F458354

General Info

Members Datasets Scaffolds Average Seq Length
519 385 1038 380

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10039792|rootL2_100397926
Length 388
Sequence MPDDRETEKANKRRSTLTAFLREEARAQGFDLCRITRPDAIPQAAVRLGQFLDKGHHGTMGWMEETRDRRGDPRVLWSETRSIVVFGLNYGPDEDPRGILEKKEKAAISIYARNRDYHDIIKGRLKEIATRFAARSKEDVKVFVDTAPVMEKPLAEAAGLGWQGKXGKHTNLVSRAFGSWLFLGSMFTTADLELDEPEIDHCGSCRACLDVCPTAAFPAPYQLDARRCISYLTIEHKGPIDPELRPLIGNRIYGCDDCLAACPWNKFASAASEMKLVARDDLKEPSIAFLLDLDDAAFRTFFSGSPVKRIGRDRFIRNVLIAAGNSGERSFIERCRQLAGDPSPVVRGMAIWALSRLMTAGEFRAFAAERDDEANEEVRAEWTLAGVV

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
24 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
44 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
45 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
46 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
47 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
48 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
49 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
50 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
51 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
52 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
53 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
54 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
55 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
56 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
58 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
60 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
62 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
65 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
74 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
76 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
77 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
78 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
80 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
81 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
82 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
83 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
84 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
85 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
86 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
87 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
88 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
89 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
90 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
91 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
92 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
93 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
94 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
95 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
96 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
97 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
98 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
99 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
100 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
101 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
102 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
103 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
104 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
105 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
106 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
107 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
108 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
109 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
110 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
111 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
112 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
113 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
114 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
115 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
116 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
117 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
118 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
119 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
120 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
126 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
127 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
128 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
129 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
130 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
131 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
132 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
133 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
134 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
135 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
136 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
137 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
138 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
139 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
140 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
141 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
142 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
143 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
144 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
145 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
146 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
147 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
148 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
149 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
150 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
151 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
152 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
153 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
154 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
155 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
156 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
157 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
158 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
159 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
160 2516143018 Ensifer sp. BR816 Isolate Nodule
161 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
162 2519899620 Rhizobium sp. Pop5 Isolate Nodule
163 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
164 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
165 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
166 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
167 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
168 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
169 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
170 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
171 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
172 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
173 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
174 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
175 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
176 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
177 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
178 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
179 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
180 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
181 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
182 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
183 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
184 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
185 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
186 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
187 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
188 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
189 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
190 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
191 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
192 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
193 2643221557 Ensifer sp. Root558 Isolate Unclassified
194 2643221610 Ensifer sp. Root74 Isolate Unclassified
195 2643221668 Ensifer sp. Root423 Isolate Unclassified
196 2643221675 Ensifer sp. Root1298 Isolate Unclassified
197 2643221680 Ensifer sp. Root1312 Isolate Unclassified
198 2643221723 Ensifer sp. Root278 Isolate Unclassified
199 2643221726 Ensifer sp. Root954 Isolate Unclassified
200 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
201 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
202 2718217882 Rhizobium sp. N741 Isolate Nodule
203 2718217927 Rhizobium sp. N324 Isolate Nodule
204 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
205 2718218009 Rhizobium sp. N561 Isolate Nodule
206 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
207 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
208 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
209 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
210 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
211 2718218363 Rhizobium sp. N113 Isolate Nodule
212 2718218365 Rhizobium sp. N731 Isolate Nodule
213 2718218366 Rhizobium sp. N621 Isolate Nodule
214 2718218423 Rhizobium sp. N941 Isolate Nodule
215 2721755514 Rhizobium sp. N6212 Isolate Nodule
216 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
217 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
218 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
219 2721755809 Rhizobium sp. N541 Isolate Nodule
220 2721755810 Rhizobium sp. N871 Isolate Nodule
221 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
222 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
223 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
224 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
225 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
226 2728369365 Rhizobium sp. N1341 Isolate Nodule
227 2728369397 Rhizobium sp. N1314 Isolate Nodule
228 2738541293 Rhizobium sp. GV031 Isolate Unclassified
229 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
230 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
231 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
232 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
233 2791355256 Rhizobium sp. M10 Isolate Nodule
234 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
235 2791355260 Rhizobium sp. L9 Isolate Nodule
236 2791355261 Rhizobium sp. J15 Isolate Nodule
237 2791355262 Rhizobium sp. M1 Isolate Nodule
238 2791355263 Rhizobium chutanense C5 Isolate Nodule
239 2791355264 Rhizobium sp. S9 Isolate Nodule
240 2791355265 Rhizobium sp. H4 Isolate Nodule
241 2791355266 Rhizobium sp. L43 Isolate Nodule
242 2791355267 Rhizobium sp. L18 Isolate Nodule
243 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
244 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
245 2802429633 Rhizobium anhuiense J3 Isolate Nodule
246 2802429634 Rhizobium anhuiense S10 Isolate Nodule
247 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
248 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
249 2802429637 Rhizobium anhuiense C15 Isolate Nodule
250 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
251 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
252 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
253 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
254 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
255 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
256 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
257 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
258 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
259 2838048938 Rhizobium pisi 27/80 Isolate Nodule
260 2838061910 Rhizobium phaseoli L15 Isolate Nodule
261 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
262 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
263 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
264 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
265 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
266 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
267 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
268 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
269 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
270 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
271 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
272 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
273 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
274 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
275 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
276 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
277 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
278 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
279 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
280 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
281 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
282 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
283 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
284 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
285 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
286 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
287 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
288 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
289 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
290 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
291 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
292 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
293 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
294 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
295 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
296 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
297 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
298 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
299 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
300 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
301 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
302 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
303 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
304 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
305 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
306 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
307 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
308 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
309 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
310 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
311 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
312 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
313 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
314 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
315 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
316 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
317 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
318 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
319 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
320 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
321 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
322 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
323 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
324 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
325 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
326 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
327 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
328 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
329 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
330 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
331 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
332 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
333 2933599457 Rhizobium phaseoli M3 Isolate Nodule
334 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
335 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
336 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
337 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
338 2936381700 Rhizobium chutanense C16 Isolate Unclassified
339 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
340 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
341 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
342 2996893221 Rhizobium sp. R635 Isolate Nodule
343 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
344 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
345 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
346 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
347 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
348 8005275841 Rhizobium sp. N4311 Isolate Nodule
349 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
350 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
351 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
352 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
353 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
354 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
355 8005382845 Rhizobium sp. R634 Isolate Nodule
356 8005395548 Rhizobium sp. R339 Isolate Nodule
357 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
358 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
359 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
360 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
361 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
362 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
363 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
364 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
365 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
366 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
367 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
368 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
369 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
370 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
371 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
372 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
373 8018176218 Rhizobium sp. N122 Isolate Nodule
374 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
375 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
376 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
377 8024501048 Rhizobium sp. H4 Isolate Nodule
378 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
379 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
380 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
381 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
382 8056382006 Rhizobium croatiense 13T Isolate Nodule
383 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
384 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
385 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 52.99
Metatranscriptomes 0
Isolates 47.01

