F458497

General Info

Members Datasets Scaffolds Average Seq Length
520 242 1040 116

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_11150758|Ga0065715_111507581
Length 135
Sequence MRLDYSIISIIVEIQNGGNVPTSSKKQSDLIIRYADMLAAMGTEPRLRIMQLLLSAHPEGLVVGDIGDELEIASSTLSHHLEKLKNEDLVRVRREGTFLWYSANAEALQELLGFLYAECCTRNKAVEPQKIVCCK

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
100 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
101 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
153 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
158 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
159 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
160 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
161 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
162 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
163 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
164 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
165 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
166 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
167 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
169 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
170 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
171 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
172 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
173 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
174 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
175 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
176 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
177 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
178 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
179 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
180 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
181 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
182 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
186 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
187 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
188 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
189 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
190 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
191 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
192 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
193 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
194 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
195 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
196 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
197 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
198 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
199 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
200 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
201 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
202 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
203 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
217 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
218 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
219 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
222 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
223 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
224 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
227 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
231 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
232 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
233 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
234 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
235 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
236 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
237 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
238 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
239 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
240 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
241 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
242 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.85
Metatranscriptomes 1.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.19
Nodule 0
Rhizoplane 0.96
Rhizosphere 98.08
Stem 0
Stem Tuber 0
Unclassified 17.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_11150758 3300005293 Unclassified 509
2 Ga0065712_10412436 3300005290 Unclassified 720
3 Ga0070676_10052631 3300005328 Bacteria 2395
4 Ga0070683_100119673 3300005329 Unclassified 2487
5 Ga0070690_100038563 3300005330 Bacteria 3016
6 Ga0070690_100085183 3300005330 Bacteria 2073
7 Ga0070690_100144490 3300005330 Bacteria 1617
8 Ga0070690_100241012 3300005330 Bacteria 1275
9 Ga0070670_100271679 3300005331 Bacteria 1479
10 Ga0068869_100107038 3300005334 Bacteria 2123
11 Ga0068869_101101298 3300005334 Bacteria 695
12 Ga0070666_10062053 3300005335 Bacteria 2531
13 Ga0070680_100876941 3300005336 Bacteria 774
14 Ga0070682_100117686 3300005337 Bacteria 1779
15 Ga0070682_100938190 3300005337 Bacteria 714
16 Ga0068868_100061017 3300005338 Bacteria 2987
17 Ga0068868_100632085 3300005338 Unclassified 951
18 Ga0068868_101748631 3300005338 Unclassified 587
19 Ga0068868_102027762 3300005338 Unclassified 546
20 Ga0070660_100212168 3300005339 Bacteria 1572
21 Ga0070660_100298212 3300005339 Bacteria 1321
22 Ga0070689_100188606 3300005340 Bacteria 1678
23 Ga0070687_100445247 3300005343 Unclassified 860
24 Ga0070687_100615263 3300005343 Unclassified 748
25 Ga0070661_100585227 3300005344 Unclassified 901
26 Ga0070692_10227508 3300005345 Bacteria 1105
27 Ga0070669_100231560 3300005353 Bacteria 1465
28 Ga0070675_100015190 3300005354 Bacteria 6081
29 Ga0070675_101017704 3300005354 Bacteria 761
30 Ga0070671_100305284 3300005355 Bacteria 1355
31 Ga0070671_100383899 3300005355 Bacteria 1201
32 Ga0070673_100082127 3300005364 Bacteria 2615
33 Ga0070673_100197328 3300005364 Bacteria 1732
34 Ga0070673_100343017 3300005364 Bacteria 1324
