F458403

General Info

Members Datasets Scaffolds Average Seq Length
519 178 1038 235

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10884638|Ga0157378_108846382
Length 257
Sequence VSDNNATVARHGGFGAAIVGGAVGSALTAALLFFAAPGVLSSKIVRQGLLADPKILTETVDALRDAQYEPVLAGNRAAIETPFASSWKGAAKPEVTLVEFFDYACPYCKASNPAVERLLQENKDLRVVYRELPILGPDSVTAARLSLEASKLGRCARFHDALWAAGRPAPETIAAAAQNAGIAPTAVQDPQIEAELSRNMKLASELGATGTPVFVVGDRVMNGAVGYDALKDAIAKARSKRCTQRSPSAGQEPDYIK

Samples

Sample ID Description Type Environment
1 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
139 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
140 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
141 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
142 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
143 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
144 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
145 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
146 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
147 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
148 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
149 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
150 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
151 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
156 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
157 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
158 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
159 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
175 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
176 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
177 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
178 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0.39
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.43
Rhizosphere 94.8
Stem 0
Stem Tuber 0
Unclassified 4.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157378_10884638 3300013297 Bacteria 923
2 JGI24740J21852_10015036 3300001979 Bacteria 2836
3 JGI24740J21852_10026984 3300001979 Bacteria 1916
4 JGI24739J22299_10055710 3300001989 Bacteria 1263
5 JGI24737J22298_10017146 3300001990 Bacteria 2335
6 JGI24735J21928_10010152 3300002067 Bacteria 3008
7 JGI24738J21930_10027208 3300002075 Bacteria 1172
8 Ga0070658_10004583 3300005327 Bacteria 11230
9 Ga0070658_10031057 3300005327 Bacteria 4289
10 Ga0070658_10031083 3300005327 Bacteria 4287
11 Ga0070658_10056097 3300005327 Bacteria 3201
12 Ga0070658_10073737 3300005327 Bacteria 2799
13 Ga0070658_10203433 3300005327 Bacteria 1671
14 Ga0070658_10425602 3300005327 Unclassified 1142
15 Ga0070658_10704445 3300005327 Bacteria 876
16 Ga0070676_10067350 3300005328 Bacteria 2141
17 Ga0070676_10069047 3300005328 Bacteria 2117
18 Ga0070683_100002102 3300005329 Bacteria 15735
19 Ga0070683_100088328 3300005329 Bacteria 2908
20 Ga0070683_100248227 3300005329 Bacteria 1693
21 Ga0070690_100009978 3300005330 Bacteria 5511
22 Ga0070670_100017755 3300005331 Bacteria 6105
23 Ga0070670_100019579 3300005331 Bacteria 5809
24 Ga0070666_10016486 3300005335 Bacteria 4726
25 Ga0070680_100019688 3300005336 Bacteria 5353
26 Ga0070680_100077827 3300005336 Bacteria 2731
27 Ga0070680_100077916 3300005336 Bacteria 2730
28 Ga0070680_100122829 3300005336 Bacteria 2168
29 Ga0070680_100140011 3300005336 Bacteria 2028
30 Ga0070680_100140042 3300005336 Bacteria 2028
31 Ga0070682_100137875 3300005337 Bacteria 1659
32 Ga0068868_100070976 3300005338 Bacteria 2777
33 Ga0068868_100247190 3300005338 Bacteria 1500
34 Ga0068868_100311126 3300005338 Bacteria 1340
35 Ga0070660_100010926 3300005339 Bacteria 6428
36 Ga0070660_100019956 3300005339 Bacteria 4917
37 Ga0070660_100031252 3300005339 Bacteria 3998
38 Ga0070660_100206515 3300005339 Bacteria 1594
39 Ga0070660_100227985 3300005339 Bacteria 1515
40 Ga0070660_100445066 3300005339 Bacteria 1074
41 Ga0070661_100035235 3300005344 Bacteria 3633
42 Ga0070661_100042733 3300005344 Bacteria 3308
43 Ga0070661_100047282 3300005344 Bacteria 3148
44 Ga0070661_100061542 3300005344 Bacteria 2756
45 Ga0070661_100107012 3300005344 Bacteria 2085
46 Ga0070661_100115150 3300005344 Bacteria 2010
47 Ga0070661_100403245 3300005344 Bacteria 1081
48 Ga0070692_10052154 3300005345 Bacteria 2130
49 Ga0070668_100110441 3300005347 Bacteria 2188
50 Ga0070669_100510598 3300005353 Bacteria 998
51 Ga0070675_100039406 3300005354 Bacteria 3856
52 Ga0070675_100047662 3300005354 Bacteria 3511
53 Ga0070675_100156793 3300005354 Bacteria 1955
54 Ga0070671_100003615 3300005355 Bacteria 12099
55 Ga0070671_100012453 3300005355 Bacteria 6849
56 Ga0070671_100086808 3300005355 Bacteria 2618
57 Ga0070671_100103003 3300005355 Bacteria 2395
58 Ga0070671_100198866 3300005355 Bacteria 1699
59 Ga0070674_100043862 3300005356 Bacteria 3045
60 Ga0070674_100177408 3300005356 Bacteria 1629
61 Ga0070673_100008479 3300005364 Bacteria 6834
62 Ga0070673_100012701 3300005364 Bacteria 5792
63 Ga0070673_100017963 3300005364 Bacteria 5043
64 Ga0070673_100177900 3300005364 Bacteria 1819
65 Ga0070673_100207274 3300005364 Bacteria 1691
66 Ga0070659_100009531 3300005366 Bacteria 7135
67 Ga0070659_100033669 3300005366 Bacteria 3981
68 Ga0070659_100204358 3300005366 Bacteria 1627
69 Ga0070659_100366154 3300005366 Bacteria 1212
70 Ga0070667_100015865 3300005367 Bacteria 6233
71 Ga0070667_100017584 3300005367 Bacteria 5925
72 Ga0070667_100152644 3300005367 Bacteria 2030
73 Ga0070667_100390247 3300005367 Bacteria 1266
74 Ga0070714_100057605 3300005435 Bacteria 3327
75 Ga0070714_100187951 3300005435 Bacteria 1883