Biome Distribution

Category Percentage (%)
Aerial Root 0.19
Bulb 0
Endosphere 24.86
Nodule 34.3
Rhizoplane 1.93
Rhizosphere 16.57
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10039792 3300003322 Bacteria 10864
2 JGI24740J21852_10003637 3300001979 Bacteria 6723
3 JGI25156J39149_1000258 3300002705 Bacteria 36521
4 JGI25162J39368_1000244 3300002737 Bacteria 54424
5 JGI25154J39366_1000104 3300002738 Bacteria 74407
6 JGI25158J39367_1000011 3300002739 Bacteria 50391
7 JGI25157J39369_1000291 3300002741 Bacteria 36531
8 JGI25157J39369_1000462 3300002741 Bacteria 25566
9 JGI25152J39213_1001180 3300002773 Bacteria 12083
10 JGI25152J39213_1003837 3300002773 Bacteria 4969
11 JGI25150J39212_1000064 3300002774 Bacteria 64002
12 JGI25150J39212_1005714 3300002774 Bacteria 2632
13 JGI25159J45721_1000015 3300002987 Bacteria 142431
14 JGI25159J45721_1000338 3300002987 Bacteria 21677
15 JGI25159J45721_1000726 3300002987 Bacteria 14386
16 JGI25151J46595_10000242 3300003187 Bacteria 64028
17 JGI25151J46595_10004532 3300003187 Bacteria 7331
18 JGI25151J46595_10012745 3300003187 Bacteria 3813
19 JGI25165J46597_1000553 3300003214 Bacteria 34037
20 JGI25153J46596_10003296 3300003215 Bacteria 9071
21 JGI25153J46596_10003865 3300003215 Bacteria 8237
22 JGI25153J46596_10011362 3300003215 Bacteria 3940
23 rootH1_10111201 3300003323 Bacteria 3025
24 JGI25160J50197_1000003 3300003354 Bacteria 482719
25 JGI25160J50197_1000012 3300003354 Bacteria 267582
26 JGI25160J50197_1001559 3300003354 Bacteria 11318
27 JGI25161J50226_1000002 3300003374 Bacteria 420324
28 JGI25161J50226_1000219 3300003374 Bacteria 35426
29 JGI25161J50226_1000229 3300003374 Bacteria 34236
30 Ga0055526_1002331 3300003771 Bacteria 12903
31 Ga0055526_1002479 3300003771 Bacteria 12467
32 Ga0055526_1003824 3300003771 Bacteria 9358
33 Ga0055524_1004511 3300003775 Bacteria 6413
34 Ga0055524_1005699 3300003775 Bacteria 5520
35 Ga0055524_1009609 3300003775 Bacteria 3914
36 Ga0055536_1001386 3300003781 Bacteria 14673
37 Ga0055528_1000863 3300003790 Bacteria 20549
38 Ga0055528_1001254 3300003790 Bacteria 16112
39 Ga0055528_1018261 3300003790 Bacteria 2384
40 Ga0055540_1000181 3300003792 Bacteria 61906
41 Ga0055540_1000797 3300003792 Bacteria 21342
42 Ga0055531_10004785 3300003794 Bacteria 8091
43 Ga0058692_1008487 3300003856 Bacteria 2650
44 Ga0055543_1000011 3300004625 Bacteria 196089
45 Ga0055543_1000034 3300004625 Bacteria 128668
46 Ga0055543_1000073 3300004625 Bacteria 88583
47 Ga0055543_1004645 3300004625 Bacteria 3683
48 Ga0065165_1000025 3300005262 Bacteria 246909
49 Ga0065165_1000082 3300005262 Bacteria 158536
50 Ga0065165_1010451 3300005262 Bacteria 4012
51 Ga0065165_1020171 3300005262 Bacteria 2354
52 Ga0070670_100000091 3300005331 Bacteria 85664
53 Ga0070669_100018163 3300005353 Bacteria 5024
54 Ga0070671_100014557 3300005355 Bacteria 6361
55 Ga0070667_100267097 3300005367 Bacteria 1533
56 Ga0070717_10052503 3300006028 Bacteria 3358
57 Ga0075365_10049604 3300006038 Bacteria 2766
58 Ga0075363_100074032 3300006048 Bacteria 1854
59 Ga0075363_100081842 3300006048 Bacteria 1766
60 Ga0075362_10005238 3300006177 Bacteria 4730
61 Ga0075369_10027895 3300006186 Bacteria 2363
62 Ga0075366_10003865 3300006195 Bacteria 7981
63 Ga0075370_10016713 3300006353 Bacteria 3951
64 Ga0099826_10013593 3300006948 Bacteria 6152
65 Ga0105240_10000024 3300009093 Bacteria 375919
66 Ga0105248_10064326 3300009177 Bacteria 4118
67 Ga0105237_10000538 3300009545 Bacteria 53474
68 Ga0123341_1009737 3300009765 Bacteria 8784
69 Ga0157370_10000180 3300013104 Bacteria 79428
70 Ga0171463_1001 3300013249 Bacteria 1406070
71 Ga0182007_10003967 3300015262 Bacteria 6832
72 Ga0183363_1038 3300015690 Bacteria 43720
73 Ga0214543_1000040 3300021327 Bacteria 174142
74 Ga0209435_100065 3300025206 Bacteria 74485
75 Ga0209436_100113 3300025208 Bacteria 39873
76 Ga0209437_100050 3300025233 Bacteria 394010
77 Ga0207425_1000139 3300025245 Bacteria 64086
78 Ga0207425_1001129 3300025245 Bacteria 12024
79 Ga0207425_1007419 3300025245 Bacteria 2894
80 Ga0209646_1000195 3300025246 Bacteria 74485
81 Ga0209026_1000235 3300025250 Bacteria 74485
82 Ga0209759_1000268 3300025256 Bacteria 74485
83 Ga0209129_1000066 3300025258 Bacteria 226820
84 Ga0209129_1000223 3300025258 Bacteria 64086
85 Ga0209129_1001096 3300025258 Bacteria 15811
86 Ga0209129_1001420 3300025258 Bacteria 13383
87 Ga0209129_1001838 3300025258 Bacteria 11245
88 Ga0209233_1000037 3300025261 Bacteria 554620
89 Ga0209233_1000236 3300025261 Bacteria 92446
90 Ga0209673_1000024 3300025273 Bacteria 409632
91 Ga0209673_1000378 3300025273 Bacteria 80351
92 Ga0209673_1000906 3300025273 Bacteria 37927
93 Ga0209673_1000988 3300025273 Bacteria 34774
94 Ga0209673_1004761 3300025273 Bacteria 7132
95 Ga0209130_1000002 3300025284 Bacteria 722648
96 Ga0209130_1000005 3300025284 Bacteria 599620
97 Ga0209130_1000028 3300025284 Bacteria 325668
98 Ga0209130_1013302 3300025284 Bacteria 2113
99 Ga0209676_1003201 3300025292 Bacteria 10368
100 Ga0209676_1003487 3300025292 Bacteria 9634
101 Ga0209025_1000060 3300025294 Bacteria 305017
102 Ga0209025_1000105 3300025294 Bacteria 224157
103 Ga0209025_1000235 3300025294 Bacteria 129981
104 Ga0209025_1000557 3300025294 Bacteria 69226
105 Ga0209025_1000612 3300025294 Bacteria 64088
106 Ga0209025_1000866 3300025294 Bacteria 47843
107 Ga0209025_1012517 3300025294 Bacteria 5428
108 Ga0209564_1000113 3300025295 Bacteria 211564
109 Ga0209564_1000683 3300025295 Bacteria 50090
110 Ga0209564_1001075 3300025295 Bacteria 32804
111 Ga0209564_1016462 3300025295 Bacteria 2941
112 Ga0209758_1000495 3300025297 Bacteria 64088
113 Ga0209758_1000786 3300025297 Bacteria 45428