35 Ga0070673_100660350 3300005364 Bacteria 958
36 Ga0070673_100823154 3300005364 Bacteria 858
37 Ga0070673_101300648 3300005364 Bacteria 683
38 Ga0070688_100334070 3300005365 Unclassified 1105
39 Ga0070688_101214132 3300005365 Unclassified 606
40 Ga0070659_101065196 3300005366 Bacteria 712
41 Ga0070667_100014038 3300005367 Bacteria 6621
42 Ga0070703_10003299 3300005406 Bacteria 4603
43 Ga0070711_100003308 3300005439 Bacteria 9378
44 Ga0070711_100048507 3300005439 Bacteria 2904
45 Ga0070694_100002159 3300005444 Bacteria 11652
46 Ga0070708_100153967 3300005445 Bacteria 2139
47 Ga0070678_100077469 3300005456 Bacteria 2508
48 Ga0070678_100171798 3300005456 Bacteria 1766
49 Ga0070681_10027003 3300005458 Bacteria 5772
50 Ga0070681_10073784 3300005458 Bacteria 3374
51 Ga0070681_10690179 3300005458 Bacteria 936
52 Ga0068867_100122015 3300005459 Bacteria 2015
53 Ga0070685_10061267 3300005466 Bacteria 2203
54 Ga0070685_10549546 3300005466 Unclassified 824
55 Ga0070707_100283461 3300005468 Bacteria 1610
56 Ga0070707_100465388 3300005468 Bacteria 1225
57 Ga0070699_100026542 3300005518 Bacteria 4994
58 Ga0070699_101006868 3300005518 Unclassified 764
59 Ga0070679_100048974 3300005530 Bacteria 4209
60 Ga0070679_100115388 3300005530 Bacteria 2671
61 Ga0070679_100668327 3300005530 Unclassified 981
62 Ga0070684_100020373 3300005535 Bacteria 5503
63 Ga0070684_100912793 3300005535 Unclassified 823
64 Ga0070697_100060353 3300005536 Bacteria 3091
65 Ga0070697_100987809 3300005536 Bacteria 748
66 Ga0070697_101476398 3300005536 Bacteria 607
67 Ga0068853_100147119 3300005539 Bacteria 2118
68 Ga0070672_100102677 3300005543 Bacteria 2321
69 Ga0070672_100637331 3300005543 Bacteria 930
70 Ga0070672_101816655 3300005543 Unclassified 548
71 Ga0070686_101184698 3300005544 Unclassified 634
72 Ga0070695_100007434 3300005545 Bacteria 6497
73 Ga0070695_100471036 3300005545 Bacteria 966
74 Ga0070693_100030957 3300005547 Bacteria 2930
75 Ga0070693_100065320 3300005547 Bacteria 2126
76 Ga0070665_100065374 3300005548 Bacteria 3648
77 Ga0070665_100270134 3300005548 Bacteria 1702
78 Ga0070665_100487966 3300005548 Bacteria 1243
79 Ga0070665_100625071 3300005548 Bacteria 1090
80 Ga0070704_100005767 3300005549 Bacteria 7244
81 Ga0068855_100036104 3300005563 Bacteria 5884
82 Ga0068855_100374480 3300005563 Bacteria 1564
83 Ga0068855_100886250 3300005563 Bacteria 943
84 Ga0068855_100895160 3300005563 Bacteria 938
85 Ga0070664_100024654 3300005564 Bacteria 4979
86 Ga0070664_100149041 3300005564 Bacteria 2065
87 Ga0070664_100642364 3300005564 Bacteria 986
88 Ga0068857_100015456 3300005577 Bacteria 6668
89 Ga0068857_100018242 3300005577 Bacteria 6155
90 Ga0068857_100019614 3300005577 Bacteria 5939
91 Ga0068857_100472596 3300005577 Bacteria 1174
92 Ga0068854_100064004 3300005578 Bacteria 2671
93 Ga0068854_101078967 3300005578 Bacteria 714
94 Ga0068856_100047459 3300005614 Bacteria 4230
95 Ga0068856_100075771 3300005614 Bacteria 3332
96 Ga0068856_100224207 3300005614 Bacteria 1895
97 Ga0068856_100349061 3300005614 Bacteria 1498
98 Ga0068856_101008233 3300005614 Bacteria 851
99 Ga0068852_100446427 3300005616 Bacteria 1280
100 Ga0068852_100539189 3300005616 Bacteria 1166
101 Ga0068859_100010419 3300005617 Bacteria 9351
102 Ga0068859_100803696 3300005617 Unclassified 1028
103 Ga0068859_101311466 3300005617 Bacteria 798
104 Ga0068859_101636452 3300005617 Unclassified 711
105 Ga0068864_100157090 3300005618 Unclassified 2065
106 Ga0068864_100445018 3300005618 Unclassified 1238
107 Ga0068864_100792066 3300005618 Bacteria 931
108 Ga0068864_101655907 3300005618 Unclassified 644
109 Ga0068866_10188947 3300005718 Bacteria 1222
110 Ga0068861_100975346 3300005719 Unclassified 807
111 Ga0068863_100021355 3300005841 Bacteria 6178
112 Ga0068863_100141925 3300005841 Bacteria 2296
113 Ga0068863_100835971 3300005841 Bacteria 919
114 Ga0068858_100015894 3300005842 Bacteria 7073
115 Ga0068858_102274480 3300005842 Unclassified 536
116 Ga0068858_102530657 3300005842 Unclassified 507
117 Ga0068860_100057334 3300005843 Bacteria 3703
118 Ga0068860_100138792 3300005843 Bacteria 2335
119 Ga0068860_100458870 3300005843 Bacteria 1268
120 Ga0068862_100288530 3300005844 Bacteria 1506
121 Ga0070717_10012454 3300006028 Bacteria 6486
122 Ga0070717_10041825 3300006028 Bacteria 3737
123 Ga0070716_100000585 3300006173 Bacteria 15316
124 Ga0070716_100159780 3300006173 Bacteria 1459
125 Ga0070716_100756665 3300006173 Unclassified 748
126 Ga0070712_100019794 3300006175 Bacteria 4396
127 Ga0070712_101713674 3300006175 Unclassified 550
128 Ga0097621_100036508 3300006237 Bacteria 3932
129 Ga0097621_100066193 3300006237 Bacteria 2975
130 Ga0097621_100110113 3300006237 Bacteria 2327
131 Ga0097621_100246109 3300006237 Bacteria 1564
132 Ga0097621_100324215 3300006237 Unclassified 1365
133 Ga0097621_101754317 3300006237 Bacteria 591
134 Ga0068871_100004319 3300006358 Bacteria 9872
135 Ga0068871_100022065 3300006358 Bacteria 4905
136 Ga0068871_100111139 3300006358 Unclassified 2305
137 Ga0075428_100213171 3300006844 Bacteria 2087
138 Ga0075428_100612511 3300006844 Bacteria 1163
139 Ga0075428_100692496 3300006844 Bacteria 1086
140 Ga0075430_100069973 3300006846 Bacteria 2943
141 Ga0075430_100334128 3300006846 Bacteria 1252
142 Ga0075430_100482406 3300006846 Bacteria 1023
143 Ga0075431_100476900 3300006847 Bacteria 1241
144 Ga0075431_100479018 3300006847 Bacteria 1238
145 Ga0075431_101502385 3300006847 Bacteria 632
146 Ga0075431_101900904 3300006847 Unclassified 551
147 Ga0075434_100015167 3300006871 Bacteria 7383
148 Ga0075434_100772137 3300006871 Bacteria 978
149 Ga0075429_100043352 3300006880 Bacteria 3915
150 Ga0068865_100006268 3300006881 Bacteria 7241
151 Ga0075436_100305796 3300006914 Bacteria 1140
152 Ga0097620_100010419 3300006931 Bacteria 9351
153 Ga0097620_100803568 3300006931 Unclassified 1028
154 Ga0097620_101311538 3300006931 Bacteria 798
155 Ga0097620_101635730 3300006931 Unclassified 711
156 Ga0075435_100417309 3300007076 Bacteria 1155
