 3300013306 Ga0163162_10032890 Ga0163162_100328906 489
200 3300025207 Ga0209760_100001 Ga0209760_100001258 489
201 3300025224 Ga0209784_100001 Ga0209784_1000011018 489
202 3300025225 Ga0209566_100001 Ga0209566_1000011018 489
203 3300025226 Ga0209674_100002 Ga0209674_1000021018 489
204 3300025230 Ga0209563_100008 Ga0209563_1000081020 489
205 3300025231 Ga0207427_100002 Ga0207427_100002258 489
206 3300025233 Ga0209437_100007 Ga0209437_100007472 489
207 3300025253 Ga0209677_100004 Ga0209677_1000041020 489
208 3300025258 Ga0209129_1000015 Ga0209129_1000015439 489
209 3300025261 Ga0209233_1016721 Ga0209233_10167212 489
210 3300025711 Ga0207696_1000444 Ga0207696_100044423 489
211 3300025728 Ga0207655_1000149 Ga0207655_1000149108 489
212 3300025728 Ga0207655_1000157 Ga0207655_100015777 489
213 3300025728 Ga0207655_1000260 Ga0207655_100026011 489
214 3300025728 Ga0207655_1000370 Ga0207655_100037061 489
215 3300025735 Ga0207713_1011731 Ga0207713_10117312 489
216 3300025735 Ga0207713_1020370 Ga0207713_10203704 489
217 3300027111 Ga0209281_1005326 Ga0209281_10053264 489
218 3300027312 Ga0209371_1000056 Ga0209371_100005671 489
219 3300030500 Ga0268256_1000003 Ga0268256_1000003481 489
220 3300030500 Ga0268256_1006298 Ga0268256_10062982 489
221 3300042010 Ga0439452_000001 Ga0439452_000001_95345_96829 489
222 3300042137 Ga0450902_003005 Ga0450902_003005_578_2047 489
223 3300046458 Ga0495591_000011 Ga0495591_000011_304580_306049 489
224 3300046460 Ga0495638_0007167 Ga0495638_0007167_1841_3310 489
225 3300046471 Ga0495650_0000016 Ga0495650_0000016_170067_171536 489
226 3300046471 Ga0495650_0001723 Ga0495650_0001723_3568_5037 489
227 3300046507 Ga0495606_0000172 Ga0495606_0000172_109761_111230 489
228 3300046518 Ga0495631_0037675 Ga0495631_0037675_327_1796 489
229 3300046522 Ga0495643_0032533 Ga0495643_0032533_911_2380 489
230 3300046523 Ga0495644_0034851 Ga0495644_0034851_356_1825 489
231 3300046524 Ga0495648_0002038 Ga0495648_0002038_14792_16261 489
232 3300046530 Ga0495654_0000733 Ga0495654_0000733_11036_12505 489
233 3300046692 Ga0495671_0001141 Ga0495671_0001141_6897_8366 489
234 3300046694 Ga0495649_0019661 Ga0495649_0019661_1252_2721 489
235 3300046694 Ga0495649_0030690 Ga0495649_0030690_394_1875 489
236 3300046810 Ga0495660_0000007 Ga0495660_0000007_126365_127834 489
237 3300046810 Ga0495660_0000074 Ga0495660_0000074_83395_84864 489
238 3300047320 Ga0495672_0000004 Ga0495672_0000004_137850_139319 489
239 3300047323 Ga0495683_0014800 Ga0495683_0014800_1715_3184 489
240 3300047446 Ga0495679_004007 Ga0495679_004007_505_1974 489
241 3300047469 Ga0495673_0000023 Ga0495673_0000023_53877_55346 489
242 3300048903 Ga0496100_0045576 Ga0496100_0045576_825_2294 489
243 3300048904 Ga0496101_0007632 Ga0496101_0007632_3976_5445 489
244 3300048907 Ga0496104_0000940 Ga0496104_0000940_15327_16796 489
245 3300048919 Ga0496116_0000127 Ga0496116_0000127_126286_127755 489
246 3300048919 Ga0496116_0000385 Ga0496116_0000385_46001_47485 489
247 3300048920 Ga0496117_0001907 Ga0496117_0001907_24740_26233 489
248 3300048920 Ga0496117_0004360 Ga0496117_0004360_13682_15151 489
249 3300048920 Ga0496117_0004601 Ga0496117_0004601_1861_3345 489
250 3300048921 Ga0496118_0005561 Ga0496118_0005561_8426_9895 489
251 3300048921 Ga0496118_0006845 Ga0496118_0006845_2145_3629 489