114 Ga0209758_1001165 3300025297 Bacteria 33420
115 Ga0209758_1001945 3300025297 Bacteria 22393
116 Ga0209758_1002238 3300025297 Bacteria 20078
117 Ga0209758_1003289 3300025297 Bacteria 14977
118 Ga0209050_1002738 3300025298 Bacteria 14211
119 Ga0209256_1000027 3300025299 Bacteria 423283
120 Ga0209256_1001273 3300025299 Bacteria 27393
121 Ga0209256_1001386 3300025299 Bacteria 25312
122 Ga0209256_1004283 3300025299 Bacteria 9094
123 Ga0209256_1008217 3300025299 Bacteria 4898
124 Ga0207426_1000012 3300025302 Bacteria 730942
125 Ga0207426_1000013 3300025302 Bacteria 721897
126 Ga0207426_1000015 3300025302 Bacteria 599316
127 Ga0207426_1000810 3300025302 Bacteria 33700
128 Ga0207426_1006434 3300025302 Bacteria 5116
129 Ga0209051_1000228 3300025303 Bacteria 94166
130 Ga0209051_1001114 3300025303 Bacteria 24583
131 Ga0209051_1002152 3300025303 Bacteria 14640
132 Ga0209051_1042764 3300025303 Bacteria 1597
133 Ga0209257_1001313 3300025304 Bacteria 30254
134 Ga0209257_1002062 3300025304 Bacteria 21252
135 Ga0209257_1016108 3300025304 Bacteria 3050
136 Ga0209257_1019025 3300025304 Bacteria 2607
137 Ga0209257_1038186 3300025304 Bacteria 1457
138 Ga0207695_10000036 3300025913 Bacteria 477897
139 Ga0207671_10000191 3300025914 Bacteria 95004
140 Ga0207681_10010465 3300025923 Bacteria 5677
141 Ga0207650_10000415 3300025925 Bacteria 37969
142 Ga0207644_10060162 3300025931 Bacteria 2748
143 Ga0207711_10176344 3300025941 Bacteria 1942
144 Ga0207711_10263646 3300025941 Bacteria 1584
145 Ga0209281_1000043 3300027111 Bacteria 341543
146 Ga0209371_1000009 3300027312 Bacteria 963030
147 Ga0209371_1004910 3300027312 Bacteria 5570
148 Ga0209282_1016796 3300027666 Bacteria 4656
149 Ga0268256_1000010 3300030500 Bacteria 963034
150 Ga0307510_10149307 3300033180 Bacteria 1961
151 Ga0373937_0000413 3300036401 Bacteria 39908
152 Ga0373925_0013602 3300037068 Bacteria 5891
153 Ga0439465_0005413 3300041413 Bacteria 4074
154 Ga0439465_0006237 3300041413 Bacteria 3788
155 Ga0451835_0649428 3300041492 Bacteria 2330
156 Ga0466968_0098417 3300044735 Bacteria 1304
157 Ga0466970_0013294 3300044765 Bacteria 4220
158 Ga0466957_0017782 3300044842 Bacteria 4171
159 Ga0451576_0198089 3300045051 Bacteria 2098
160 Ga0466958_0150628 3300045836 Bacteria 1467
161 Ga0495651_0134052 3300046462 Bacteria 1805
162 Ga0495605_0019717 3300046474 Bacteria 3596
163 Ga0495662_0032372 3300046476 Bacteria 2525
164 Ga0495585_0111235 3300046492 Bacteria 1456
165 Ga0495596_0020806 3300046500 Bacteria 2683
166 Ga0495607_0040235 3300046501 Bacteria 2785
167 Ga0495583_0045509 3300046506 Bacteria 2029
168 Ga0495606_0000995 3300046507 Bacteria 41346
169 Ga0495610_0046651 3300046512 Bacteria 2136
170 Ga0495628_0226465 3300046516 Bacteria 1402
171 Ga0495631_0005467 3300046518 Bacteria 6644
172 Ga0495643_0013263 3300046522 Bacteria 4939
173 Ga0495654_0000070 3300046530 Bacteria 117357
174 Ga0495668_0009086 3300046616 Bacteria 6133
175 Ga0495625_0008274 3300046660 Bacteria 8891
176 Ga0495625_0076861 3300046660 Bacteria 2333
177 Ga0495649_0009260 3300046694 Bacteria 5867
178 Ga0495604_0019348 3300047317 Bacteria 5450
179 Ga0495686_0000654 3300047472 Bacteria 47357
180 Ga0495626_0040755 3300048091 Bacteria 2192
181 Ga0496103_0019973 3300048906 Bacteria 4023
182 Ga0496106_0001485 3300048909 Bacteria 17625
183 Ga0496111_0000442 3300048914 Bacteria 21049
184 Ga0496113_0333963 3300048916 Bacteria 1215
185 Ga0496116_0021865 3300048919 Bacteria 4811
186 Ga0496116_0031137 3300048919 Bacteria 3824
187 Ga0496116_0033453 3300048919 Bacteria 3648
188 Ga0496116_0066895 3300048919 Bacteria 2297
189 Ga0496116_0096761 3300048919 Bacteria 1777
190 Ga0496116_0144404 3300048919 Bacteria 1332
191 Ga0496117_0000002 3300048920 Bacteria 2483758
192 Ga0496117_0001890 3300048920 Bacteria 28086
193 Ga0496117_0004320 3300048920 Bacteria 15810
194 Ga0496117_0010644 3300048920 Bacteria 8342
195 Ga0496117_0020743 3300048920 Bacteria 5347
196 Ga0496117_0052800 3300048920 Bacteria 2860
197 Ga0496118_0001610 3300048921 Bacteria 33387
198 Ga0496118_0003649 3300048921 Bacteria 19121
199 Ga0496118_0049422 3300048921 Bacteria 3239
200 Ga0496118_0057912 3300048921 Bacteria 2900
201 Ga0496118_0066363 3300048921 Bacteria 2634
202 Ga0496119_0038052 3300048922 Bacteria 3114
203 Ga0496119_0096348 3300048922 Bacteria 1670
204 Ga0496120_0000034 3300048923 Bacteria 215228
205 Ga0496120_0060771 3300048923 Bacteria 2112
206 Ga0496120_0064667 3300048923 Bacteria 2029
207 Ga0496121_0000001 3300048924 Bacteria 1830318
208 Ga0496121_0006036 3300048924 Bacteria 15267
209 Ga0496121_0010015 3300048924 Bacteria 10777
210 Ga0496121_0057006 3300048924 Bacteria 3240
211 Ga0496121_0128294 3300048924 Bacteria 1903
212 Ga0496122_0000001 3300048925 Bacteria 1827766
213 Ga0496122_0000018 3300048925 Bacteria 426350
214 Ga0496122_0000309 3300048925 Bacteria 107844
215 Ga0496122_0003689 3300048925 Bacteria 19844
216 Ga0496122_0014328 3300048925 Bacteria 7674
217 Ga0496122_0025078 3300048925 Bacteria 5195
218 Ga0496122_0038743 3300048925 Bacteria 3811
219 Ga0496122_0057883 3300048925 Bacteria 2874
220 Ga0496122_0074354 3300048925 Bacteria 2404
221 Ga0496123_0000001 3300048926 Bacteria 1831497
222 Ga0496123_0000015 3300048926 Bacteria 426088
223 Ga0496123_0002465 3300048926 Bacteria 22901
224 Ga0496123_0011919 3300048926 Bacteria 7467
225 Ga0496123_0019120 3300048926 Bacteria 5408
226 Ga0496123_0020091 3300048926 Bacteria 5239
227 Ga0496123_0051311 3300048926 Bacteria 2747
228 Ga0496123_0072533 3300048926 Bacteria 2141
229 Ga0496123_0083263 3300048926 Bacteria 1935
230 Ga0496124_0003452 3300048927 Bacteria 19323
231 Ga0496124_0003968 3300048927 Bacteria 17643