157 Ga0075435_100705353 3300007076 Unclassified 877
158 Ga0105240_10001309 3300009093 Bacteria 42943
159 Ga0105240_10118669 3300009093 Bacteria 3188
160 Ga0105240_10179226 3300009093 Bacteria 2502
161 Ga0105240_10322351 3300009093 Bacteria 1761
162 Ga0105240_10659866 3300009093 Bacteria 1145
163 Ga0105240_11075626 3300009093 Bacteria 857
164 Ga0105240_11624050 3300009093 Unclassified 676
165 Ga0111539_10849815 3300009094 Bacteria 1062
166 Ga0111539_12015722 3300009094 Bacteria 669
167 Ga0105245_10004551 3300009098 Bacteria 12237
168 Ga0105245_10070687 3300009098 Unclassified 3168
169 Ga0105245_10072695 3300009098 Bacteria 3125
170 Ga0105245_10165664 3300009098 Bacteria 2101
171 Ga0105245_10667982 3300009098 Bacteria 1070
172 Ga0105247_10140193 3300009101 Bacteria 1583
173 Ga0105247_10144653 3300009101 Bacteria 1561
174 Ga0105247_10394498 3300009101 Unclassified 984
175 Ga0114129_10418576 3300009147 Bacteria 1763
176 Ga0114129_12985423 3300009147 Bacteria 557
177 Ga0105243_10102000 3300009148 Bacteria 2383
178 Ga0105243_10491262 3300009148 Bacteria 1161
179 Ga0105243_10566523 3300009148 Unclassified 1088
180 Ga0105243_10803409 3300009148 Bacteria 927
181 Ga0105243_12045142 3300009148 Unclassified 608
182 Ga0105241_10010673 3300009174 Bacteria 6738
183 Ga0105241_10088583 3300009174 Bacteria 2437
184 Ga0105241_10151940 3300009174 Bacteria 1895
185 Ga0105241_10183675 3300009174 Bacteria 1736
186 Ga0105241_10555411 3300009174 Bacteria 1031
187 Ga0105241_10845907 3300009174 Unclassified 846
188 Ga0105242_10012668 3300009176 Bacteria 6494
189 Ga0105242_10017298 3300009176 Bacteria 5615
190 Ga0105242_10019175 3300009176 Bacteria 5358
191 Ga0105242_10236654 3300009176 Bacteria 1639
192 Ga0105242_10300293 3300009176 Bacteria 1465
193 Ga0105242_10319806 3300009176 Bacteria 1423
194 Ga0105242_10351506 3300009176 Bacteria 1361
195 Ga0105242_11728607 3300009176 Bacteria 662
196 Ga0105242_12289494 3300009176 Unclassified 586
197 Ga0105248_10003621 3300009177 Bacteria 17140
198 Ga0105248_10008653 3300009177 Bacteria 11181
199 Ga0105248_10009284 3300009177 Bacteria 10829
200 Ga0105248_10537842 3300009177 Bacteria 1318
201 Ga0105248_10638753 3300009177 Unclassified 1201
202 Ga0105248_11416377 3300009177 Bacteria 786
203 Ga0105237_10002493 3300009545 Bacteria 22822
204 Ga0105237_10012575 3300009545 Bacteria 8915
205 Ga0105237_10621669 3300009545 Unclassified 1087
206 Ga0105238_10004437 3300009551 Bacteria 13910
207 Ga0105238_10029444 3300009551 Bacteria 5594
208 Ga0105238_10163762 3300009551 Bacteria 2200
209 Ga0105238_10310693 3300009551 Bacteria 1561
210 Ga0105238_12648696 3300009551 Bacteria 538
211 Ga0105249_10409333 3300009553 Bacteria 1388
212 Ga0105249_11510899 3300009553 Bacteria 744
213 Ga0105249_12998225 3300009553 Unclassified 542
214 Ga0105239_10056524 3300010375 Bacteria 4304
215 Ga0105239_10091397 3300010375 Bacteria 3359
216 Ga0105239_10162354 3300010375 Bacteria 2497
217 Ga0105239_12428319 3300010375 Unclassified 611
218 Ga0105246_10070087 3300011119 Bacteria 2465
219 Ga0105246_10160750 3300011119 Bacteria 1711
220 Ga0105246_11148740 3300011119 Unclassified 712
221 Ga0105246_12536742 3300011119 Bacteria 505
222 Ga0157370_10132149 3300013104 Bacteria 2328
223 Ga0157369_10042232 3300013105 Bacteria 4975
224 Ga0157369_10220982 3300013105 Bacteria 1983
225 Ga0157369_11684717 3300013105 Unclassified 644
226 Ga0157374_10011369 3300013296 Bacteria 7704
227 Ga0157374_10242630 3300013296 Bacteria 1772
228 Ga0157374_10246099 3300013296 Bacteria 1759
229 Ga0157374_10617814 3300013296 Bacteria 1094
230 Ga0157374_11141531 3300013296 Bacteria 800
231 Ga0157374_11609535 3300013296 Unclassified 674
232 Ga0157378_10008966 3300013297 Bacteria 8710
233 Ga0157378_10019906 3300013297 Bacteria 5901
234 Ga0157378_10311195 3300013297 Bacteria 1527
235 Ga0157378_11579407 3300013297 Unclassified 702
236 Ga0163162_10042673 3300013306 Bacteria 4541
237 Ga0163162_10070953 3300013306 Bacteria 3536
238 Ga0163162_10107894 3300013306 Bacteria 2880
239 Ga0163162_10469317 3300013306 Bacteria 1390
240 Ga0163162_12510951 3300013306 Unclassified 593
241 Ga0157372_10003294 3300013307 Bacteria 17440
242 Ga0157372_10799381 3300013307 Bacteria 1096
243 Ga0157372_11046052 3300013307 Bacteria 945
244 Ga0157375_10008177 3300013308 Bacteria 9157
245 Ga0157375_10277305 3300013308 Bacteria 1839
246 Ga0157375_10453347 3300013308 Bacteria 1448
247 Ga0163163_10060723 3300014325 Bacteria 3744
248 Ga0163163_10166548 3300014325 Bacteria 2250
249 Ga0163163_10328352 3300014325 Bacteria 1584
250 Ga0163163_10536187 3300014325 Bacteria 1233
251 Ga0163163_10573631 3300014325 Unclassified 1191
252 Ga0163163_10713613 3300014325 Bacteria 1066
253 Ga0163163_10945810 3300014325 Bacteria 925
254 Ga0163163_11957123 3300014325 Unclassified 646
255 Ga0157380_12730107 3300014326 Unclassified 560
256 Ga0157377_10598625 3300014745 Bacteria 786
257 Ga0157379_10000180 3300014968 Bacteria 47884
258 Ga0157379_10016182 3300014968 Bacteria 6562
259 Ga0157376_10011170 3300014969 Bacteria 6607
260 Ga0157376_10028287 3300014969 Bacteria 4455
261 Ga0157376_10081988 3300014969 Bacteria 2770
262 Ga0163161_10004663 3300017792 Bacteria 9529
263 Ga0213873_10017761 3300021358 Unclassified 1627
264 Ga0213872_10101830 3300021361 Bacteria 1280
265 Ga0224572_1024311 3300024225 Bacteria 1163
266 Ga0224572_1026457 3300024225 Bacteria 1112
267 Ga0207697_10402689 3300025315 Unclassified 608
268 Ga0207642_10651652 3300025899 Unclassified 660
269 Ga0207710_10149893 3300025900 Bacteria 1131
270 Ga0207710_10348890 3300025900 Unclassified 754
271 Ga0207680_10044610 3300025903 Bacteria 2609
272 Ga0207680_10688313 3300025903 Unclassified 733
273 Ga0207680_10819195 3300025903 Bacteria 667
274 Ga0207684_10066532 3300025910 Bacteria 3060
275 Ga0207684_10857282 3300025910 Unclassified 765
276 Ga0207654_10004960 3300025911 Bacteria 6729
277 Ga0207654_10577331 3300025911 Bacteria 801
278 Ga0207654_10604041 3300025911 Bacteria 783