252 3300048921 Ga0496118_0024150 Ga0496118_0024150_3622_5091 489
253 3300048922 Ga0496119_0000056 Ga0496119_0000056_156967_158448 489
254 3300048922 Ga0496119_0000607 Ga0496119_0000607_42804_44297 489
255 3300048922 Ga0496119_0005046 Ga0496119_0005046_2415_3884 489
256 3300048922 Ga0496119_0005988 Ga0496119_0005988_3785_5287 489
257 3300048923 Ga0496120_0000063 Ga0496120_0000063_150766_152247 489
258 3300048923 Ga0496120_0014222 Ga0496120_0014222_370_1863 489
259 3300048925 Ga0496122_0000013 Ga0496122_0000013_174366_175835 489
260 3300048925 Ga0496122_0028049 Ga0496122_0028049_1997_3490 489
261 3300048926 Ga0496123_0000010 Ga0496123_0000010_325205_326674 489
262 3300048926 Ga0496123_0035477 Ga0496123_0035477_1997_3490 489
263 3300048927 Ga0496124_0000515 Ga0496124_0000515_49368_50837 489
264 3300048927 Ga0496124_0001415 Ga0496124_0001415_10873_12366 489
265 3300048927 Ga0496124_0003498 Ga0496124_0003498_6220_7719 489
266 3300048927 Ga0496124_0009263 Ga0496124_0009263_627_2111 489
267 3300048928 Ga0496125_0000019 Ga0496125_0000019_116088_117557 489
268 3300048928 Ga0496125_0009553 Ga0496125_0009553_7580_9073 489
269 3300048929 Ga0496126_0001396 Ga0496126_0001396_21022_22491 489
270 3300049460 Ga0495682_0000026 Ga0495682_0000026_111982_113451 489
271 3300053126 Ga0500621_000001 Ga0500621_000001_526362_527831 489
272 iso_pu_bacteria 2932406140 2932408639 489
273 iso_pu_bacteria 2939577877 2939579031 489
274 2162886007 SwRhRL2b_contig_1805141 SwRhRL2b_0654.00008180 490
275 2162886007 SwRhRL2b_contig_284845 SwRhRL2b_0693.00001360 490
276 3300003320 rootH2_10000678 rootH2_1000067814 490
277 3300003856 Ga0058692_1000480 Ga0058692_10004802 490
278 3300003856 Ga0058692_1003043 Ga0058692_10030434 490
279 3300003856 Ga0058692_1004946 Ga0058692_10049462 490
280 3300003856 Ga0058692_1005271 Ga0058692_10052712 490
281 3300003856 Ga0058692_1012284 Ga0058692_10122842 490
282 3300005289 Ga0065704_10000313 Ga0065704_1000031351 490
283 3300005289 Ga0065704_10002666 Ga0065704_100026666 490
284 3300005347 Ga0070668_100012019 Ga0070668_1000120197 490
285 3300005548 Ga0070665_100000199 Ga0070665_10000019973 490
286 3300005577 Ga0068857_100000646 Ga0068857_10000064614 490
287 3300006051 Ga0075364_10004339 Ga0075364_100043398 490
288 3300006051 Ga0075364_10009002 Ga0075364_100090023 490
289 3300006195 Ga0075366_10023490 Ga0075366_100234904 490
290 3300006946 Ga0079104_1000080 Ga0079104_1000080129 490
291 3300006946 Ga0079104_1000087 Ga0079104_100008716 490
292 3300006946 Ga0079104_1000250 Ga0079104_100025012 490
293 3300006946 Ga0079104_1000324 Ga0079104_100032445 490
294 3300006946 Ga0079104_1000985 Ga0079104_100098512 490
295 3300006946 Ga0079104_1001383 Ga0079104_100138313 490
296 3300006946 Ga0079104_1002508 Ga0079104_10025083 490
297 3300006946 Ga0079104_1005210 Ga0079104_10052106 490
298 3300006946 Ga0079104_1009328 Ga0079104_10093283 490
299 3300006946 Ga0079104_1014918 Ga0079104_10149183 490
300 3300009011 Ga0105251_10000337 Ga0105251_1000033711 490
301 3300009011 Ga0105251_10000374 Ga0105251_1000037438 490
302 3300009011 Ga0105251_10000511 Ga0105251_100005118 490
303 3300009011 Ga0105251_10000642 Ga0105251_1000064213 490
304 3300009011 Ga0105251_10003592 Ga0105251_100035927 490
305 3300009011 Ga0105251_10007735 Ga0105251_100077351 490
306 3300009011 Ga0105251_10017246 Ga0105251_100172464 490