232 Ga0496124_0005732 3300048927 Bacteria 13834
233 Ga0496124_0008074 3300048927 Bacteria 11065
234 Ga0496124_0013636 3300048927 Bacteria 7925
235 Ga0496124_0023124 3300048927 Bacteria 5683
236 Ga0496124_0029989 3300048927 Bacteria 4836
237 Ga0496124_0081160 3300048927 Bacteria 2667
238 Ga0496124_0115170 3300048927 Bacteria 2158
239 Ga0496124_0132365 3300048927 Bacteria 1979
240 Ga0496125_0000001 3300048928 Bacteria 1766138
241 Ga0496125_0005992 3300048928 Bacteria 13304
242 Ga0496125_0008218 3300048928 Bacteria 10971
243 Ga0496125_0008887 3300048928 Bacteria 10432
244 Ga0496125_0019126 3300048928 Bacteria 6474
245 Ga0496126_0002943 3300048929 Bacteria 22129
246 Ga0496126_0037953 3300048929 Bacteria 4485
247 Ga0496126_0070729 3300048929 Bacteria 3108
248 Ga0496126_0191750 3300048929 Bacteria 1730
249 Ga0501034_0233077 3300049571 Bacteria 1789
250 Ga0501036_0140545 3300049572 Bacteria 2038
251 Ga0501037_0086393 3300049573 Bacteria 2271
252 Ga0501047_0045036 3300049581 Bacteria 4265
253 Ga0501044_0178674 3300049823 Bacteria 2090
254 nmdc:mga03683_15784_c1 3300050489 Bacteria 2825
255 nmdc:mga00v17_26_c4 3300050491 Bacteria 47279
256 nmdc:mga00v17_3025_c1 3300050491 Bacteria 8642
257 Ga0495619_0122002 3300053085 Bacteria 1787
258 Ga0500557_001640 3300053105 Bacteria 3763
259 Ga0500569_003891 3300053109 Bacteria 3093
260 Ga0500572_001990 3300053111 Bacteria 5099
261 Ga0500618_000096 3300053125 Bacteria 72003
262 Ga0500618_000415 3300053125 Bacteria 28810
263 Ga0500658_0010073 3300053134 Bacteria 3489
264 Ga0500658_0010804 3300053134 Bacteria 3369
265 Ga0500568_0003620 3300053139 Bacteria 8530
266 Ga0500568_0004058 3300053139 Bacteria 7927
267 Ga0500590_000069 3300053148 Bacteria 26240
268 Ga0500616_0000170 3300053153 Bacteria 108126
269 Ga0500616_0000903 3300053153 Bacteria 32556
270 Ga0500622_0002923 3300053156 Bacteria 11874
271 Ga0500634_0010323 3300053161 Bacteria 4767
272 Ga0500636_0000069 3300053177 Bacteria 50916
273 Ga0500636_0065642 3300053177 Bacteria 2112
274 Ga0501082_0207818 3300060353 Bacteria 1703
275 Ga0466962_0063422 3300061719 Bacteria 1764
276 2509388880 2509276021 Bacteria 7634384
277 2509444466 2509276033 Bacteria 7180565
278 2510135790 2510065019 Bacteria 6903379
279 2510897269 2510461076 Bacteria 8618824
280 2511137149 2510917022 Bacteria 6504556
281 2511194084 2510917030 Bacteria 7460662
282 2513570955 2513237084 Bacteria 7231967
283 2513574845 2513237085 Bacteria 7695351
284 2513634091 2513237093 Bacteria 7545552
285 2513707458 2513237103 Bacteria 7647401
286 2513911081 2513237144 Bacteria 7530820
287 2513924401 2513237146 Bacteria 7166346
288 2514022224 2513237162 Bacteria 7468464
289 2515114998 2515075009 Bacteria 7288508
290 2515633886 2515154113 Bacteria 7807172
291 2515641292 2515154114 Bacteria 7848616
292 2515659702 2515154116 Bacteria 7552979
293 2515741071 2515154134 Bacteria 7220242
294 2516204717 2516143018 Bacteria 6951533
295 2517409060 2517287029 Bacteria 6905599
296 2520375833 2519899620 Bacteria 6499161
297 2524458024 2524023209 Bacteria 6679728
298 2530648238 2529292951 Bacteria 6916614
299 2585223374 2582581298 Bacteria 7315509
300 2585273598 2582581307 Bacteria 6597605
301 2585281099 2582581308 Bacteria 7413247
302 2585326317 2582581315 Bacteria 7318924
303 2585330483 2582581316 Bacteria 7774528
304 2585523830 2585427526 Bacteria 7258840
305 2585533837 2585427527 Bacteria 7273426
306 2585543381 2585427528 Bacteria 6842387
307 2585546030 2585427529 Bacteria 7395659
308 2585553430 2585427530 Bacteria 7383882
309 2585559771 2585427531 Bacteria 6992870
310 2585840799 2585427593 Bacteria 7141551
311 2585843822 2585427594 Bacteria 6180594
312 2585900459 2585427608 Bacteria 6544331
313 2585906049 2585427609 Bacteria 6667127
314 2585998585 2585427633 Bacteria 6413184
315 2586003121 2585427634 Bacteria 6455027
316 2587978836 2585428125 Bacteria 6662905
317 2599419640 2599185170 Bacteria 7295545
318 2599718886 2599185236 Bacteria 6875203
319 2600197552 2599185352 Bacteria 7228948
320 2600376663 2600254933 Bacteria 4750527
321 2601609434 2600255279 Bacteria 5605316
322 2601746209 2600255308 Bacteria 5611129
323 2616293843 2615840624 Bacteria 6557588
324 2616309453 2615840626 Bacteria 7921970
325 2616556214 2615840698 Bacteria 7319877
326 2617380588 2617270742 Bacteria 6808054
327 2643805897 2643221557 Bacteria 7184309
328 2644066073 2643221610 Bacteria 7480339
329 2644380378 2643221668 Bacteria 7306521
330 2644417404 2643221675 Bacteria 7473456
331 2644450800 2643221680 Bacteria 7473610
332 2644671573 2643221723 Bacteria 7095460
333 2644692776 2643221726 Bacteria 7455827
334 2671114000 2667528174 Bacteria 6435400
335 2692317663 2690316117 Bacteria 6800650
336 2719183455 2718217882 Bacteria 6556348
337 2719388199 2718217927 Bacteria 6972593
338 2719667821 2718217997 Bacteria 6740740
339 2719734172 2718218009 Bacteria 6478651
340 2720494241 2718218199 Bacteria 6740745
341 2720615703 2718218232 Bacteria 6720332
342 2720622488 2718218233 Bacteria 6662049
343 2720633842 2718218235 Bacteria 6630699
344 2720777542 2718218269 Bacteria 6906114
345 2721149567 2718218363 Bacteria 6524337
346 2721160970 2718218365 Bacteria 6274507
347 2721166404 2718218366 Bacteria 6425255
348 2721401834 2718218423 Bacteria 6438183
349 2722842574 2721755514 Bacteria 6424414
350 2723029141 2721755556 Bacteria 6745503
351 2723562755 2721755684 Bacteria 6859907
352 2723569449 2721755685 Bacteria 6704835
353 2724040648 2721755809 Bacteria 6438790
354 2724046928 2721755810 Bacteria 6479005
355 2724092149 2721755819 Bacteria 6906405
356 2724106714 2721755822 Bacteria 6726041
357 2724112523 2721755823 Bacteria 6752556