279 Ga0207707_10029072 3300025912 Bacteria 4830
280 Ga0207707_10099864 3300025912 Unclassified 2536
281 Ga0207707_10564131 3300025912 Unclassified 966
282 Ga0207707_11582158 3300025912 Unclassified 517
283 Ga0207695_10027344 3300025913 Bacteria 6353
284 Ga0207695_10703499 3300025913 Bacteria 891
285 Ga0207695_11547946 3300025913 Bacteria 544
286 Ga0207695_11730723 3300025913 Unclassified 506
287 Ga0207671_10022317 3300025914 Bacteria 4787
288 Ga0207671_10030619 3300025914 Unclassified 4012
289 Ga0207671_10281801 3300025914 Bacteria 1311
290 Ga0207693_10010223 3300025915 Bacteria 7619
291 Ga0207663_10001205 3300025916 Bacteria 11947
292 Ga0207663_10005501 3300025916 Bacteria 6387
293 Ga0207660_10426816 3300025917 Bacteria 1070
294 Ga0207660_10606395 3300025917 Unclassified 892
295 Ga0207660_10902172 3300025917 Bacteria 721
296 Ga0207662_10908482 3300025918 Unclassified 623
297 Ga0207662_11151887 3300025918 Unclassified 551
298 Ga0207657_10462739 3300025919 Bacteria 995
299 Ga0207657_11122399 3300025919 Unclassified 600
300 Ga0207649_10240627 3300025920 Bacteria 1299
301 Ga0207649_10473265 3300025920 Bacteria 949
302 Ga0207649_10670711 3300025920 Bacteria 802
303 Ga0207646_10025674 3300025922 Bacteria 5387
304 Ga0207646_10195573 3300025922 Bacteria 1826
305 Ga0207694_10002315 3300025924 Bacteria 15573
306 Ga0207694_10134719 3300025924 Bacteria 1983
307 Ga0207694_10514092 3300025924 Bacteria 1003
308 Ga0207694_11087095 3300025924 Bacteria 677
309 Ga0207694_11604379 3300025924 Unclassified 548
310 Ga0207659_10000818 3300025926 Bacteria 18436
311 Ga0207659_10002355 3300025926 Bacteria 11257
312 Ga0207659_11390893 3300025926 Unclassified 602
313 Ga0207687_10006391 3300025927 Bacteria 7788
314 Ga0207687_10043169 3300025927 Unclassified 3106
315 Ga0207687_10135311 3300025927 Bacteria 1863
316 Ga0207687_11558713 3300025927 Unclassified 567
317 Ga0207664_10000528 3300025929 Bacteria 27199
318 Ga0207690_10054071 3300025932 Bacteria 2697
319 Ga0207690_10515822 3300025932 Bacteria 968
320 Ga0207706_10028531 3300025933 Bacteria 4984
321 Ga0207686_10045649 3300025934 Bacteria 2697
322 Ga0207686_10149711 3300025934 Bacteria 1623
323 Ga0207686_10197802 3300025934 Bacteria 1437
324 Ga0207686_10263683 3300025934 Bacteria 1264
325 Ga0207686_10411044 3300025934 Bacteria 1033
326 Ga0207686_11065939 3300025934 Bacteria 658
327 Ga0207709_10353580 3300025935 Bacteria 1110
328 Ga0207709_10902044 3300025935 Bacteria 718
329 Ga0207709_11150703 3300025935 Unclassified 638
330 Ga0207670_10303666 3300025936 Bacteria 1250
331 Ga0207670_10531032 3300025936 Bacteria 959
332 Ga0207670_11770759 3300025936 Unclassified 525
333 Ga0207704_10404209 3300025938 Bacteria 1078
334 Ga0207665_10000156 3300025939 Bacteria 46270
335 Ga0207665_10535863 3300025939 Bacteria 908
336 Ga0207691_10020017 3300025940 Bacteria 6331
337 Ga0207711_10011224 3300025941 Bacteria 7445
338 Ga0207711_10012495 3300025941 Bacteria 7056
339 Ga0207711_10028923 3300025941 Bacteria 4669
340 Ga0207711_10975025 3300025941 Bacteria 787
341 Ga0207711_10999056 3300025941 Bacteria 776
342 Ga0207689_10393701 3300025942 Bacteria 1154
343 Ga0207689_10838310 3300025942 Unclassified 776
344 Ga0207689_11155384 3300025942 Bacteria 652
345 Ga0207661_10227545 3300025944 Bacteria 1650
346 Ga0207661_10630587 3300025944 Unclassified 985
347 Ga0207679_10028721 3300025945 Bacteria 3864
348 Ga0207679_10063942 3300025945 Bacteria 2749
349 Ga0207667_10139466 3300025949 Bacteria 2496
350 Ga0207667_10154158 3300025949 Bacteria 2364
351 Ga0207667_10702733 3300025949 Bacteria 1013
352 Ga0207667_11395522 3300025949 Unclassified 674
353 Ga0207651_10041167 3300025960 Bacteria 3064
354 Ga0207651_10158458 3300025960 Bacteria 1771
355 Ga0207651_11251377 3300025960 Unclassified 667
356 Ga0207640_10109768 3300025981 Bacteria 1952
357 Ga0207658_10013042 3300025986 Bacteria 5675
358 Ga0207658_10610585 3300025986 Bacteria 980
359 Ga0207677_10043331 3300026023 Bacteria 2991
360 Ga0207677_11173930 3300026023 Unclassified 702
361 Ga0207703_10022533 3300026035 Bacteria 4941
362 Ga0207703_10030253 3300026035 Bacteria 4278
363 Ga0207703_11323222 3300026035 Unclassified 693
364 Ga0207639_10301524 3300026041 Bacteria 1416
365 Ga0207702_10284783 3300026078 Bacteria 1563
366 Ga0207702_10644284 3300026078 Bacteria 1042
367 Ga0207702_11128240 3300026078 Unclassified 778
368 Ga0207702_11998309 3300026078 Bacteria 570
369 Ga0207641_10002504 3300026088 Bacteria 16952
370 Ga0207641_10111259 3300026088 Bacteria 2428
371 Ga0207641_10863300 3300026088 Bacteria 897
372 Ga0207648_10020840 3300026089 Bacteria 5902
373 Ga0207648_10041015 3300026089 Bacteria 4066
374 Ga0207676_10464722 3300026095 Unclassified 1195
375 Ga0207676_10566775 3300026095 Bacteria 1087
376 Ga0207674_10004223 3300026116 Bacteria 17334
377 Ga0207674_10021678 3300026116 Bacteria 6917
378 Ga0207674_10047798 3300026116 Bacteria 4384
379 Ga0207675_100760433 3300026118 Bacteria 981
380 Ga0207683_10106975 3300026121 Bacteria 2502
381 Ga0265355_1000074 3300028036 Bacteria 3470
382 Ga0268266_10392250 3300028379 Bacteria 1311
383 Ga0268266_10577230 3300028379 Bacteria 1079
384 Ga0268266_10984316 3300028379 Bacteria 816
385 Ga0268265_10142424 3300028380 Bacteria 2009
386 Ga0268264_10011728 3300028381 Bacteria 7227
387 Ga0268264_10014196 3300028381 Bacteria 6549
388 Ga0268264_10056627 3300028381 Bacteria 3277
389 Ga0268264_11458400 3300028381 Bacteria 695
390 Ga0265338_10179337 3300028800 Bacteria 1617
391 Ga0265338_10421393 3300028800 Unclassified 949
392 Ga0265762_1015183 3300030760 Bacteria 1394
393 Ga0265765_1002921 3300030879 Bacteria 1689
394 Ga0265773_1028407 3300031018 Unclassified 588
395 Ga0265760_10000219 3300031090 Bacteria 15517
396 Ga0265760_10001338 3300031090 Bacteria 7234
397 Ga0265760_10116041 3300031090 Bacteria 856
398 Ga0265332_10150650 3300031238 Bacteria 973
399 Ga0265325_10003323 3300031241 Bacteria 10576
400 Ga0265325_10015139 3300031241 Bacteria 4344