307 3300009036 Ga0105244_10000973 Ga0105244_1000097312 490
308 3300009036 Ga0105244_10002115 Ga0105244_100021152 490
309 3300009036 Ga0105244_10002376 Ga0105244_1000237611 490
310 3300009036 Ga0105244_10003362 Ga0105244_100033621 490
311 3300009036 Ga0105244_10010711 Ga0105244_100107112 490
312 3300009036 Ga0105244_10028016 Ga0105244_100280162 490
313 3300009036 Ga0105244_10044932 Ga0105244_100449321 490
314 3300009092 Ga0105250_10000003 Ga0105250_10000003263 490
315 3300009092 Ga0105250_10000026 Ga0105250_10000026178 490
316 3300009092 Ga0105250_10000133 Ga0105250_1000013348 490
317 3300009092 Ga0105250_10001673 Ga0105250_100016738 490
318 3300009092 Ga0105250_10001890 Ga0105250_100018908 490
319 3300009092 Ga0105250_10002003 Ga0105250_1000200311 490
320 3300009092 Ga0105250_10014416 Ga0105250_100144162 490
321 3300009092 Ga0105250_10047031 Ga0105250_100470312 490
322 3300009101 Ga0105247_10000018 Ga0105247_10000018165 490
323 3300009174 Ga0105241_10000004 Ga0105241_10000004432 490
324 3300011119 Ga0105246_10017030 Ga0105246_100170302 490
325 3300013100 Ga0157373_10002765 Ga0157373_100027652 490
326 3300013100 Ga0157373_10008291 Ga0157373_100082914 490
327 3300013100 Ga0157373_10010172 Ga0157373_100101725 490
328 3300013102 Ga0157371_10008243 Ga0157371_100082439 490
329 3300013102 Ga0157371_10049497 Ga0157371_100494973 490
330 3300013104 Ga0157370_10001894 Ga0157370_1000189410 490
331 3300013307 Ga0157372_10131886 Ga0157372_101318863 490
332 3300013307 Ga0157372_10142740 Ga0157372_101427402 490
333 3300014497 Ga0182008_10005912 Ga0182008_100059127 490
334 3300015261 Ga0182006_1000063 Ga0182006_100006372 490
335 3300015261 Ga0182006_1005872 Ga0182006_10058723 490
336 3300015679 Ga0183366_1001 Ga0183366_1001499 490
337 3300015680 Ga0183370_1001 Ga0183370_1001499 490
338 3300015685 Ga0183369_1001 Ga0183369_1001499 490
339 3300015687 Ga0183368_1001 Ga0183368_1001499 490
340 3300017792 Ga0163161_10000001 Ga0163161_1000000114 490
341 3300017792 Ga0163161_10112949 Ga0163161_101129492 490
342 3300025233 Ga0209437_100035 Ga0209437_10003514 490
343 3300025711 Ga0207696_1000001 Ga0207696_100000182 490
344 3300025711 Ga0207696_1000003 Ga0207696_1000003645 490
345 3300025711 Ga0207696_1000004 Ga0207696_1000004370 490
346 3300025711 Ga0207696_1000059 Ga0207696_100005954 490
347 3300025711 Ga0207696_1000312 Ga0207696_100031214 490
348 3300025711 Ga0207696_1001356 Ga0207696_10013565 490
349 3300025711 Ga0207696_1003078 Ga0207696_10030784 490
350 3300025711 Ga0207696_1003854 Ga0207696_10038547 490
351 3300025711 Ga0207696_1022675 Ga0207696_10226751 490
352 3300025728 Ga0207655_1000001 Ga0207655_1000001559 490
353 3300025728 Ga0207655_1000011 Ga0207655_1000011343 490
354 3300025728 Ga0207655_1000023 Ga0207655_1000023145 490
355 3300025728 Ga0207655_1000032 Ga0207655_1000032290 490
356 3300025728 Ga0207655_1000334 Ga0207655_100033412 490
357 3300025728 Ga0207655_1003730 Ga0207655_10037304 490
358 3300025728 Ga0207655_1009645 Ga0207655_10096455 490
359 3300025728 Ga0207655_1015472 Ga0207655_10154724 490
360 3300025728 Ga0207655_1039075 Ga0207655_10390752 490
361 3300025728 Ga0207655_1041595 Ga0207655_10415952 490
362 3300025735 Ga0207713_1000001 Ga0207713_1000001355 490
363 3300025735 Ga0207713_1000005 Ga0207713_1000005107 490
364 3300025735 Ga0207713_1000024 Ga0207713_10000247 490