358 2725947578 2724679232 Bacteria 7646494
359 2730110077 2728369352 Bacteria 6745171
360 2730166690 2728369365 Bacteria 6555560
361 2730300602 2728369397 Bacteria 6274511
362 2738800898 2738541293 Bacteria 7065685
363 2739038219 2738541333 Bacteria 7106503
364 2766063277 2765235942 Bacteria 7445910
365 2778173833 2775507266 Bacteria 7392367
366 2792637700 2791355094 Bacteria 7011481
367 2793296726 2791355256 Bacteria 6798008
368 2793314102 2791355259 Bacteria 7254731
369 2793322386 2791355260 Bacteria 6598818
370 2793327683 2791355261 Bacteria 6661293
371 2793336713 2791355262 Bacteria 6774204
372 2793341155 2791355263 Bacteria 6872478
373 2793349560 2791355264 Bacteria 6429314
374 2793352590 2791355265 Bacteria 6539969
375 2793358405 2791355266 Bacteria 7116587
376 2793365447 2791355267 Bacteria 7222458
377 2805928250 2802429605 Bacteria 6875453
378 2805936578 2802429606 Bacteria 6346811
379 2806046585 2802429633 Bacteria 7341974
380 2806051335 2802429634 Bacteria 7083200
381 2806059324 2802429635 Bacteria 7650140
382 2806066703 2802429636 Bacteria 7597525
383 2806073760 2802429637 Bacteria 7067217
384 2819608741 2818991448 Bacteria 6772224
385 2819640850 2818991453 Bacteria 7181617
386 2819685911 2818991461 Bacteria 7026071
387 2821123323 2821123053 Bacteria 7836056
388 2838020697 2838016132 Bacteria 6577831
389 2838026333 2838022645 Bacteria 6494267
390 2838029632 2838029111 Bacteria 6603031
391 2838039828 2838035591 Bacteria 7166484
392 2838044746 2838042994 Bacteria 6046894
393 2838053201 2838048938 Bacteria 6044578
394 2838064595 2838061910 Bacteria 6794874
395 2838070628 2838068647 Bacteria 6208656
396 2838664110 2838661181 Bacteria 7385261
397 2838674054 2838668709 Bacteria 6671819
398 2838680134 2838680041 Bacteria 6545511
399 2838695835 2838694306 Bacteria 6853137
400 2838706506 2838701080 Bacteria 6669771
401 2838709210 2838707686 Bacteria 6619912
402 2838739653 2838736955 Bacteria 5760694
403 2841844223 2841840854 Bacteria 5761912
404 2841868997 2841864319 Bacteria 6742987
405 2842079554 2842077413 Bacteria 6508645
406 2842112627 2842110456 Bacteria 7656360
407 2842120172 2842118031 Bacteria 7033875
408 2842143944 2842140634 Bacteria 5759631
409 2842151164 2842146304 Bacteria 5957337
410 2842165640 2842163707 Bacteria 6916235
411 2842196259 2842192696 Bacteria 6147454
412 2842202094 2842198810 Bacteria 6608673
413 2842209030 2842205361 Bacteria 6340321
414 2842219296 2842217011 Bacteria 7497767
415 2842238621 2842237096 Bacteria 6620661
416 2842256220 2842250916 Bacteria 6579627
417 2842268275 2842264693 Bacteria 6472963
418 2842282280 2842278818 Bacteria 6340002
419 2842286398 2842285085 Bacteria 6011953
420 2842293215 2842291075 Bacteria 7076806
421 2842299794 2842298080 Bacteria 6123127
422 2842308988 2842304105 Bacteria 7023636
423 2842312329 2842311132 Bacteria 6616990
424 2842321925 2842317721 Bacteria 6793725
425 2842344528 2842341865 Bacteria 7003929
426 2842359684 2842357229 Bacteria 6485165
427 2842367569 2842363717 Bacteria 6844742
428 2842370596 2842370503 Bacteria 7038661
429 2842379612 2842377471 Bacteria 7140707
430 2842386683 2842384541 Bacteria 7057858
431 2842397730 2842395702 Bacteria 6780583
432 2842404049 2842402390 Bacteria 6681310
433 2842410248 2842409023 Bacteria 6687331
434 2842416896 2842415677 Bacteria 6596907
435 2842424243 2842422224 Bacteria 6239196
436 2842432247 2842428310 Bacteria 6767288
437 2842438551 2842434925 Bacteria 6502746
438 2842445181 2842441272 Bacteria 6769273
439 2842453930 2842447887 Bacteria 6754142
440 2842466418 2842462802 Bacteria 6588055
441 2842473238 2842469257 Bacteria 6752936
442 2842475938 2842475841 Bacteria 6603183
443 2842486021 2842482326 Bacteria 7212537
444 2842494710 2842489311 Bacteria 6620893
445 2842499824 2842495871 Bacteria 6820686
446 2842503160 2842502639 Bacteria 6604161
447 2842513027 2842509118 Bacteria 6850950
448 2847421357 2847417321 Bacteria 6913799
449 2848996142 2848992105 Bacteria 6810864
450 2852388052 2852387548 Bacteria 8025568
451 2854900709 2854896431 Bacteria 5869725
452 2854919594 2854916844 Bacteria 5725939
453 2855877850 2855872281 Bacteria 6964271
454 2857522072 2857516855 Bacteria 7787325
455 2857533726 2857531043 Bacteria 6754041
456 2891375343 2891373044 Bacteria 5202277
457 2913298329 2913295892 Bacteria 6333755
458 2919101746 2919100787 Bacteria 7710546
459 2919172377 2919171160 Bacteria 6499771
460 2919408458 2919408235 Bacteria 6149349
461 2920822926 2920822456 Bacteria 6897201
462 2929142239 2929138655 Bacteria 5810547
463 2933018799 2933016740 Bacteria 6355406
464 2933575432 2933570622 Bacteria 7023390
465 2933588484 2933586486 Bacteria 7667493
466 2933594295 2933594066 Bacteria 5594265
467 2933601432 2933599457 Bacteria 5858799
468 2935896355 2935894831 Bacteria 6620579
469 2935902435 2935901341 Bacteria 7341747
470 2936369396 2936367885 Bacteria 7324495
471 2936380090 2936375103 Bacteria 6652732
472 2936386206 2936381700 Bacteria 7006523
473 2979104928 2979100975 Bacteria 5423623
474 2984601884 2984601300 Bacteria 5455244
475 2989351819 2989349275 Bacteria 6349068
476 2996897716 2996893221 Bacteria 5823108
477 3005410729 3005409236 Bacteria 7188837
478 3005423156 3005416602 Bacteria 7064308
479 3005450203 3005445848 Bacteria 6906074
480 639646195 639633055 Bacteria 7751309
481 643827848 643692032 Bacteria 6891900
482 8005278405 8005275841 Bacteria 6929066
483 8005285366 8005282627 Bacteria 6675747
484 8005291529 8005289223 Bacteria 6634003
485 8005305591 8005301065 Bacteria 6614431
486 8005310365 8005307578 Bacteria 7395396
487 8005315483 8005314921 Bacteria 7072929
488 8005377905 8005376324 Bacteria 6590079