401 Ga0265340_10196252 3300031247 Bacteria 909
402 Ga0265331_10032464 3300031250 Bacteria 2587
403 Ga0265313_10041389 3300031595 Bacteria 2270
404 Ga0265313_10084280 3300031595 Bacteria 1438
405 Ga0265313_10136684 3300031595 Bacteria 1057
406 Ga0265313_10259707 3300031595 Unclassified 706
407 Ga0265314_10222858 3300031711 Bacteria 1099
408 Ga0265342_10080541 3300031712 Bacteria 1881
409 Ga0316212_1008493 3300033547 Bacteria 1478
410 Ga0373934_0204395 3300035086 Bacteria 813
411 Ga0373944_0010720 3300035089 Bacteria 2503
412 Ga0373923_0009592 3300035111 Bacteria 3499
413 Ga0373936_0000354 3300035113 Bacteria 15557
414 Ga0373936_0454087 3300035113 Bacteria 593
415 Ga0373945_0007602 3300035116 Bacteria 3514
416 Ga0373945_0020350 3300035116 Bacteria 2270
417 Ga0373953_0102890 3300035117 Bacteria 1203
418 Ga0373954_0014578 3300035118 Bacteria 3505
419 Ga0373954_0202973 3300035118 Bacteria 974
420 Ga0373956_0079363 3300035119 Bacteria 1504
421 Ga0373956_0252202 3300035119 Bacteria 839
422 Ga0373957_0401995 3300035120 Bacteria 589
423 Ga0373943_0000054 3300035170 Bacteria 38966
424 Ga0373943_0715197 3300035170 Unclassified 594
425 Ga0373946_0008903 3300035171 Bacteria 3689
426 Ga0373946_0081030 3300035171 Bacteria 1421
427 Ga0373955_0013964 3300035172 Bacteria 3898
428 Ga0373924_0075011 3300035410 Bacteria 1431
429 Ga0373924_0240400 3300035410 Bacteria 801
430 Ga0373931_0229841 3300035691 Bacteria 1120
431 Ga0373935_0000891 3300035692 Bacteria 16134
432 Ga0373935_0020066 3300035692 Bacteria 4080
433 Ga0373935_0917204 3300035692 Bacteria 649
434 Ga0373927_0000093 3300035695 Bacteria 67477
435 Ga0373927_0001941 3300035695 Bacteria 15269
436 Ga0373933_0013231 3300035724 Bacteria 4571
437 Ga0373933_0023332 3300035724 Bacteria 3533
438 Ga0373947_0002260 3300035725 Bacteria 11635
439 Ga0373947_0003381 3300035725 Bacteria 9441
440 Ga0373937_0052338 3300036401 Bacteria 3743
441 Ga0373937_0377704 3300036401 Bacteria 1344
442 Ga0373937_1253352 3300036401 Bacteria 690
443 Ga0373925_0000132 3300037068 Bacteria 79406
444 Ga0373925_0000603 3300037068 Bacteria 34219
445 Ga0373925_0069242 3300037068 Bacteria 2665
446 Ga0436364_0685646 3300037853 Bacteria 3340
447 Ga0436365_1313529 3300039437 Bacteria 515
448 Ga0436365_1462500 3300039437 Bacteria 1511
449 Ga0436360_0787437 3300039438 Bacteria 1828
450 Ga0436360_1280688 3300039438 Bacteria 1744
451 Ga0436361_0053535 3300039447 Bacteria 4099
452 Ga0436361_0147031 3300039447 Bacteria 2399
453 Ga0436361_0880745 3300039447 Bacteria 7067
454 Ga0436361_0946399 3300039447 Bacteria 970
455 Ga0436361_1188074 3300039447 Bacteria 2257
456 Ga0436362_0613138 3300039453 Unclassified 1757
457 Ga0450888_040808 3300042126 Bacteria 645
458 Ga0453683_0255286 3300044673 Bacteria 1118
459 Ga0495651_0956850 3300046462 Bacteria 521
460 Ga0495580_0008809 3300046472 Bacteria 7987
461 Ga0495580_0072840 3300046472 Bacteria 2399
462 Ga0495580_0321722 3300046472 Bacteria 1051
463 Ga0495664_0007802 3300046477 Bacteria 5956
464 Ga0495628_0459327 3300046516 Bacteria 924
465 Ga0495628_0896145 3300046516 Unclassified 616
466 Ga0495630_0211703 3300046517 Bacteria 1479
467 Ga0495630_0547035 3300046517 Bacteria 888
468 Ga0495630_1344675 3300046517 Bacteria 538
469 Ga0495665_0309558 3300046531 Bacteria 808
470 Ga0495645_0157751 3300046543 Bacteria 1571
471 Ga0495624_0608541 3300046690 Bacteria 651
472 Ga0495674_0029021 3300047319 Bacteria 5039
473 Ga0495674_0102743 3300047319 Bacteria 2431
474 Ga0495674_0156721 3300047319 Bacteria 1907
475 Ga0496100_0985252 3300048903 Unclassified 663
476 Ga0496101_0972634 3300048904 Bacteria 668
477 Ga0496103_0259591 3300048906 Bacteria 1118
478 Ga0496112_0105504 3300048915 Bacteria 2787
479 Ga0496112_0187907 3300048915 Bacteria 2029
480 Ga0501033_0148117 3300049570 Bacteria 1694
481 Ga0501036_0074492 3300049572 Bacteria 2871
482 Ga0501037_0083643 3300049573 Bacteria 2312
483 Ga0501038_0004533 3300049574 Bacteria 12932
484 Ga0501039_0002828 3300049575 Bacteria 12975
485 Ga0501040_0000127 3300049576 Bacteria 40573
486 Ga0501041_0001355 3300049577 Bacteria 13495
487 Ga0501042_0004186 3300049578 Bacteria 9174
488 Ga0501043_0116289 3300049579 Bacteria 2099
489 Ga0501046_0015372 3300049580 Bacteria 6436
490 Ga0501048_0287804 3300049582 Bacteria 1168
491 Ga0501068_0044333 3300049584 Bacteria 2678
492 Ga0501070_0635020 3300049586 Bacteria 849
493 Ga0501071_0005685 3300049587 Bacteria 8044
494 Ga0501072_0007276 3300049588 Bacteria 8395
495 Ga0501074_0844403 3300049590 Bacteria 645
496 Ga0501075_0001116 3300049591 Bacteria 17270
497 Ga0501076_0005124 3300049592 Bacteria 9379
498 Ga0501077_0025386 3300049593 Bacteria 3763
499 Ga0501079_0001243 3300049741 Bacteria 17860
500 Ga0501080_0123649 3300049742 Bacteria 2397
501 Ga0501081_0000804 3300049743 Bacteria 18533
502 Ga0501044_1087226 3300049823 Bacteria 669
503 Ga0501045_0003405 3300049824 Bacteria 10888
504 nmdc:mga05p37_151474_c1 3300050507 Bacteria 2836
505 nmdc:mga09592_119605_c1 3300050508 Bacteria 2262
506 nmdc:mga06r32_264331_c1 3300050510 Bacteria 1708
507 nmdc:mga06r32_422754_c1 3300050510 Bacteria 1314
508 nmdc:mga06r32_681731_c1 3300050510 Bacteria 994
509 nmdc:mga08y16_1376965_c1 3300050511 Bacteria 669
510 nmdc:mga08y16_1974203_c1 3300050511 Bacteria 533
511 nmdc:mga0n895_8863_c2 3300050512 Bacteria 6658
512 nmdc:mga0rr50_1188094_c1 3300050513 Bacteria 648
513 nmdc:mga08x19_552934_c1 3300050514 Bacteria 814
514 nmdc:mga0a205_159249_c1 3300050515 Bacteria 2155
515 Ga0495612_0330554 3300053078 Unclassified 686
516 Ga0495619_0563559 3300053085 Unclassified 781
517 Ga0500568_0001495 3300053139 Bacteria 14945
518 Ga0501084_0003049 3300054114 Bacteria 13579
519 Ga0501082_0012209 3300060353 Bacteria 7381
520 Ga0530510_0004732 3300061734 Bacteria 9418
521 Ga0065715_11150758
522 Ga0065712_10412436
523 Ga0070676_10052631
524 Ga0070683_100119673
525 Ga0070690_100038563
526 Ga0070690_100085183
527 Ga0070690_100144490
528 Ga0070690_100241012
529 Ga0070670_100271679