76 Ga0070714_100759787 3300005435 Bacteria 937
77 Ga0070713_100003702 3300005436 Bacteria 10120
78 Ga0070663_100038403 3300005455 Bacteria 3340
79 Ga0070663_100058400 3300005455 Bacteria 2770
80 Ga0070663_100145841 3300005455 Bacteria 1811
81 Ga0070663_100495630 3300005455 Unclassified 1013
82 Ga0070678_100000491 3300005456 Bacteria 18926
83 Ga0070678_100014956 3300005456 Bacteria 4915
84 Ga0070678_100306122 3300005456 Bacteria 1352
85 Ga0070662_100007713 3300005457 Bacteria 6985
86 Ga0070662_100031099 3300005457 Bacteria 3743
87 Ga0070662_100089074 3300005457 Bacteria 2314
88 Ga0070662_100099044 3300005457 Bacteria 2203
89 Ga0070662_100157339 3300005457 Unclassified 1775
90 Ga0070681_10095507 3300005458 Bacteria 2921
91 Ga0070681_10122190 3300005458 Bacteria 2537
92 Ga0070681_10186998 3300005458 Bacteria 1991
93 Ga0068867_100121665 3300005459 Bacteria 2018
94 Ga0068867_100124839 3300005459 Bacteria 1993
95 Ga0070685_10134090 3300005466 Bacteria 1551
96 Ga0070679_100067937 3300005530 Bacteria 3555
97 Ga0070679_100103962 3300005530 Bacteria 2826
98 Ga0070679_100158798 3300005530 Bacteria 2235
99 Ga0070679_100165711 3300005530 Bacteria 2183
100 Ga0070679_100200897 3300005530 Bacteria 1959
101 Ga0070679_100664842 3300005530 Bacteria 984
102 Ga0070679_100783539 3300005530 Bacteria 896
103 Ga0070684_100001660 3300005535 Bacteria 16146
104 Ga0070684_100027222 3300005535 Bacteria 4823
105 Ga0070684_100372387 3300005535 Bacteria 1315
106 Ga0070684_100605848 3300005535 Bacteria 1018
107 Ga0068853_100061563 3300005539 Bacteria 3246
108 Ga0068853_100397441 3300005539 Unclassified 1289
109 Ga0070672_100008981 3300005543 Bacteria 6869
110 Ga0070672_100023859 3300005543 Bacteria 4513
111 Ga0070672_100031884 3300005543 Bacteria 3972
112 Ga0070672_100253788 3300005543 Unclassified 1482
113 Ga0070672_100274184 3300005543 Bacteria 1425
114 Ga0070672_100332367 3300005543 Bacteria 1293
115 Ga0070693_100011412 3300005547 Bacteria 4474
116 Ga0070665_100008437 3300005548 Bacteria 10422
117 Ga0070665_100336866 3300005548 Bacteria 1513
118 Ga0070665_100696525 3300005548 Bacteria 1029
119 Ga0068855_100066693 3300005563 Bacteria 4196
120 Ga0068855_100075486 3300005563 Bacteria 3914
121 Ga0068855_100094328 3300005563 Bacteria 3451
122 Ga0068855_100102380 3300005563 Bacteria 3296
123 Ga0068855_100382700 3300005563 Bacteria 1544
124 Ga0068855_100873550 3300005563 Bacteria 951
125 Ga0070664_100013772 3300005564 Bacteria 6592
126 Ga0070664_100022945 3300005564 Bacteria 5148
127 Ga0070664_100039223 3300005564 Bacteria 3990
128 Ga0070664_100058055 3300005564 Bacteria 3291
129 Ga0070664_100089557 3300005564 Bacteria 2662
130 Ga0070664_100163187 3300005564 Bacteria 1972
131 Ga0068857_100067617 3300005577 Bacteria 3180
132 Ga0068857_100095903 3300005577 Bacteria 2658
133 Ga0068857_100560698 3300005577 Bacteria 1077
134 Ga0068857_100562563 3300005577 Unclassified 1075
135 Ga0068854_100019573 3300005578 Bacteria 4566
136 Ga0068854_100042195 3300005578 Bacteria 3227
137 Ga0068854_100052902 3300005578 Bacteria 2914
138 Ga0068854_100057449 3300005578 Bacteria 2807
139 Ga0068854_100143366 3300005578 Bacteria 1835
140 Ga0068854_100420837 3300005578 Bacteria 1110
141 Ga0068856_100040538 3300005614 Bacteria 4575
142 Ga0068856_100518092 3300005614 Bacteria 1214
143 Ga0068856_100652564 3300005614 Bacteria 1073
144 Ga0068852_100001493 3300005616 Bacteria 15819
145 Ga0068852_100008910 3300005616 Bacteria 7423
146 Ga0068852_100036708 3300005616 Bacteria 4104
147 Ga0068852_100247780 3300005616 Bacteria 1705
148 Ga0068852_100376713 3300005616 Bacteria 1391
149 Ga0068859_100113547 3300005617 Bacteria 2773
150 Ga0068864_100016758 3300005618 Bacteria 6107
151 Ga0068864_100029516 3300005618 Bacteria 4647
152 Ga0068866_10004607 3300005718 Bacteria 5652
153 Ga0068861_100124547 3300005719 Bacteria 2084
154 Ga0068851_10036111 3300005834 Bacteria 2473
155 Ga0068851_10088365 3300005834 Bacteria 1628
156 Ga0068863_100007505 3300005841 Bacteria 10668
157 Ga0068858_100011273 3300005842 Bacteria 8447
158 Ga0068858_100137629 3300005842 Bacteria 2292
159 Ga0068860_100149043 3300005843 Bacteria 2252
160 Ga0081539_10013950 3300005985 Bacteria 5996
161 Ga0081539_10058259 3300005985 Bacteria 2133
162 Ga0070717_10009098 3300006028 Bacteria 7457
163 Ga0097621_100035910 3300006237 Bacteria 3961
164 Ga0097621_100130106 3300006237 Bacteria 2142
165 Ga0097620_100113546 3300006931 Bacteria 2773
166 Ga0105240_10018070 3300009093 Bacteria 9481
167 Ga0105240_10694967 3300009093 Bacteria 1111
168 Ga0105240_11032608 3300009093 Bacteria 878
169 Ga0105247_10417519 3300009101 Bacteria 960
170 Ga0105243_10214970 3300009148 Bacteria 1695
171 Ga0105242_10039520 3300009176 Bacteria 3798
172 Ga0105248_10007484 3300009177 Bacteria 11978
173 Ga0105248_10016010 3300009177 Bacteria 8254
174 Ga0105248_10147035 3300009177 Bacteria 2659
175 Ga0105248_10182817 3300009177 Bacteria 2362
176 Ga0105248_10197180 3300009177 Bacteria 2269
177 Ga0105238_10040880 3300009551 Bacteria 4697
178 Ga0105238_10218490 3300009551 Bacteria 1882
179 Ga0105239_10371936 3300010375 Bacteria 1615
180 Ga0157373_10025214 3300013100 Bacteria 4303
181 Ga0157373_10042764 3300013100 Bacteria 3237
182 Ga0157373_10527093 3300013100 Bacteria 855
183 Ga0157371_10010864 3300013102 Bacteria 7063
184 Ga0157371_10020325 3300013102 Bacteria 4888
185 Ga0157371_10030393 3300013102 Bacteria 3897
186 Ga0157371_10048374 3300013102 Bacteria 3022
187 Ga0157371_10049890 3300013102 Bacteria 2973
188 Ga0157371_10065562 3300013102 Bacteria 2572
189 Ga0157371_10131193 3300013102 Bacteria 1783