489 8005385200 8005382845 Bacteria 6732062
490 8005399721 8005395548 Bacteria 6806915
491 8005433280 8005430974 Bacteria 6689030
492 8005465695 8005460587 Bacteria 7157962
493 8005484609 8005484373 Bacteria 6297373
494 8005498218 8005497431 Bacteria 6477605
495 8005560098 8005556819 Bacteria 6908598
496 8005564403 8005563573 Bacteria 7153261
497 8005573963 8005570704 Bacteria 6957481
498 8005619428 8005619151 Bacteria 7030230
499 8005627994 8005626139 Bacteria 6534237
500 8005649302 8005645114 Bacteria 6950293
501 8005669627 8005668836 Bacteria 6953162
502 8005685461 8005682033 Bacteria 6726518
503 8005692656 8005688590 Bacteria 6610080
504 8005701343 8005695170 Bacteria 6912330
505 8018132674 8018127388 Bacteria 7351159
506 8018167476 8018163183 Bacteria 7277977
507 8018181961 8018176218 Bacteria 6896178
508 8023681158 8023680758 Bacteria 7729763
509 8024479817 8024479707 Bacteria 6954785
510 8024491740 8024486573 Bacteria 6540512
511 8024506442 8024501048 Bacteria 6427847
512 8046769629 8046767195 Bacteria 7547379
513 8054461091 8054460903 Bacteria 4872905
514 8054561120 8054558443 Bacteria 5204801
515 8056381059 8056375014 Bacteria 7006639
516 8056382575 8056382006 Bacteria 6408074
517 8056878757 8056875544 Bacteria 4355797
518 8057580332 8057575449 Bacteria 7367519
519 8057879072 8057874678 Bacteria 7494653
520 rootL2_10039792
521 JGI24740J21852_10003637
522 JGI25156J39149_1000258
523 JGI25162J39368_1000244
524 JGI25154J39366_1000104
525 JGI25158J39367_1000011
526 JGI25157J39369_1000291
527 JGI25157J39369_1000462
528 JGI25152J39213_1001180
529 JGI25152J39213_1003837
530 JGI25150J39212_1000064
531 JGI25150J39212_1005714
532 JGI25159J45721_1000015
533 JGI25159J45721_1000338
534 JGI25159J45721_1000726
535 JGI25151J46595_10000242
536 JGI25151J46595_10004532
537 JGI25151J46595_10012745
538 JGI25165J46597_1000553
539 JGI25153J46596_10003296
540 JGI25153J46596_10003865
541 JGI25153J46596_10011362
542 rootH1_10111201
543 JGI25160J50197_1000003
544 JGI25160J50197_1000012
545 JGI25160J50197_1001559
546 JGI25161J50226_1000002
547 JGI25161J50226_1000219
548 JGI25161J50226_1000229
549 Ga0055526_1002331
550 Ga0055526_1002479
551 Ga0055526_1003824
552 Ga0055524_1004511
553 Ga0055524_1005699
554 Ga0055524_1009609
555 Ga0055536_1001386
556 Ga0055528_1000863
557 Ga0055528_1001254
558 Ga0055528_1018261
559 Ga0055540_1000181
560 Ga0055540_1000797
561 Ga0055531_10004785
562 Ga0058692_1008487
563 Ga0055543_1000011
564 Ga0055543_1000034
565 Ga0055543_1000073
566 Ga0055543_1004645
567 Ga0065165_1000025
568 Ga0065165_1000082
569 Ga0065165_1010451
570 Ga0065165_1020171
571 Ga0070670_100000091
572 Ga0070669_100018163
573 Ga0070671_100014557
574 Ga0070667_100267097
575 Ga0070717_10052503
576 Ga0075365_10049604
577 Ga0075363_100074032
578 Ga0075363_100081842
579 Ga0075362_10005238
580 Ga0075369_10027895
581 Ga0075366_10003865
582 Ga0075370_10016713
583 Ga0099826_10013593
584 Ga0105240_10000024
585 Ga0105248_10064326
586 Ga0105237_10000538
587 Ga0123341_1009737
588 Ga0157370_10000180
589 Ga0171463_1001
590 Ga0182007_10003967
591 Ga0183363_1038
592 Ga0214543_1000040
593 Ga0209435_100065
594 Ga0209436_100113
595 Ga0209437_100050
596 Ga0207425_1000139
597 Ga0207425_1001129
598 Ga0207425_1007419
599 Ga0209646_1000195
600 Ga0209026_1000235
601 Ga0209759_1000268
602 Ga0209129_1000066
603 Ga0209129_1000223
604 Ga0209129_1001096
605 Ga0209129_1001420
606 Ga0209129_1001838
607 Ga0209233_1000037
608 Ga0209233_1000236
609 Ga0209673_1000024
610 Ga0209673_1000378
611 Ga0209673_1000906
612 Ga0209673_1000988
613 Ga0209673_1004761
614 Ga0209130_1000002
615 Ga0209130_1000005
616 Ga0209130_1000028
617 Ga0209130_1013302
618 Ga0209676_1003201
619 Ga0209676_1003487
620 Ga0209025_1000060
621 Ga0209025_1000105
622 Ga0209025_1000235
623 Ga0209025_1000557
624 Ga0209025_1000612
625 Ga0209025_1000866
626 Ga0209025_1012517
627 Ga0209564_1000113
628 Ga0209564_1000683
629 Ga0209564_1001075
630 Ga0209564_1016462
631 Ga0209758_1000495
632 Ga0209758_1000786
633 Ga0209758_1001165
634 Ga0209758_1001945
635 Ga0209758_1002238
636 Ga0209758_1003289
637 Ga0209050_1002738
638 Ga0209256_1000027
639 Ga0209256_1001273
640 Ga0209256_1001386
641 Ga0209256_1004283
642 Ga0209256_1008217
643 Ga0207426_1000012
644 Ga0207426_1000013
645 Ga0207426_1000015
646 Ga0207426_1000810
647 Ga0207426_1006434
648 Ga0209051_1000228
649 Ga0209051_1001114
650 Ga0209051_1002152
651 Ga0209051_1042764
652 Ga0209257_1001313
653 Ga0209257_1002062
654 Ga0209257_1016108
655 Ga0209257_1019025
656 Ga0209257_1038186
657 Ga0207695_10000036
658 Ga0207671_10000191
659 Ga0207681_10010465
660 Ga0207650_10000415
661 Ga0207644_10060162
662 Ga0207711_10176344
663 Ga0207711_10263646
664 Ga0209281_1000043
665 Ga0209371_1000009
666 Ga0209371_1004910
667 Ga0209282_1016796
668 Ga0268256_1000010
669 Ga0307510_10149307
670 Ga0373937_0000413
671 Ga0373925_0013602
672 Ga0439465_0005413
673 Ga0439465_0006237
674 Ga0451835_0649428
675 Ga0466968_0098417
676 Ga0466970_0013294
677 Ga0466957_0017782
678 Ga0451576_0198089
679 Ga0466958_0150628
680 Ga0495651_0134052
681 Ga0495605_0019717
682 Ga0495662_0032372
683 Ga0495585_0111235
684 Ga0495596_0020806
685 Ga0495607_0040235
686 Ga0495583_0045509
687 Ga0495606_0000995
688 Ga0495610_0046651
689 Ga0495628_0226465
690 Ga0495631_0005467
691 Ga0495643_0013263
692 Ga0495654_0000070
693 Ga0495668_0009086
694 Ga0495625_0008274
695 Ga0495625_0076861
696 Ga0495649_0009260
697 Ga0495604_0019348
698 Ga0495686_0000654
699 Ga0495626_0040755
700 Ga0496103_0019973
701 Ga0496106_0001485
702 Ga0496111_0000442
703 Ga0496113_0333963
704 Ga0496116_0021865
705 Ga0496116_0031137
706 Ga0496116_0033453
707 Ga0496116_0066895