530 Ga0068869_100107038
531 Ga0068869_101101298
532 Ga0070666_10062053
533 Ga0070680_100876941
534 Ga0070682_100117686
535 Ga0070682_100938190
536 Ga0068868_100061017
537 Ga0068868_100632085
538 Ga0068868_101748631
539 Ga0068868_102027762
540 Ga0070660_100212168
541 Ga0070660_100298212
542 Ga0070689_100188606
543 Ga0070687_100445247
544 Ga0070687_100615263
545 Ga0070661_100585227
546 Ga0070692_10227508
547 Ga0070669_100231560
548 Ga0070675_100015190
549 Ga0070675_101017704
550 Ga0070671_100305284
551 Ga0070671_100383899
552 Ga0070673_100082127
553 Ga0070673_100197328
554 Ga0070673_100343017
555 Ga0070673_100660350
556 Ga0070673_100823154
557 Ga0070673_101300648
558 Ga0070688_100334070
559 Ga0070688_101214132
560 Ga0070659_101065196
561 Ga0070667_100014038
562 Ga0070703_10003299
563 Ga0070711_100003308
564 Ga0070711_100048507
565 Ga0070694_100002159
566 Ga0070708_100153967
567 Ga0070678_100077469
568 Ga0070678_100171798
569 Ga0070681_10027003
570 Ga0070681_10073784
571 Ga0070681_10690179
572 Ga0068867_100122015
573 Ga0070685_10061267
574 Ga0070685_10549546
575 Ga0070707_100283461
576 Ga0070707_100465388
577 Ga0070699_100026542
578 Ga0070699_101006868
579 Ga0070679_100048974
580 Ga0070679_100115388
581 Ga0070679_100668327
582 Ga0070684_100020373
583 Ga0070684_100912793
584 Ga0070697_100060353
585 Ga0070697_100987809
586 Ga0070697_101476398
587 Ga0068853_100147119
588 Ga0070672_100102677
589 Ga0070672_100637331
590 Ga0070672_101816655
591 Ga0070686_101184698
592 Ga0070695_100007434
593 Ga0070695_100471036
594 Ga0070693_100030957
595 Ga0070693_100065320
596 Ga0070665_100065374
597 Ga0070665_100270134
598 Ga0070665_100487966
599 Ga0070665_100625071
600 Ga0070704_100005767
601 Ga0068855_100036104
602 Ga0068855_100374480
603 Ga0068855_100886250
604 Ga0068855_100895160
605 Ga0070664_100024654
606 Ga0070664_100149041
607 Ga0070664_100642364
608 Ga0068857_100015456
609 Ga0068857_100018242
610 Ga0068857_100019614
611 Ga0068857_100472596
612 Ga0068854_100064004
613 Ga0068854_101078967
614 Ga0068856_100047459
615 Ga0068856_100075771
616 Ga0068856_100224207
617 Ga0068856_100349061
618 Ga0068856_101008233
619 Ga0068852_100446427
620 Ga0068852_100539189
621 Ga0068859_100010419
622 Ga0068859_100803696
623 Ga0068859_101311466
624 Ga0068859_101636452
625 Ga0068864_100157090
626 Ga0068864_100445018
627 Ga0068864_100792066
628 Ga0068864_101655907
629 Ga0068866_10188947
630 Ga0068861_100975346
631 Ga0068863_100021355
632 Ga0068863_100141925
633 Ga0068863_100835971
634 Ga0068858_100015894
635 Ga0068858_102274480
636 Ga0068858_102530657
637 Ga0068860_100057334
638 Ga0068860_100138792
639 Ga0068860_100458870
640 Ga0068862_100288530
641 Ga0070717_10012454
642 Ga0070717_10041825
643 Ga0070716_100000585
644 Ga0070716_100159780
645 Ga0070716_100756665
646 Ga0070712_100019794
647 Ga0070712_101713674
648 Ga0097621_100036508
649 Ga0097621_100066193
650 Ga0097621_100110113
651 Ga0097621_100246109
652 Ga0097621_100324215
653 Ga0097621_101754317
654 Ga0068871_100004319
655 Ga0068871_100022065
656 Ga0068871_100111139
657 Ga0075428_100213171
658 Ga0075428_100612511
659 Ga0075428_100692496
660 Ga0075430_100069973
661 Ga0075430_100334128
662 Ga0075430_100482406
663 Ga0075431_100476900
664 Ga0075431_100479018
665 Ga0075431_101502385
666 Ga0075431_101900904
667 Ga0075434_100015167
668 Ga0075434_100772137
669 Ga0075429_100043352
670 Ga0068865_100006268
671 Ga0075436_100305796
672 Ga0097620_100010419
673 Ga0097620_100803568
674 Ga0097620_101311538
675 Ga0097620_101635730
676 Ga0075435_100417309
677 Ga0075435_100705353
678 Ga0105240_10001309
679 Ga0105240_10118669
680 Ga0105240_10179226
681 Ga0105240_10322351
682 Ga0105240_10659866
683 Ga0105240_11075626
684 Ga0105240_11624050
685 Ga0111539_10849815
686 Ga0111539_12015722
687 Ga0105245_10004551
688 Ga0105245_10070687
689 Ga0105245_10072695
690 Ga0105245_10165664
691 Ga0105245_10667982
692 Ga0105247_10140193
693 Ga0105247_10144653
694 Ga0105247_10394498
695 Ga0114129_10418576
696 Ga0114129_12985423
697 Ga0105243_10102000
698 Ga0105243_10491262
699 Ga0105243_10566523
700 Ga0105243_10803409
701 Ga0105243_12045142
702 Ga0105241_10010673
703 Ga0105241_10088583
704 Ga0105241_10151940
705 Ga0105241_10183675
706 Ga0105241_10555411
707 Ga0105241_10845907
708 Ga0105242_10012668
709 Ga0105242_10017298
710 Ga0105242_10019175
711 Ga0105242_10236654
712 Ga0105242_10300293
713 Ga0105242_10319806
714 Ga0105242_10351506
715 Ga0105242_11728607
716 Ga0105242_12289494
717 Ga0105248_10003621
718 Ga0105248_10008653
719 Ga0105248_10009284
720 Ga0105248_10537842
721 Ga0105248_10638753
722 Ga0105248_11416377
723 Ga0105237_10002493
724 Ga0105237_10012575
725 Ga0105237_10621669
726 Ga0105238_10004437
727 Ga0105238_10029444
728 Ga0105238_10163762
729 Ga0105238_10310693
730 Ga0105238_12648696
731 Ga0105249_10409333
732 Ga0105249_11510899
733 Ga0105249_12998225
734 Ga0105239_10056524
735 Ga0105239_10091397
736 Ga0105239_10162354
737 Ga0105239_12428319
738 Ga0105246_10070087
739 Ga0105246_10160750
740 Ga0105246_11148740
741 Ga0105246_12536742
742 Ga0157370_10132149
743 Ga0157369_10042232
744 Ga0157369_10220982
745 Ga0157369_11684717
746 Ga0157374_10011369
747 Ga0157374_10242630
748 Ga0157374_10246099
749 Ga0157374_10617814
750 Ga0157374_11141531
751 Ga0157374_11609535
752 Ga0157378_10008966
753 Ga0157378_10019906
754 Ga0157378_10311195
755 Ga0157378_11579407
756 Ga0163162_10042673
757 Ga0163162_10070953
758 Ga0163162_10107894
759 Ga0163162_10469317
760 Ga0163162_12510951
761 Ga0157372_10003294
762 Ga0157372_10799381
763 Ga0157372_11046052
764 Ga0157375_10008177
765 Ga0157375_10277305
766 Ga0157375_10453347
767 Ga0163163_10060723
768 Ga0163163_10166548
769 Ga0163163_10328352
770 Ga0163163_10536187
771 Ga0163163_10573631
772 Ga0163163_10713613
773 Ga0163163_10945810
774 Ga0163163_11957123
775 Ga0157380_12730107
776 Ga0157377_10598625
777 Ga0157379_10000180
778 Ga0157379_10016182
779 Ga0157376_10011170
780 Ga0157376_10028287
781 Ga0157376_10081988