190 Ga0157370_10023378 3300013104 Bacteria 6136
191 Ga0157370_10042607 3300013104 Bacteria 4373
192 Ga0157370_10045675 3300013104 Bacteria 4201
193 Ga0157370_10050759 3300013104 Bacteria 3964
194 Ga0157370_10088052 3300013104 Bacteria 2916
195 Ga0157370_10160647 3300013104 Bacteria 2090
196 Ga0157369_10007870 3300013105 Bacteria 12254
197 Ga0157369_10045304 3300013105 Bacteria 4785
198 Ga0157369_10123611 3300013105 Bacteria 2745
199 Ga0157369_10196852 3300013105 Bacteria 2116
200 Ga0157369_10197829 3300013105 Bacteria 2110
201 Ga0157369_10450215 3300013105 Bacteria 1333
202 Ga0157374_10001070 3300013296 Bacteria 23723
203 Ga0157374_10013216 3300013296 Bacteria 7203
204 Ga0157374_10098390 3300013296 Bacteria 2801
205 Ga0157374_10114282 3300013296 Bacteria 2599
206 Ga0157378_10105970 3300013297 Bacteria 2571
207 Ga0157378_10518814 3300013297 Bacteria 1193
208 Ga0163162_10001359 3300013306 Bacteria 22770
209 Ga0157372_10062761 3300013307 Bacteria 4164
210 Ga0157372_10142158 3300013307 Bacteria 2766
211 Ga0157372_10251064 3300013307 Bacteria 2053
212 Ga0157372_10397389 3300013307 Bacteria 1606
213 Ga0157372_10571855 3300013307 Bacteria 1317
214 Ga0157375_10002568 3300013308 Bacteria 15773
215 Ga0157375_10753311 3300013308 Bacteria 1125
216 Ga0163163_10129947 3300014325 Bacteria 2558
217 Ga0157379_10713207 3300014968 Bacteria 942
218 Ga0206356_10706738 3300020070 Bacteria 1017
219 Ga0206353_11960203 3300020082 Bacteria 1159
220 Ga0213876_10009552 3300021384 Bacteria 5218
221 Ga0213876_10280093 3300021384 Unclassified 886
222 Ga0207656_10036209 3300025321 Bacteria 2070
223 Ga0207656_10052130 3300025321 Unclassified 1771
224 Ga0207656_10121584 3300025321 Bacteria 1216
225 Ga0207656_10126738 3300025321 Bacteria 1193
226 Ga0207680_10146357 3300025903 Bacteria 1571
227 Ga0207680_10152401 3300025903 Bacteria 1542
228 Ga0207680_10388954 3300025903 Bacteria 984
229 Ga0207647_10002423 3300025904 Bacteria 14149
230 Ga0207647_10008121 3300025904 Bacteria 7541
231 Ga0207647_10014125 3300025904 Bacteria 5515
232 Ga0207647_10022660 3300025904 Bacteria 4168
233 Ga0207647_10070541 3300025904 Bacteria 2110
234 Ga0207647_10076082 3300025904 Bacteria 2019
235 Ga0207645_10005274 3300025907 Bacteria 9413
236 Ga0207645_10052658 3300025907 Bacteria 2601
237 Ga0207705_10001299 3300025909 Bacteria 20060
238 Ga0207705_10006040 3300025909 Bacteria 9006
239 Ga0207705_10018920 3300025909 Bacteria 4924
240 Ga0207705_10028812 3300025909 Bacteria 3957
241 Ga0207705_10040146 3300025909 Bacteria 3355
242 Ga0207705_10059238 3300025909 Bacteria 2763
243 Ga0207705_10277582 3300025909 Bacteria 1282
244 Ga0207654_10304572 3300025911 Bacteria 1085
245 Ga0207654_10421497 3300025911 Bacteria 931
246 Ga0207707_10131210 3300025912 Bacteria 2191
247 Ga0207695_10012620 3300025913 Bacteria 10125
248 Ga0207695_10045131 3300025913 Bacteria 4681
249 Ga0207671_10453801 3300025914 Bacteria 1021
250 Ga0207660_10002619 3300025917 Bacteria 11809
251 Ga0207660_10003290 3300025917 Bacteria 10571
252 Ga0207660_10010641 3300025917 Bacteria 5978
253 Ga0207660_10026979 3300025917 Bacteria 3915
254 Ga0207660_10034615 3300025917 Bacteria 3502
255 Ga0207660_10068405 3300025917 Bacteria 2575
256 Ga0207660_10108763 3300025917 Bacteria 2083
257 Ga0207660_10117334 3300025917 Bacteria 2011
258 Ga0207657_10006038 3300025919 Bacteria 12593
259 Ga0207657_10007451 3300025919 Bacteria 11223
260 Ga0207657_10015323 3300025919 Bacteria 7431
261 Ga0207657_10021782 3300025919 Bacteria 6021
262 Ga0207657_10022888 3300025919 Bacteria 5832
263 Ga0207657_10040601 3300025919 Bacteria 4121
264 Ga0207649_10024509 3300025920 Bacteria 3508
265 Ga0207649_10055904 3300025920 Bacteria 2462
266 Ga0207649_10115097 3300025920 Bacteria 1803
267 Ga0207649_10141667 3300025920 Bacteria 1646
268 Ga0207649_10221149 3300025920 Bacteria 1349
269 Ga0207649_10244655 3300025920 Bacteria 1289
270 Ga0207649_10419086 3300025920 Bacteria 1005
271 Ga0207652_10155189 3300025921 Bacteria 2051
272 Ga0207694_10072573 3300025924 Bacteria 2691
273 Ga0207694_10472053 3300025924 Bacteria 1049
274 Ga0207650_10067769 3300025925 Bacteria 2679
275 Ga0207650_10074445 3300025925 Bacteria 2560
276 Ga0207659_10119461 3300025926 Bacteria 2018
277 Ga0207659_10126643 3300025926 Bacteria 1965
278 Ga0207700_10003656 3300025928 Bacteria 8968
279 Ga0207664_10116116 3300025929 Bacteria 2233
280 Ga0207664_10176539 3300025929 Unclassified 1832
281 Ga0207644_10001401 3300025931 Bacteria 15540
282 Ga0207644_10004258 3300025931 Bacteria 9283
283 Ga0207644_10016356 3300025931 Bacteria 4991
284 Ga0207644_10161695 3300025931 Bacteria 1741
285 Ga0207644_10180158 3300025931 Bacteria 1655
286 Ga0207644_10303976 3300025931 Bacteria 1286
287 Ga0207644_10475018 3300025931 Bacteria 1029
288 Ga0207690_10009447 3300025932 Bacteria 5791
289 Ga0207690_10153575 3300025932 Bacteria 1709
290 Ga0207690_10287965 3300025932 Bacteria 1281
291 Ga0207706_10010976 3300025933 Bacteria 8258
292 Ga0207706_10013032 3300025933 Bacteria 7567
293 Ga0207706_10017267 3300025933 Bacteria 6503
294 Ga0207706_10020320 3300025933 Bacteria 5968
295 Ga0207706_10023358 3300025933 Bacteria 5553
296 Ga0207706_10045138 3300025933 Bacteria 3905
297 Ga0207706_10046041 3300025933 Bacteria 3863
298 Ga0207706_10111706 3300025933 Bacteria 2404
299 Ga0207706_10171755 3300025933 Bacteria 1905
300 Ga0207686_10051843 3300025934 Bacteria 2558
301 Ga0207669_10063888 3300025937 Bacteria 2275
302 Ga0207669_10098346 3300025937 Bacteria 1927
303 Ga0207669_10246238 3300025937 Unclassified 1328
304 Ga0207691_10000843 3300025940 Bacteria 30513
305 Ga0207691_10033830 3300025940 Bacteria 4758