365 3300025735 Ga0207713_1000059 Ga0207713_100005914 490
366 3300025735 Ga0207713_1000316 Ga0207713_100031623 490
367 3300025735 Ga0207713_1001778 Ga0207713_10017785 490
368 3300025735 Ga0207713_1031556 Ga0207713_10315561 490
369 3300025900 Ga0207710_10000049 Ga0207710_10000049141 490
370 3300025911 Ga0207654_10000006 Ga0207654_10000006449 490
371 3300026116 Ga0207674_10002213 Ga0207674_1000221328 490
372 3300027111 Ga0209281_1000001 Ga0209281_10000011397 490
373 3300027111 Ga0209281_1000008 Ga0209281_1000008347 490
374 3300027111 Ga0209281_1000021 Ga0209281_100002165 490
375 3300027111 Ga0209281_1000101 Ga0209281_1000101195 490
376 3300027111 Ga0209281_1000201 Ga0209281_100020116 490
377 3300027111 Ga0209281_1000291 Ga0209281_100029133 490
378 3300027111 Ga0209281_1000634 Ga0209281_100063414 490
379 3300027111 Ga0209281_1000780 Ga0209281_100078029 490
380 3300027111 Ga0209281_1000799 Ga0209281_100079920 490
381 3300027111 Ga0209281_1001293 Ga0209281_10012933 490
382 3300027111 Ga0209281_1009227 Ga0209281_10092271 490
383 3300027312 Ga0209371_1000001 Ga0209371_1000001459 490
384 3300027312 Ga0209371_1000010 Ga0209371_1000010501 490
385 3300027312 Ga0209371_1000047 Ga0209371_1000047239 490
386 3300027312 Ga0209371_1000170 Ga0209371_1000170102 490
387 3300027312 Ga0209371_1000590 Ga0209371_10005906 490
388 3300027312 Ga0209371_1000614 Ga0209371_10006146 490
389 3300027312 Ga0209371_1000677 Ga0209371_10006777 490
390 3300027312 Ga0209371_1001163 Ga0209371_10011632 490
391 3300027312 Ga0209371_1001201 Ga0209371_10012019 490
392 3300027312 Ga0209371_1003169 Ga0209371_10031692 490
393 3300027312 Ga0209371_1003558 Ga0209371_10035584 490
394 3300028379 Ga0268266_10000571 Ga0268266_1000057122 490
395 3300030500 Ga0268256_1000001 Ga0268256_10000012182 490
396 3300030500 Ga0268256_1000022 Ga0268256_1000022364 490
397 3300030500 Ga0268256_1000071 Ga0268256_1000071168 490
398 3300030500 Ga0268256_1000142 Ga0268256_10001426 490
399 3300030500 Ga0268256_1000438 Ga0268256_100043833 490
400 3300030500 Ga0268256_1000494 Ga0268256_100049414 490
401 3300030500 Ga0268256_1000514 Ga0268256_10005146 490
402 3300030500 Ga0268256_1000981 Ga0268256_100098118 490
403 3300030500 Ga0268256_1001031 Ga0268256_100103113 490
404 3300030500 Ga0268256_1003261 Ga0268256_10032615 490
405 3300030500 Ga0268256_1004464 Ga0268256_10044645 490
406 3300030500 Ga0268256_1010870 Ga0268256_10108703 490
407 3300041407 Ga0439447_005502 Ga0439447_005502_965_2458 490
408 3300041411 Ga0439466_0000003 Ga0439466_0000003_375601_377094 490
409 3300042010 Ga0439452_000003 Ga0439452_000003_440701_442173 490
410 3300042010 Ga0439452_000030 Ga0439452_000030_180658_182130 490
411 3300042010 Ga0439452_000220 Ga0439452_000220_33637_35109 490
412 3300042146 Ga0450907_000116 Ga0450907_000116_22554_24047 490
413 3300042439 Ga0439464_0005303 Ga0439464_0005303_458_1930 490
414 3300044669 Ga0466981_0000023 Ga0466981_0000023_72615_74087 490
415 3300046453 Ga0495627_000028 Ga0495627_000028_196989_198461 490
416 3300046458 Ga0495591_000080 Ga0495591_000080_58609_60081 490
417 3300046458 Ga0495591_000380 Ga0495591_000380_4931_6403 490
418 3300046471 Ga0495650_0000021 Ga0495650_0000021_524680_526152 490
419 3300046471 Ga0495650_0008194 Ga0495650_0008194_230_1705 490
420 3300046492 Ga0495585_0015936 Ga0495585_0015936_640_2133 490