782 Ga0163161_10004663
783 Ga0213873_10017761
784 Ga0213872_10101830
785 Ga0224572_1024311
786 Ga0224572_1026457
787 Ga0207697_10402689
788 Ga0207642_10651652
789 Ga0207710_10149893
790 Ga0207710_10348890
791 Ga0207680_10044610
792 Ga0207680_10688313
793 Ga0207680_10819195
794 Ga0207684_10066532
795 Ga0207684_10857282
796 Ga0207654_10004960
797 Ga0207654_10577331
798 Ga0207654_10604041
799 Ga0207707_10029072
800 Ga0207707_10099864
801 Ga0207707_10564131
802 Ga0207707_11582158
803 Ga0207695_10027344
804 Ga0207695_10703499
805 Ga0207695_11547946
806 Ga0207695_11730723
807 Ga0207671_10022317
808 Ga0207671_10030619
809 Ga0207671_10281801
810 Ga0207693_10010223
811 Ga0207663_10001205
812 Ga0207663_10005501
813 Ga0207660_10426816
814 Ga0207660_10606395
815 Ga0207660_10902172
816 Ga0207662_10908482
817 Ga0207662_11151887
818 Ga0207657_10462739
819 Ga0207657_11122399
820 Ga0207649_10240627
821 Ga0207649_10473265
822 Ga0207649_10670711
823 Ga0207646_10025674
824 Ga0207646_10195573
825 Ga0207694_10002315
826 Ga0207694_10134719
827 Ga0207694_10514092
828 Ga0207694_11087095
829 Ga0207694_11604379
830 Ga0207659_10000818
831 Ga0207659_10002355
832 Ga0207659_11390893
833 Ga0207687_10006391
834 Ga0207687_10043169
835 Ga0207687_10135311
836 Ga0207687_11558713
837 Ga0207664_10000528
838 Ga0207690_10054071
839 Ga0207690_10515822
840 Ga0207706_10028531
841 Ga0207686_10045649
842 Ga0207686_10149711
843 Ga0207686_10197802
844 Ga0207686_10263683
845 Ga0207686_10411044
846 Ga0207686_11065939
847 Ga0207709_10353580
848 Ga0207709_10902044
849 Ga0207709_11150703
850 Ga0207670_10303666
851 Ga0207670_10531032
852 Ga0207670_11770759
853 Ga0207704_10404209
854 Ga0207665_10000156
855 Ga0207665_10535863
856 Ga0207691_10020017
857 Ga0207711_10011224
858 Ga0207711_10012495
859 Ga0207711_10028923
860 Ga0207711_10975025
861 Ga0207711_10999056
862 Ga0207689_10393701
863 Ga0207689_10838310
864 Ga0207689_11155384
865 Ga0207661_10227545
866 Ga0207661_10630587
867 Ga0207679_10028721
868 Ga0207679_10063942
869 Ga0207667_10139466
870 Ga0207667_10154158
871 Ga0207667_10702733
872 Ga0207667_11395522
873 Ga0207651_10041167
874 Ga0207651_10158458
875 Ga0207651_11251377
876 Ga0207640_10109768
877 Ga0207658_10013042
878 Ga0207658_10610585
879 Ga0207677_10043331
880 Ga0207677_11173930
881 Ga0207703_10022533
882 Ga0207703_10030253
883 Ga0207703_11323222
884 Ga0207639_10301524
885 Ga0207702_10284783
886 Ga0207702_10644284
887 Ga0207702_11128240
888 Ga0207702_11998309
889 Ga0207641_10002504
890 Ga0207641_10111259
891 Ga0207641_10863300
892 Ga0207648_10020840
893 Ga0207648_10041015
894 Ga0207676_10464722
895 Ga0207676_10566775
896 Ga0207674_10004223
897 Ga0207674_10021678
898 Ga0207674_10047798
899 Ga0207675_100760433
900 Ga0207683_10106975
901 Ga0265355_1000074
902 Ga0268266_10392250
903 Ga0268266_10577230
904 Ga0268266_10984316
905 Ga0268265_10142424
906 Ga0268264_10011728
907 Ga0268264_10014196
908 Ga0268264_10056627
909 Ga0268264_11458400
910 Ga0265338_10179337
911 Ga0265338_10421393
912 Ga0265762_1015183
913 Ga0265765_1002921
914 Ga0265773_1028407
915 Ga0265760_10000219
916 Ga0265760_10001338
917 Ga0265760_10116041
918 Ga0265332_10150650
919 Ga0265325_10003323
920 Ga0265325_10015139
921 Ga0265340_10196252
922 Ga0265331_10032464
923 Ga0265313_10041389
924 Ga0265313_10084280
925 Ga0265313_10136684
926 Ga0265313_10259707
927 Ga0265314_10222858
928 Ga0265342_10080541
929 Ga0316212_1008493
930 Ga0373934_0204395
931 Ga0373944_0010720
932 Ga0373923_0009592
933 Ga0373936_0000354
934 Ga0373936_0454087
935 Ga0373945_0007602
936 Ga0373945_0020350
937 Ga0373953_0102890
938 Ga0373954_0014578
939 Ga0373954_0202973
940 Ga0373956_0079363
941 Ga0373956_0252202
942 Ga0373957_0401995
943 Ga0373943_0000054
944 Ga0373943_0715197
945 Ga0373946_0008903
946 Ga0373946_0081030
947 Ga0373955_0013964
948 Ga0373924_0075011
949 Ga0373924_0240400
950 Ga0373931_0229841
951 Ga0373935_0000891
952 Ga0373935_0020066
953 Ga0373935_0917204
954 Ga0373927_0000093
955 Ga0373927_0001941
956 Ga0373933_0013231
957 Ga0373933_0023332
958 Ga0373947_0002260
959 Ga0373947_0003381
960 Ga0373937_0052338
961 Ga0373937_0377704
962 Ga0373937_1253352
963 Ga0373925_0000132
964 Ga0373925_0000603
965 Ga0373925_0069242
966 Ga0436364_0685646
967 Ga0436365_1313529
968 Ga0436365_1462500
969 Ga0436360_0787437
970 Ga0436360_1280688
971 Ga0436361_0053535
972 Ga0436361_0147031
973 Ga0436361_0880745
974 Ga0436361_0946399
975 Ga0436361_1188074
976 Ga0436362_0613138
977 Ga0450888_040808
978 Ga0453683_0255286
979 Ga0495651_0956850
980 Ga0495580_0008809
981 Ga0495580_0072840
982 Ga0495580_0321722
983 Ga0495664_0007802
984 Ga0495628_0459327
985 Ga0495628_0896145
986 Ga0495630_0211703
987 Ga0495630_0547035
988 Ga0495630_1344675
989 Ga0495665_0309558
990 Ga0495645_0157751
991 Ga0495624_0608541
992 Ga0495674_0029021
993 Ga0495674_0102743
994 Ga0495674_0156721
995 Ga0496100_0985252
996 Ga0496101_0972634
997 Ga0496103_0259591
998 Ga0496112_0105504
999 Ga0496112_0187907
1000 Ga0501033_0148117
1001 Ga0501036_0074492
1002 Ga0501037_0083643
1003 Ga0501038_0004533
1004 Ga0501039_0002828
1005 Ga0501040_0000127
1006 Ga0501041_0001355
1007 Ga0501042_0004186
1008 Ga0501043_0116289
1009 Ga0501046_0015372
1010 Ga0501048_0287804
1011 Ga0501068_0044333
1012 Ga0501070_0635020
1013 Ga0501071_0005685
1014 Ga0501072_0007276
1015 Ga0501074_0844403
1016 Ga0501075_0001116
1017 Ga0501076_0005124
1018 Ga0501077_0025386
1019 Ga0501079_0001243
1020 Ga0501080_0123649
1021 Ga0501081_0000804
1022 Ga0501044_1087226
1023 Ga0501045_0003405
1024 nmdc:mga05p37_151474_c1
1025 nmdc:mga09592_119605_c1
1026 nmdc:mga06r32_264331_c1
1027 nmdc:mga06r32_422754_c1
1028 nmdc:mga06r32_681731_c1
1029 nmdc:mga08y16_1376965_c1
1030 nmdc:mga08y16_1974203_c1
1031 nmdc:mga0n895_8863_c2
1032 nmdc:mga0rr50_1188094_c1
1033 nmdc:mga08x19_552934_c1
1034 nmdc:mga0a205_159249_c1
1035 Ga0495612_0330554
1036 Ga0495619_0563559
1037 Ga0500568_0001495
1038 Ga0501084_0003049
1039 Ga0501082_0012209
1040 Ga0530510_0004732