306 Ga0207691_10036205 3300025940 Bacteria 4573
307 Ga0207691_10070966 3300025940 Bacteria 3145
308 Ga0207711_10000800 3300025941 Bacteria 30933
309 Ga0207711_10003099 3300025941 Bacteria 14499
310 Ga0207711_10009042 3300025941 Bacteria 8325
311 Ga0207661_10027117 3300025944 Bacteria 4373
312 Ga0207661_10200173 3300025944 Bacteria 1755
313 Ga0207661_10227202 3300025944 Bacteria 1651
314 Ga0207679_10003453 3300025945 Bacteria 9757
315 Ga0207679_10003456 3300025945 Bacteria 9753
316 Ga0207679_10008138 3300025945 Bacteria 6670
317 Ga0207679_10065217 3300025945 Bacteria 2724
318 Ga0207679_10592396 3300025945 Bacteria 998
319 Ga0207679_10680664 3300025945 Bacteria 932
320 Ga0207667_10040767 3300025949 Bacteria 4942
321 Ga0207667_10054616 3300025949 Bacteria 4201
322 Ga0207667_10060053 3300025949 Bacteria 3980
323 Ga0207667_10917912 3300025949 Bacteria 867
324 Ga0207651_10024746 3300025960 Bacteria 3719
325 Ga0207651_10069237 3300025960 Bacteria 2491
326 Ga0207651_10187576 3300025960 Bacteria 1646
327 Ga0207668_10564291 3300025972 Bacteria 988
328 Ga0207640_10006773 3300025981 Bacteria 6304
329 Ga0207640_10037898 3300025981 Bacteria 3037
330 Ga0207640_10071595 3300025981 Bacteria 2336
331 Ga0207640_10456082 3300025981 Bacteria 1055
332 Ga0207658_10005216 3300025986 Bacteria 8942
333 Ga0207658_10140907 3300025986 Bacteria 1951
334 Ga0207658_10327274 3300025986 Bacteria 1328
335 Ga0207658_10579544 3300025986 Bacteria 1006
336 Ga0207677_10127118 3300026023 Bacteria 1928
337 Ga0207677_10350002 3300026023 Bacteria 1238
338 Ga0207677_10505783 3300026023 Bacteria 1045
339 Ga0207703_10013987 3300026035 Bacteria 6256
340 Ga0207639_10008879 3300026041 Bacteria 6913
341 Ga0207678_10003083 3300026067 Bacteria 15075
342 Ga0207678_10012426 3300026067 Bacteria 7476
343 Ga0207678_10018242 3300026067 Bacteria 6162
344 Ga0207678_10039880 3300026067 Bacteria 4074
345 Ga0207678_10083744 3300026067 Bacteria 2728
346 Ga0207702_10227168 3300026078 Bacteria 1742
347 Ga0207702_10487763 3300026078 Bacteria 1200
348 Ga0207702_10550442 3300026078 Bacteria 1128
349 Ga0207641_10076556 3300026088 Bacteria 2892
350 Ga0207676_10040231 3300026095 Bacteria 3582
351 Ga0207676_10051401 3300026095 Bacteria 3217
352 Ga0207676_10061954 3300026095 Bacteria 2964
353 Ga0207674_10011913 3300026116 Bacteria 9749
354 Ga0207674_10012984 3300026116 Bacteria 9284
355 Ga0207674_10015543 3300026116 Bacteria 8359
356 Ga0207674_10040051 3300026116 Bacteria 4856
357 Ga0207674_10556797 3300026116 Bacteria 1108
358 Ga0207683_10010456 3300026121 Bacteria 7918
359 Ga0207683_10010830 3300026121 Bacteria 7776
360 Ga0207683_10033469 3300026121 Bacteria 4464
361 Ga0207698_10001495 3300026142 Bacteria 13610
362 Ga0207698_10001615 3300026142 Bacteria 13114
363 Ga0207698_10007109 3300026142 Bacteria 7013
364 Ga0207698_10080265 3300026142 Bacteria 2627
365 Ga0207698_10128950 3300026142 Bacteria 2158
366 Ga0207698_10229667 3300026142 Bacteria 1684
367 Ga0268266_10011575 3300028379 Bacteria 7658
368 Ga0268266_10123198 3300028379 Bacteria 2309
369 Ga0268266_10472325 3300028379 Bacteria 1195
370 Ga0268264_10025370 3300028381 Bacteria 4843
371 Ga0268264_10158468 3300028381 Bacteria 2036
372 Ga0307405_10012120 3300031731 Bacteria 4550
373 Ga0307410_10016961 3300031852 Bacteria 4357
374 Ga0307407_10307856 3300031903 Bacteria 1107
375 Ga0307407_10486044 3300031903 Unclassified 902
376 Ga0307412_10046815 3300031911 Bacteria 2836
377 Ga0307409_100297902 3300031995 Bacteria 1499
378 Ga0307416_100013878 3300032002 Bacteria 5493
379 Ga0307414_10443770 3300032004 Bacteria 1136
380 Ga0307415_100023089 3300032126 Bacteria 3854
381 Ga0373960_0072494 3300035121 Bacteria 1068
382 Ga0395899_0002415 3300037312 Bacteria 15182
383 Ga0395899_0011887 3300037312 Bacteria 6664
384 Ga0395899_0042682 3300037312 Bacteria 3384
385 Ga0395899_0050526 3300037312 Bacteria 3086
386 Ga0395899_0055163 3300037312 Bacteria 2940
387 Ga0395899_0091116 3300037312 Bacteria 2209
388 Ga0395899_0114599 3300037312 Unclassified 1935
389 Ga0395899_0128052 3300037312 Bacteria 1815
390 Ga0395899_0135172 3300037312 Bacteria 1758
391 Ga0395900_0004320 3300037418 Bacteria 15066
392 Ga0395900_0011318 3300037418 Bacteria 9126
393 Ga0395900_0028965 3300037418 Bacteria 5677
394 Ga0395900_0041917 3300037418 Bacteria 4717
395 Ga0395900_0043910 3300037418 Bacteria 4607
396 Ga0395900_0255888 3300037418 Bacteria 1750
397 Ga0395900_0256212 3300037418 Bacteria 1749
398 Ga0395900_0270952 3300037418 Bacteria 1692
399 Ga0395900_0292416 3300037418 Bacteria 1617
400 Ga0395900_0312058 3300037418 Unclassified 1555
401 Ga0395900_0424188 3300037418 Unclassified 1290
402 Ga0395900_0424676 3300037418 Unclassified 1289
403 Ga0395900_0449387 3300037418 Bacteria 1245
404 Ga0395900_0471003 3300037418 Unclassified 1209
405 Ga0395900_0632295 3300037418 Unclassified 1008
406 Ga0395900_0644400 3300037418 Bacteria 996
407 Ga0395900_0693227 3300037418 Bacteria 952
408 Ga0395898_0002752 3300037466 Bacteria 20261
409 Ga0395898_0010826 3300037466 Bacteria 9528
410 Ga0395898_0016801 3300037466 Bacteria 7477
411 Ga0395898_0018154 3300037466 Bacteria 7179
412 Ga0395898_0028412 3300037466 Bacteria 5603
413 Ga0395898_0054697 3300037466 Bacteria 3894
414 Ga0395898_0092491 3300037466 Bacteria 2908
415 Ga0395898_0092597 3300037466 Bacteria 2906
416 Ga0395898_0358954 3300037466 Bacteria 1389
417 Ga0395898_0388681 3300037466 Bacteria 1330
418 Ga0395898_0544493 3300037466 Bacteria 1102
419 Ga0395905_0000618 3300037471 Bacteria 47635
420 Ga0395905_0002085 3300037471 Bacteria 22730