421 3300046524 Ga0495648_0001111 Ga0495648_0001111_12043_13536 490
422 3300046530 Ga0495654_0000125 Ga0495654_0000125_58606_60078 490
423 3300046530 Ga0495654_0000358 Ga0495654_0000358_7650_9143 490
424 3300046542 Ga0495597_0001380 Ga0495597_0001380_5505_6986 490
425 3300046616 Ga0495668_0017944 Ga0495668_0017944_2130_3602 490
426 3300046660 Ga0495625_0005102 Ga0495625_0005102_4712_6193 490
427 3300046794 Ga0495589_0000002 Ga0495589_0000002_557584_559077 490
428 3300046810 Ga0495660_0004991 Ga0495660_0004991_1349_2842 490
429 3300047320 Ga0495672_0000009 Ga0495672_0000009_210728_212221 490
430 3300047320 Ga0495672_0000012 Ga0495672_0000012_144912_146405 490
431 3300047446 Ga0495679_000113 Ga0495679_000113_60925_62406 490
432 3300047469 Ga0495673_0000022 Ga0495673_0000022_242689_244161 490
433 3300047470 Ga0495681_0045964 Ga0495681_0045964_513_1991 490
434 3300048903 Ga0496100_0070126 Ga0496100_0070126_500_1972 490
435 3300048904 Ga0496101_0000098 Ga0496101_0000098_23059_24531 490
436 3300048905 Ga0496102_0006081 Ga0496102_0006081_313_1806 490
437 3300048907 Ga0496104_0000256 Ga0496104_0000256_30768_32240 490
438 3300048908 Ga0496105_0012322 Ga0496105_0012322_354_1847 490
439 3300048908 Ga0496105_0031185 Ga0496105_0031185_637_2109 490
440 3300048919 Ga0496116_0000023 Ga0496116_0000023_15220_16692 490
441 3300048919 Ga0496116_0001717 Ga0496116_0001717_1908_3413 490
442 3300048919 Ga0496116_0006112 Ga0496116_0006112_4630_6102 490
443 3300048919 Ga0496116_0014320 Ga0496116_0014320_1067_2539 490
444 3300048919 Ga0496116_0063169 Ga0496116_0063169_521_1993 490
445 3300048920 Ga0496117_0000004 Ga0496117_0000004_658692_660185 490
446 3300048920 Ga0496117_0000131 Ga0496117_0000131_160912_162405 490
447 3300048920 Ga0496117_0001660 Ga0496117_0001660_26719_28203 490
448 3300048920 Ga0496117_0003668 Ga0496117_0003668_4446_5918 490
449 3300048920 Ga0496117_0012155 Ga0496117_0012155_1613_3085 490
450 3300048920 Ga0496117_0014206 Ga0496117_0014206_4777_6249 490
451 3300048920 Ga0496117_0016478 Ga0496117_0016478_1206_2678 490
452 3300048920 Ga0496117_0027333 Ga0496117_0027333_502_1977 490
453 3300048920 Ga0496117_0036179 Ga0496117_0036179_817_2289 490
454 3300048920 Ga0496117_0036669 Ga0496117_0036669_205_1698 490
455 3300048921 Ga0496118_0000024 Ga0496118_0000024_166797_168290 490
456 3300048921 Ga0496118_0000782 Ga0496118_0000782_38619_40091 490
457 3300048921 Ga0496118_0013885 Ga0496118_0013885_317_1789 490
458 3300048921 Ga0496118_0016916 Ga0496118_0016916_3512_4984 490
459 3300048921 Ga0496118_0043510 Ga0496118_0043510_1270_2742 490
460 3300048922 Ga0496119_0000068 Ga0496119_0000068_140876_142369 490
461 3300048922 Ga0496119_0000529 Ga0496119_0000529_12418_13893 490
462 3300048922 Ga0496119_0002583 Ga0496119_0002583_8127_9635 490
463 3300048922 Ga0496119_0005304 Ga0496119_0005304_844_2352 490
464 3300048922 Ga0496119_0012955 Ga0496119_0012955_3921_5414 490
465 3300048922 Ga0496119_0014151 Ga0496119_0014151_57_1529 490
466 3300048922 Ga0496119_0017415 Ga0496119_0017415_1057_2529 490
467 3300048922 Ga0496119_0030578 Ga0496119_0030578_664_2136 490
468 3300048922 Ga0496119_0039501 Ga0496119_0039501_1354_2826 490
469 3300048922 Ga0496119_0044744 Ga0496119_0044744_1088_2560 490
470 3300048923 Ga0496120_0000193 Ga0496120_0000193_98717_100222 490