708 Ga0496116_0096761
709 Ga0496116_0144404
710 Ga0496117_0000002
711 Ga0496117_0001890
712 Ga0496117_0004320
713 Ga0496117_0010644
714 Ga0496117_0020743
715 Ga0496117_0052800
716 Ga0496118_0001610
717 Ga0496118_0003649
718 Ga0496118_0049422
719 Ga0496118_0057912
720 Ga0496118_0066363
721 Ga0496119_0038052
722 Ga0496119_0096348
723 Ga0496120_0000034
724 Ga0496120_0060771
725 Ga0496120_0064667
726 Ga0496121_0000001
727 Ga0496121_0006036
728 Ga0496121_0010015
729 Ga0496121_0057006
730 Ga0496121_0128294
731 Ga0496122_0000001
732 Ga0496122_0000018
733 Ga0496122_0000309
734 Ga0496122_0003689
735 Ga0496122_0014328
736 Ga0496122_0025078
737 Ga0496122_0038743
738 Ga0496122_0057883
739 Ga0496122_0074354
740 Ga0496123_0000001
741 Ga0496123_0000015
742 Ga0496123_0002465
743 Ga0496123_0011919
744 Ga0496123_0019120
745 Ga0496123_0020091
746 Ga0496123_0051311
747 Ga0496123_0072533
748 Ga0496123_0083263
749 Ga0496124_0003452
750 Ga0496124_0003968
751 Ga0496124_0005732
752 Ga0496124_0008074
753 Ga0496124_0013636
754 Ga0496124_0023124
755 Ga0496124_0029989
756 Ga0496124_0081160
757 Ga0496124_0115170
758 Ga0496124_0132365
759 Ga0496125_0000001
760 Ga0496125_0005992
761 Ga0496125_0008218
762 Ga0496125_0008887
763 Ga0496125_0019126
764 Ga0496126_0002943
765 Ga0496126_0037953
766 Ga0496126_0070729
767 Ga0496126_0191750
768 Ga0501034_0233077
769 Ga0501036_0140545
770 Ga0501037_0086393
771 Ga0501047_0045036
772 Ga0501044_0178674
773 nmdc:mga03683_15784_c1
774 nmdc:mga00v17_26_c4
775 nmdc:mga00v17_3025_c1
776 Ga0495619_0122002
777 Ga0500557_001640
778 Ga0500569_003891
779 Ga0500572_001990
780 Ga0500618_000096
781 Ga0500618_000415
782 Ga0500658_0010073
783 Ga0500658_0010804
784 Ga0500568_0003620
785 Ga0500568_0004058
786 Ga0500590_000069
787 Ga0500616_0000170
788 Ga0500616_0000903
789 Ga0500622_0002923
790 Ga0500634_0010323
791 Ga0500636_0000069
792 Ga0500636_0065642
793 Ga0501082_0207818
794 Ga0466962_0063422
795 2509388880
796 2509444466
797 2510135790
798 2510897269
799 2511137149
800 2511194084
801 2513570955
802 2513574845
803 2513634091
804 2513707458
805 2513911081
806 2513924401
807 2514022224
808 2515114998
809 2515633886
810 2515641292
811 2515659702
812 2515741071
813 2516204717
814 2517409060
815 2520375833
816 2524458024
817 2530648238
818 2585223374
819 2585273598
820 2585281099
821 2585326317
822 2585330483
823 2585523830
824 2585533837
825 2585543381
826 2585546030
827 2585553430
828 2585559771
829 2585840799
830 2585843822
831 2585900459
832 2585906049
833 2585998585
834 2586003121
835 2587978836
836 2599419640
837 2599718886
838 2600197552
839 2600376663
840 2601609434
841 2601746209
842 2616293843
843 2616309453
844 2616556214
845 2617380588
846 2643805897
847 2644066073
848 2644380378
849 2644417404
850 2644450800
851 2644671573
852 2644692776
853 2671114000
854 2692317663
855 2719183455
856 2719388199
857 2719667821
858 2719734172
859 2720494241
860 2720615703
861 2720622488
862 2720633842
863 2720777542
864 2721149567
865 2721160970
866 2721166404
867 2721401834
868 2722842574
869 2723029141
870 2723562755
871 2723569449
872 2724040648
873 2724046928
874 2724092149
875 2724106714
876 2724112523
877 2725947578
878 2730110077
879 2730166690
880 2730300602
881 2738800898
882 2739038219
883 2766063277
884 2778173833
885 2792637700
886 2793296726
887 2793314102
888 2793322386
889 2793327683
890 2793336713
891 2793341155
892 2793349560
893 2793352590
894 2793358405
895 2793365447
896 2805928250
897 2805936578
898 2806046585
899 2806051335
900 2806059324
901 2806066703
902 2806073760
903 2819608741
904 2819640850
905 2819685911
906 2821123323
907 2838020697
908 2838026333
909 2838029632
910 2838039828
911 2838044746
912 2838053201
913 2838064595
914 2838070628
915 2838664110
916 2838674054
917 2838680134
918 2838695835
919 2838706506
920 2838709210
921 2838739653
922 2841844223
923 2841868997
924 2842079554
925 2842112627
926 2842120172
927 2842143944
928 2842151164
929 2842165640
930 2842196259
931 2842202094
932 2842209030
933 2842219296
934 2842238621
935 2842256220
936 2842268275
937 2842282280
938 2842286398
939 2842293215
940 2842299794
941 2842308988
942 2842312329
943 2842321925
944 2842344528
945 2842359684
946 2842367569
947 2842370596
948 2842379612
949 2842386683
950 2842397730
951 2842404049
952 2842410248
953 2842416896
954 2842424243
955 2842432247
956 2842438551
957 2842445181
958 2842453930
959 2842466418
960 2842473238
961 2842475938
962 2842486021
963 2842494710
964 2842499824
965 2842503160
966 2842513027
967 2847421357
968 2848996142
969 2852388052
970 2854900709
971 2854919594
972 2855877850
973 2857522072
974 2857533726
975 2891375343
976 2913298329
977 2919101746
978 2919172377
979 2919408458
980 2920822926
981 2929142239
982 2933018799
983 2933575432
984 2933588484
985 2933594295
986 2933601432
987 2935896355
988 2935902435
989 2936369396
990 2936380090
991 2936386206
992 2979104928
993 2984601884
994 2989351819
995 2996897716
996 3005410729
997 3005423156
998 3005450203
999 639646195
1000 643827848
1001 8005278405
1002 8005285366
1003 8005291529
1004 8005305591
1005 8005310365
1006 8005315483
1007 8005377905
1008 8005385200
1009 8005399721
1010 8005433280
1011 8005465695
1012 8005484609
1013 8005498218
1014 8005560098
1015 8005564403
1016 8005573963
1017 8005619428
1018 8005627994
1019 8005649302
1020 8005669627
1021 8005685461
1022 8005692656
1023 8005701343
1024 8018132674
1025 8018167476
1026 8018181961
1027 8023681158
1028 8024479817
1029 8024491740
1030 8024506442
1031 8046769629
1032 8054461091
1033 8054561120
1034 8056381059
1035 8056382575
1036 8056878757
1037 8057580332
1038 8057879072