421 Ga0395905_0003598 3300037471 Bacteria 16480
422 Ga0395905_0004344 3300037471 Bacteria 14757
423 Ga0395905_0017002 3300037471 Bacteria 6906
424 Ga0395905_0022972 3300037471 Bacteria 5894
425 Ga0395905_0026915 3300037471 Bacteria 5423
426 Ga0395905_0028284 3300037471 Bacteria 5284
427 Ga0395905_0030881 3300037471 Bacteria 5046
428 Ga0395905_0040241 3300037471 Bacteria 4384
429 Ga0395905_0059555 3300037471 Bacteria 3569
430 Ga0395905_0078664 3300037471 Bacteria 3090
431 Ga0395905_0079526 3300037471 Bacteria 3073
432 Ga0395905_0093735 3300037471 Bacteria 2816
433 Ga0395905_0098792 3300037471 Bacteria 2741
434 Ga0395905_0123385 3300037471 Unclassified 2435
435 Ga0395905_0130423 3300037471 Bacteria 2364
436 Ga0395905_0193916 3300037471 Bacteria 1905
437 Ga0395905_0268298 3300037471 Unclassified 1592
438 Ga0395905_0389236 3300037471 Bacteria 1288
439 Ga0395905_0594367 3300037471 Bacteria 1008
440 Ga0395905_0738180 3300037471 Bacteria 887
441 Ga0395901_0004999 3300038443 Bacteria 13389
442 Ga0395901_0005705 3300038443 Bacteria 12599
443 Ga0395901_0005835 3300038443 Bacteria 12464
444 Ga0395901_0005896 3300038443 Bacteria 12398
445 Ga0395901_0019302 3300038443 Bacteria 6969
446 Ga0395901_0045820 3300038443 Bacteria 4540
447 Ga0395901_0074221 3300038443 Bacteria 3548
448 Ga0395901_0082429 3300038443 Bacteria 3360
449 Ga0395901_0130783 3300038443 Bacteria 2637
450 Ga0395901_0226143 3300038443 Bacteria 1954
451 Ga0395901_0592644 3300038443 Bacteria 1118
452 Ga0436365_0304614 3300039437 Bacteria 14809
453 Ga0436365_0664406 3300039437 Bacteria 1629
454 Ga0439465_0013514 3300041413 Bacteria 2544
455 Ga0439448_0008419 3300042005 Bacteria 3020
456 Ga0439432_027054 3300042006 Bacteria 1875
457 Ga0439458_0001023 3300042157 Bacteria 7132
458 Ga0439458_0004690 3300042157 Bacteria 3117
459 Ga0466969_0024706 3300044656 Bacteria 3091
460 Ga0466972_0043525 3300044658 Bacteria 2180
461 Ga0466966_0024958 3300044684 Bacteria 3908
462 Ga0466966_0067999 3300044684 Bacteria 2236
463 Ga0466961_0008395 3300044693 Bacteria 6579
464 Ga0466961_0016447 3300044693 Bacteria 4754
465 Ga0466961_0043103 3300044693 Bacteria 2891
466 Ga0466963_0190036 3300044694 Bacteria 1434
467 Ga0466964_0003511 3300044706 Bacteria 5726
468 Ga0466971_0173675 3300044719 Bacteria 1012
469 Ga0466971_0254597 3300044719 Bacteria 837
470 Ga0466968_0216585 3300044735 Unclassified 901
471 Ga0466970_0011727 3300044765 Bacteria 4470
472 Ga0466970_0105624 3300044765 Bacteria 1536
473 Ga0466960_0003474 3300044901 Bacteria 6063
474 Ga0466959_0009516 3300045049 Bacteria 6914
475 Ga0466959_0009755 3300045049 Bacteria 6839
476 Ga0466959_0262054 3300045049 Bacteria 1190
477 Ga0466959_0503905 3300045049 Bacteria 818
478 Ga0466958_0083528 3300045836 Bacteria 1968
479 Ga0466967_0027948 3300045976 Bacteria 4701
480 Ga0466967_0037009 3300045976 Bacteria 4172
481 Ga0466967_0102314 3300045976 Bacteria 2620
482 Ga0466967_0437113 3300045976 Bacteria 1277
483 Ga0466967_1104518 3300045976 Unclassified 790
484 Ga0495663_0011518 3300046525 Bacteria 2460
485 Ga0495642_0018917 3300046528 Bacteria 2697
486 Ga0495668_0027472 3300046616 Bacteria 3224
487 Ga0495669_0008100 3300046684 Bacteria 4410
488 Ga0495669_0060325 3300046684 Bacteria 1714
489 Ga0495669_0076489 3300046684 Bacteria 1532
490 Ga0495677_0009432 3300047445 Bacteria 3605
491 Ga0495677_0167715 3300047445 Bacteria 849
492 Ga0496100_0019827 3300048903 Bacteria 4021
493 Ga0496100_0097150 3300048903 Bacteria 2022
494 Ga0496101_0061791 3300048904 Bacteria 2721
495 Ga0496103_0087209 3300048906 Bacteria 1967
496 Ga0496104_0456147 3300048907 Bacteria 1190
497 Ga0496106_0197648 3300048909 Bacteria 1600
498 Ga0496107_0185265 3300048910 Unclassified 1546
499 Ga0496107_0222982 3300048910 Bacteria 1403
500 Ga0496107_0385423 3300048910 Bacteria 1043
501 Ga0496108_0001424 3300048911 Bacteria 18863
502 Ga0496109_0002445 3300048912 Bacteria 15556
503 Ga0496109_0019642 3300048912 Bacteria 5960
504 Ga0496109_0509058 3300048912 Bacteria 1136
505 Ga0496110_0023030 3300048913 Bacteria 5296
506 Ga0496111_0025215 3300048914 Bacteria 4194
507 Ga0496111_0052429 3300048914 Bacteria 2945
508 Ga0496112_0002650 3300048915 Bacteria 14465
509 Ga0496112_0007744 3300048915 Bacteria 9556
510 Ga0496113_0003755 3300048916 Bacteria 9159
511 Ga0496113_0014799 3300048916 Bacteria 5336
512 Ga0496114_0000069 3300048917 Bacteria 73894
513 Ga0496114_0083464 3300048917 Bacteria 2703
514 Ga0496115_0016537 3300048918 Bacteria 5620
515 Ga0501067_0067764 3300049583 Bacteria 1976
516 Ga0501202_018359 3300049652 Bacteria 1373
517 Ga0501234_010213 3300049707 Bacteria 1463
518 Ga0501272_002153 3300049769 Bacteria 1939
519 Ga0495655_0058107 3300053083 Bacteria 1046
520 Ga0157378_10884638
521 JGI24740J21852_10015036
522 JGI24740J21852_10026984
523 JGI24739J22299_10055710
524 JGI24737J22298_10017146
525 JGI24735J21928_10010152
526 JGI24738J21930_10027208
527 Ga0070658_10004583
528 Ga0070658_10031057
529 Ga0070658_10031083
530 Ga0070658_10056097
531 Ga0070658_10073737
532 Ga0070658_10203433
533 Ga0070658_10425602
534 Ga0070658_10704445
535 Ga0070676_10067350
536 Ga0070676_10069047
537 Ga0070683_100002102
538 Ga0070683_100088328
539 Ga0070683_100248227
540 Ga0070690_100009978
541 Ga0070670_100017755
542 Ga0070670_100019579
543 Ga0070666_10016486
544 Ga0070680_100019688
545 Ga0070680_100077827
546 Ga0070680_100077916
547 Ga0070680_100122829
548 Ga0070680_100140011
549 Ga0070680_100140042
550 Ga0070682_100137875
551 Ga0068868_100070976
552 Ga0068868_100247190
553 Ga0068868_100311126
554 Ga0070660_100010926
555 Ga0070660_100019956
556 Ga0070660_100031252