471 3300048923 Ga0496120_0000194 Ga0496120_0000194_16380_17873 490
472 3300048923 Ga0496120_0000290 Ga0496120_0000290_63643_65151 490
473 3300048923 Ga0496120_0000859 Ga0496120_0000859_37061_38533 490
474 3300048923 Ga0496120_0001066 Ga0496120_0001066_19881_21389 490
475 3300048923 Ga0496120_0001162 Ga0496120_0001162_15524_17017 490
476 3300048923 Ga0496120_0003077 Ga0496120_0003077_1327_2802 490
477 3300048923 Ga0496120_0004966 Ga0496120_0004966_4663_6135 490
478 3300048923 Ga0496120_0007704 Ga0496120_0007704_1211_2683 490
479 3300048923 Ga0496120_0033806 Ga0496120_0033806_497_1969 490
480 3300048924 Ga0496121_0000185 Ga0496121_0000185_38584_40077 490
481 3300048924 Ga0496121_0004683 Ga0496121_0004683_1426_2910 490
482 3300048924 Ga0496121_0006847 Ga0496121_0006847_7930_9402 490
483 3300048924 Ga0496121_0006950 Ga0496121_0006950_1325_2797 490
484 3300048924 Ga0496121_0007043 Ga0496121_0007043_7338_8810 490
485 3300048924 Ga0496121_0008679 Ga0496121_0008679_5207_6691 490
486 3300048924 Ga0496121_0017719 Ga0496121_0017719_4742_6214 490
487 3300048924 Ga0496121_0025740 Ga0496121_0025740_1088_2560 490
488 3300048925 Ga0496122_0000099 Ga0496122_0000099_16180_17652 490
489 3300048925 Ga0496122_0000796 Ga0496122_0000796_17159_18631 490
490 3300048925 Ga0496122_0017293 Ga0496122_0017293_740_2212 490
491 3300048925 Ga0496122_0018246 Ga0496122_0018246_1390_2874 490
492 3300048925 Ga0496122_0019926 Ga0496122_0019926_3011_4483 490
493 3300048926 Ga0496123_0000005 Ga0496123_0000005_282791_284263 490
494 3300048926 Ga0496123_0000599 Ga0496123_0000599_42636_44108 490
495 3300048926 Ga0496123_0002225 Ga0496123_0002225_14822_16294 490
496 3300048926 Ga0496123_0003321 Ga0496123_0003321_323_1816 490
497 3300048926 Ga0496123_0009152 Ga0496123_0009152_740_2212 490
498 3300048926 Ga0496123_0014580 Ga0496123_0014580_3035_4507 490
499 3300048926 Ga0496123_0022475 Ga0496123_0022475_2858_4330 490
500 3300048927 Ga0496124_0000039 Ga0496124_0000039_38321_39829 490
501 3300048927 Ga0496124_0003869 Ga0496124_0003869_3674_5167 490
502 3300048927 Ga0496124_0004405 Ga0496124_0004405_10357_11829 490
503 3300048927 Ga0496124_0009444 Ga0496124_0009444_4703_6208 490
504 3300048927 Ga0496124_0010143 Ga0496124_0010143_6358_7851 490
505 3300048927 Ga0496124_0027511 Ga0496124_0027511_2141_3625 490
506 3300048927 Ga0496124_0049486 Ga0496124_0049486_467_1939 490
507 3300048927 Ga0496124_0123796 Ga0496124_0123796_399_1871 490
508 3300048928 Ga0496125_0000016 Ga0496125_0000016_151741_153225 490
509 3300048928 Ga0496125_0004463 Ga0496125_0004463_4605_6077 490
510 3300048928 Ga0496125_0004856 Ga0496125_0004856_12374_13858 490
511 3300048928 Ga0496125_0099216 Ga0496125_0099216_114_1691 490
512 3300048928 Ga0496125_0147449 Ga0496125_0147449_54_1526 490
513 3300048929 Ga0496126_0000346 Ga0496126_0000346_85106_86578 490
514 3300048929 Ga0496126_0008127 Ga0496126_0008127_5965_7542 490
515 3300048929 Ga0496126_0027407 Ga0496126_0027407_2013_3485 490
516 3300048929 Ga0496126_0066040 Ga0496126_0066040_1238_2710 490
517 3300048929 Ga0496126_0074618 Ga0496126_0074618_956_2440 490
518 3300050491 nmdc:mga00v17_15027_c1 nmdc:mga00v17_15027_c1_305_1777 490
519 3300050493 nmdc:mga0k408_9791_c2 nmdc:mga0k408_9791_c2_1590_3062 490
520 iso_pu_bacteria 2511231035 2511436064 490
521 iso_pu_bacteria 2939602548 2939602843 490