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12840

HTH_20

Helix-turn-helix domain

41

93

0.97

PF01022

HTH_5

Bacterial regulatory protein, arsR family

43

92

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cll-assembly1.cif.gz_F structural insights into human tfiiic promoter recognition 0.9227 29 84
5zuo-assembly1.cif.gz_A crystal structure of bz junction in diverse sequence 0.8852 43 85
6gho-assembly1.cif.gz_B crystal structure of spx in complex with yjbh 0.8666 42 85
4ija-assembly1.cif.gz_A structure of s. aureus methicillin resistance factor mecr2 0.8571 28 85
5zup-assembly1.cif.gz_B crystal structure of bz junction in diverse sequence 0.8542 29 84
ID Description Score Start End Superfamily
af_Q9VD25_77_142_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.937 30 84 1.10.10.10
af_Q4CRP5_780_927_3.30.230.130 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Cullin; Chain C, Domain 2 0.9301 26 86 3.30.230.130
af_Q4DKK4_76_138_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9082 30 84 1.10.10.10
af_Q4DZU8_467_618_3.30.230.130 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Cullin; Chain C, Domain 2 0.9034 36 86 3.30.230.130
af_P91529_82_146_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8962 24 84 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2E2J6Z4-F1-model_v4 deleted 0.8613 24 102
AF-A0A251XQ13-F1-model_v4 HTH-type transcriptional regulator KmtR 0.8303 23 111 GO:0003700
AF-A0A1Q7NL66-F1-model_v4 Transcriptional regulator 0.82 24 108
AF-A0A256YGG8-F1-model_v4 HTH marR-type domain-containing protein 0.8173 20 99 GO:0003700
GO:0016020
AF-A0A2M7R6Y1-F1-model_v4 HTH arsR-type domain-containing protein 0.8117 17 108

Map