557 Ga0070660_100206515
558 Ga0070660_100227985
559 Ga0070660_100445066
560 Ga0070661_100035235
561 Ga0070661_100042733
562 Ga0070661_100047282
563 Ga0070661_100061542
564 Ga0070661_100107012
565 Ga0070661_100115150
566 Ga0070661_100403245
567 Ga0070692_10052154
568 Ga0070668_100110441
569 Ga0070669_100510598
570 Ga0070675_100039406
571 Ga0070675_100047662
572 Ga0070675_100156793
573 Ga0070671_100003615
574 Ga0070671_100012453
575 Ga0070671_100086808
576 Ga0070671_100103003
577 Ga0070671_100198866
578 Ga0070674_100043862
579 Ga0070674_100177408
580 Ga0070673_100008479
581 Ga0070673_100012701
582 Ga0070673_100017963
583 Ga0070673_100177900
584 Ga0070673_100207274
585 Ga0070659_100009531
586 Ga0070659_100033669
587 Ga0070659_100204358
588 Ga0070659_100366154
589 Ga0070667_100015865
590 Ga0070667_100017584
591 Ga0070667_100152644
592 Ga0070667_100390247
593 Ga0070714_100057605
594 Ga0070714_100187951
595 Ga0070714_100759787
596 Ga0070713_100003702
597 Ga0070663_100038403
598 Ga0070663_100058400
599 Ga0070663_100145841
600 Ga0070663_100495630
601 Ga0070678_100000491
602 Ga0070678_100014956
603 Ga0070678_100306122
604 Ga0070662_100007713
605 Ga0070662_100031099
606 Ga0070662_100089074
607 Ga0070662_100099044
608 Ga0070662_100157339
609 Ga0070681_10095507
610 Ga0070681_10122190
611 Ga0070681_10186998
612 Ga0068867_100121665
613 Ga0068867_100124839
614 Ga0070685_10134090
615 Ga0070679_100067937
616 Ga0070679_100103962
617 Ga0070679_100158798
618 Ga0070679_100165711
619 Ga0070679_100200897
620 Ga0070679_100664842
621 Ga0070679_100783539
622 Ga0070684_100001660
623 Ga0070684_100027222
624 Ga0070684_100372387
625 Ga0070684_100605848
626 Ga0068853_100061563
627 Ga0068853_100397441
628 Ga0070672_100008981
629 Ga0070672_100023859
630 Ga0070672_100031884
631 Ga0070672_100253788
632 Ga0070672_100274184
633 Ga0070672_100332367
634 Ga0070693_100011412
635 Ga0070665_100008437
636 Ga0070665_100336866
637 Ga0070665_100696525
638 Ga0068855_100066693
639 Ga0068855_100075486
640 Ga0068855_100094328
641 Ga0068855_100102380
642 Ga0068855_100382700
643 Ga0068855_100873550
644 Ga0070664_100013772
645 Ga0070664_100022945
646 Ga0070664_100039223
647 Ga0070664_100058055
648 Ga0070664_100089557
649 Ga0070664_100163187
650 Ga0068857_100067617
651 Ga0068857_100095903
652 Ga0068857_100560698
653 Ga0068857_100562563
654 Ga0068854_100019573
655 Ga0068854_100042195
656 Ga0068854_100052902
657 Ga0068854_100057449
658 Ga0068854_100143366
659 Ga0068854_100420837
660 Ga0068856_100040538
661 Ga0068856_100518092
662 Ga0068856_100652564
663 Ga0068852_100001493
664 Ga0068852_100008910
665 Ga0068852_100036708
666 Ga0068852_100247780
667 Ga0068852_100376713
668 Ga0068859_100113547
669 Ga0068864_100016758
670 Ga0068864_100029516
671 Ga0068866_10004607
672 Ga0068861_100124547
673 Ga0068851_10036111
674 Ga0068851_10088365
675 Ga0068863_100007505
676 Ga0068858_100011273
677 Ga0068858_100137629
678 Ga0068860_100149043
679 Ga0081539_10013950
680 Ga0081539_10058259
681 Ga0070717_10009098
682 Ga0097621_100035910
683 Ga0097621_100130106
684 Ga0097620_100113546
685 Ga0105240_10018070
686 Ga0105240_10694967
687 Ga0105240_11032608
688 Ga0105247_10417519
689 Ga0105243_10214970
690 Ga0105242_10039520
691 Ga0105248_10007484
692 Ga0105248_10016010
693 Ga0105248_10147035
694 Ga0105248_10182817
695 Ga0105248_10197180
696 Ga0105238_10040880
697 Ga0105238_10218490
698 Ga0105239_10371936
699 Ga0157373_10025214
700 Ga0157373_10042764
701 Ga0157373_10527093
702 Ga0157371_10010864
703 Ga0157371_10020325
704 Ga0157371_10030393
705 Ga0157371_10048374
706 Ga0157371_10049890
707 Ga0157371_10065562
708 Ga0157371_10131193
709 Ga0157370_10023378
710 Ga0157370_10042607
711 Ga0157370_10045675
712 Ga0157370_10050759
713 Ga0157370_10088052
714 Ga0157370_10160647
715 Ga0157369_10007870
716 Ga0157369_10045304
717 Ga0157369_10123611
718 Ga0157369_10196852
719 Ga0157369_10197829
720 Ga0157369_10450215
721 Ga0157374_10001070
722 Ga0157374_10013216
723 Ga0157374_10098390
724 Ga0157374_10114282
725 Ga0157378_10105970
726 Ga0157378_10518814
727 Ga0163162_10001359
728 Ga0157372_10062761
729 Ga0157372_10142158
730 Ga0157372_10251064
731 Ga0157372_10397389
732 Ga0157372_10571855
733 Ga0157375_10002568
734 Ga0157375_10753311
735 Ga0163163_10129947
736 Ga0157379_10713207
737 Ga0206356_10706738
738 Ga0206353_11960203
739 Ga0213876_10009552
740 Ga0213876_10280093
741 Ga0207656_10036209
742 Ga0207656_10052130
743 Ga0207656_10121584
744 Ga0207656_10126738
745 Ga0207680_10146357
746 Ga0207680_10152401
747 Ga0207680_10388954
748 Ga0207647_10002423
749 Ga0207647_10008121
750 Ga0207647_10014125
751 Ga0207647_10022660
752 Ga0207647_10070541
753 Ga0207647_10076082
754 Ga0207645_10005274
755 Ga0207645_10052658
756 Ga0207705_10001299
757 Ga0207705_10006040
758 Ga0207705_10018920
759 Ga0207705_10028812
760 Ga0207705_10040146
761 Ga0207705_10059238
762 Ga0207705_10277582
763 Ga0207654_10304572
764 Ga0207654_10421497
765 Ga0207707_10131210
766 Ga0207695_10012620
767 Ga0207695_10045131
768 Ga0207671_10453801
769 Ga0207660_10002619
770 Ga0207660_10003290
771 Ga0207660_10010641
772 Ga0207660_10026979
773 Ga0207660_10034615
774 Ga0207660_10068405
775 Ga0207660_10108763
776 Ga0207660_10117334
777 Ga0207657_10006038
778 Ga0207657_10007451
779 Ga0207657_10015323
780 Ga0207657_10021782
781 Ga0207657_10022888
782 Ga0207657_10040601
783 Ga0207649_10024509
784 Ga0207649_10055904
785 Ga0207649_10115097
786 Ga0207649_10141667
787 Ga0207649_10221149
788 Ga0207649_10244655
789 Ga0207649_10419086
790 Ga0207652_10155189
791 Ga0207694_10072573
792 Ga0207694_10472053