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

310

464

0.92

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

419

497

0.89

PF00005

ABC_tran

ABC transporter

53

198

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ihy-assembly1.cif.gz_A structure of the staphylococcus aureus putative atpase subunit of an atp-binding cassette (abc) transporter 0.9127 258 489
7nnu-assembly1.cif.gz_A cryo-em structure of the folate-specific ecf transporter complex in msp2n2 lipid nanodiscs 0.877 258 474
4hzi-assembly1.cif.gz_A crystal structure of the leptospira interrogans atpase subunit of an orphan abc transporter 0.8751 258 483
4hzi-assembly1.cif.gz_B crystal structure of the leptospira interrogans atpase subunit of an orphan abc transporter 0.8652 258 489
8bmr-assembly1.cif.gz_A cryo-em structure of the wild-type solitary ecf module in msp2n2 lipid nanodiscs in the atpase open and nucleotide-free conformation 0.8626 258 482
ID Description Score Start End Superfamily
af_P31060_247_480_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9881 247 479 3.40.50.300
af_P31060_247_480_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9797 247 479 3.40.50.300
af_P31060_4_241_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9272 5 240 3.40.50.300
af_P31060_4_241_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9167 5 240 3.40.50.300
af_A4HRM7_1245_1429_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8937 100 225 3.40.50.300
ID Description Score Start End GO Terms
AF-X0U0N2-F1-model_v4 ABC transporter domain-containing protein 0.9535 113 225 GO:0005524
GO:0005886
GO:0016887
AF-A0A836RXZ5-F1-model_v4 ABC transporter ATP-binding protein 0.9431 114 227 GO:0005524
GO:0016887
AF-A0A843JDG0-F1-model_v4 Amino acid ABC transporter ATP-binding protein 0.9331 114 225 GO:0005524
GO:0005886
GO:0015716
GO:0016887
AF-T0QFQ1-F1-model_v4 deleted 0.9296 100 225
AF-A0A2N1QX64-F1-model_v4 ABC transporter ATP-binding protein 0.9279 114 225 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806

Feature Viewer

pLDDT pTM Quality
84.59 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map