793 Ga0207650_10067769
794 Ga0207650_10074445
795 Ga0207659_10119461
796 Ga0207659_10126643
797 Ga0207700_10003656
798 Ga0207664_10116116
799 Ga0207664_10176539
800 Ga0207644_10001401
801 Ga0207644_10004258
802 Ga0207644_10016356
803 Ga0207644_10161695
804 Ga0207644_10180158
805 Ga0207644_10303976
806 Ga0207644_10475018
807 Ga0207690_10009447
808 Ga0207690_10153575
809 Ga0207690_10287965
810 Ga0207706_10010976
811 Ga0207706_10013032
812 Ga0207706_10017267
813 Ga0207706_10020320
814 Ga0207706_10023358
815 Ga0207706_10045138
816 Ga0207706_10046041
817 Ga0207706_10111706
818 Ga0207706_10171755
819 Ga0207686_10051843
820 Ga0207669_10063888
821 Ga0207669_10098346
822 Ga0207669_10246238
823 Ga0207691_10000843
824 Ga0207691_10033830
825 Ga0207691_10036205
826 Ga0207691_10070966
827 Ga0207711_10000800
828 Ga0207711_10003099
829 Ga0207711_10009042
830 Ga0207661_10027117
831 Ga0207661_10200173
832 Ga0207661_10227202
833 Ga0207679_10003453
834 Ga0207679_10003456
835 Ga0207679_10008138
836 Ga0207679_10065217
837 Ga0207679_10592396
838 Ga0207679_10680664
839 Ga0207667_10040767
840 Ga0207667_10054616
841 Ga0207667_10060053
842 Ga0207667_10917912
843 Ga0207651_10024746
844 Ga0207651_10069237
845 Ga0207651_10187576
846 Ga0207668_10564291
847 Ga0207640_10006773
848 Ga0207640_10037898
849 Ga0207640_10071595
850 Ga0207640_10456082
851 Ga0207658_10005216
852 Ga0207658_10140907
853 Ga0207658_10327274
854 Ga0207658_10579544
855 Ga0207677_10127118
856 Ga0207677_10350002
857 Ga0207677_10505783
858 Ga0207703_10013987
859 Ga0207639_10008879
860 Ga0207678_10003083
861 Ga0207678_10012426
862 Ga0207678_10018242
863 Ga0207678_10039880
864 Ga0207678_10083744
865 Ga0207702_10227168
866 Ga0207702_10487763
867 Ga0207702_10550442
868 Ga0207641_10076556
869 Ga0207676_10040231
870 Ga0207676_10051401
871 Ga0207676_10061954
872 Ga0207674_10011913
873 Ga0207674_10012984
874 Ga0207674_10015543
875 Ga0207674_10040051
876 Ga0207674_10556797
877 Ga0207683_10010456
878 Ga0207683_10010830
879 Ga0207683_10033469
880 Ga0207698_10001495
881 Ga0207698_10001615
882 Ga0207698_10007109
883 Ga0207698_10080265
884 Ga0207698_10128950
885 Ga0207698_10229667
886 Ga0268266_10011575
887 Ga0268266_10123198
888 Ga0268266_10472325
889 Ga0268264_10025370
890 Ga0268264_10158468
891 Ga0307405_10012120
892 Ga0307410_10016961
893 Ga0307407_10307856
894 Ga0307407_10486044
895 Ga0307412_10046815
896 Ga0307409_100297902
897 Ga0307416_100013878
898 Ga0307414_10443770
899 Ga0307415_100023089
900 Ga0373960_0072494
901 Ga0395899_0002415
902 Ga0395899_0011887
903 Ga0395899_0042682
904 Ga0395899_0050526
905 Ga0395899_0055163
906 Ga0395899_0091116
907 Ga0395899_0114599
908 Ga0395899_0128052
909 Ga0395899_0135172
910 Ga0395900_0004320
911 Ga0395900_0011318
912 Ga0395900_0028965
913 Ga0395900_0041917
914 Ga0395900_0043910
915 Ga0395900_0255888
916 Ga0395900_0256212
917 Ga0395900_0270952
918 Ga0395900_0292416
919 Ga0395900_0312058
920 Ga0395900_0424188
921 Ga0395900_0424676
922 Ga0395900_0449387
923 Ga0395900_0471003
924 Ga0395900_0632295
925 Ga0395900_0644400
926 Ga0395900_0693227
927 Ga0395898_0002752
928 Ga0395898_0010826
929 Ga0395898_0016801
930 Ga0395898_0018154
931 Ga0395898_0028412
932 Ga0395898_0054697
933 Ga0395898_0092491
934 Ga0395898_0092597
935 Ga0395898_0358954
936 Ga0395898_0388681
937 Ga0395898_0544493
938 Ga0395905_0000618
939 Ga0395905_0002085
940 Ga0395905_0003598
941 Ga0395905_0004344
942 Ga0395905_0017002
943 Ga0395905_0022972
944 Ga0395905_0026915
945 Ga0395905_0028284
946 Ga0395905_0030881
947 Ga0395905_0040241
948 Ga0395905_0059555
949 Ga0395905_0078664
950 Ga0395905_0079526
951 Ga0395905_0093735
952 Ga0395905_0098792
953 Ga0395905_0123385
954 Ga0395905_0130423
955 Ga0395905_0193916
956 Ga0395905_0268298
957 Ga0395905_0389236
958 Ga0395905_0594367
959 Ga0395905_0738180
960 Ga0395901_0004999
961 Ga0395901_0005705
962 Ga0395901_0005835
963 Ga0395901_0005896
964 Ga0395901_0019302
965 Ga0395901_0045820
966 Ga0395901_0074221
967 Ga0395901_0082429
968 Ga0395901_0130783
969 Ga0395901_0226143
970 Ga0395901_0592644
971 Ga0436365_0304614
972 Ga0436365_0664406
973 Ga0439465_0013514
974 Ga0439448_0008419
975 Ga0439432_027054
976 Ga0439458_0001023
977 Ga0439458_0004690
978 Ga0466969_0024706
979 Ga0466972_0043525
980 Ga0466966_0024958
981 Ga0466966_0067999
982 Ga0466961_0008395
983 Ga0466961_0016447
984 Ga0466961_0043103
985 Ga0466963_0190036
986 Ga0466964_0003511
987 Ga0466971_0173675
988 Ga0466971_0254597
989 Ga0466968_0216585
990 Ga0466970_0011727
991 Ga0466970_0105624
992 Ga0466960_0003474
993 Ga0466959_0009516
994 Ga0466959_0009755
995 Ga0466959_0262054
996 Ga0466959_0503905
997 Ga0466958_0083528
998 Ga0466967_0027948
999 Ga0466967_0037009
1000 Ga0466967_0102314
1001 Ga0466967_0437113
1002 Ga0466967_1104518
1003 Ga0495663_0011518
1004 Ga0495642_0018917
1005 Ga0495668_0027472
1006 Ga0495669_0008100
1007 Ga0495669_0060325
1008 Ga0495669_0076489
1009 Ga0495677_0009432
1010 Ga0495677_0167715
1011 Ga0496100_0019827
1012 Ga0496100_0097150
1013 Ga0496101_0061791
1014 Ga0496103_0087209
1015 Ga0496104_0456147
1016 Ga0496106_0197648
1017 Ga0496107_0185265
1018 Ga0496107_0222982
1019 Ga0496107_0385423
1020 Ga0496108_0001424
1021 Ga0496109_0002445
1022 Ga0496109_0019642
1023 Ga0496109_0509058
1024 Ga0496110_0023030
1025 Ga0496111_0025215
1026 Ga0496111_0052429
1027 Ga0496112_0002650
1028 Ga0496112_0007744
1029 Ga0496113_0003755
1030 Ga0496113_0014799
1031 Ga0496114_0000069
1032 Ga0496114_0083464
1033 Ga0496115_0016537
1034 Ga0501067_0067764
1035 Ga0501202_018359
1036 Ga0501234_010213
1037 Ga0501272_002153
1038 Ga0495655_0058107

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01323

DSBA

DSBA-like thioredoxin domain

96

235

0.97

PF13462

Thioredoxin_4

Thioredoxin

83

236

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7d6l-assembly1.cif.gz_A crystal structure of trx2 from d. radiodurans r1 0.9096 96 130
3gyk-assembly4.cif.gz_D the crystal structure of a thioredoxin-like oxidoreductase from silicibacter pomeroyi dss-3 0.905 76 240
6nen-assembly1.cif.gz_A catalytic domain of proteus mirabilis scsc 0.8994 70 240
4gxz-assembly3.cif.gz_C crystal structure of a periplasmic thioredoxin-like protein from salmonella enterica serovar typhimurium 0.8981 77 240
6nen-assembly1.cif.gz_A catalytic domain of proteus mirabilis scsc 0.8708 70 240
ID Description Score Start End Superfamily
4xvwC01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8664 69 241 3.40.30.10
af_O76877_42_160_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8656 96 132 3.40.30.10
af_Q7ZVX9_55_186_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8637 94 132 3.40.30.10
af_A0A143ZZR4_72_201_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8547 93 132 3.40.30.10
1r26A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.852 93 132 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2A2K558-F1-model_v4 Thioredoxin domain-containing protein 0.9579 63 240 GO:0016491
AF-A0A2A2K558-F1-model_v4 Thioredoxin domain-containing protein 0.9374 63 240 GO:0016491
AF-A0A258X6G2-F1-model_v4 Disulfide bond formation protein DsbA 0.9313 95 240 GO:0016491
AF-A0A418Q2E3-F1-model_v4 DsbA family protein 0.9242 40 240 GO:0016491
AF-A0A532EKN4-F1-model_v4 DSBA-like thioredoxin domain-containing protein 0.9242 75 241 GO:0016491

Map