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13484

Fer4_16

4Fe-4S double cluster binding domain

201

265

0.99

PF08331

QueG_DUF1730

Epoxyqueuosine reductase QueG, DUF1730

70

146

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8aw4-assembly1.cif.gz_B structure of a complex of biosynthetic proteins bb-e3 and bgfpd-yy 0.8409 284 382
5l4k-assembly1.cif.gz_N the human 26s proteasome lid 0.8045 310 383
5n3u-assembly1.cif.gz_A-2 the structure of the complex of cpce and cpcf of phycocyanin lyase from nostoc sp. pcc7120 0.7996 284 354
4lac-assembly1.cif.gz_A crystal structure of protein phosphatase 2a (pp2a) and pp2a phosphatase activator (ptpa) complex with atpgammas 0.7929 312 382
7z0f-assembly1.cif.gz_C cpap:s-tubulin:iih5 alpharep complex 0.7918 284 382
ID Description Score Start End Superfamily
af_Q2FX88_260_379_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.841 274 382 1.25.10.10
af_A0A1D6HPT4_75_193_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.7946 284 382 1.25.10.10
4jw3D00 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.7884 284 382 1.25.10.10
af_Q2FX88_260_379_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.7637 274 382 1.25.10.10
4jw2A00 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.7417 284 365 1.25.10.10
ID Description Score Start End GO Terms
AF-A0A526YKE1-F1-model_v4 tRNA epoxyqueuosine(34) reductase QueG 0.9827 284 365
AF-A0A4Q5PBG4-F1-model_v4 tRNA epoxyqueuosine(34) reductase QueG 0.9396 280 380 GO:0008033
GO:0008616
GO:0052693
AF-A0A836VFR8-F1-model_v4 DUF1730 domain-containing protein 0.9049 21 160 GO:0008033
GO:0008616
GO:0051539
GO:0052693
AF-A0A383AGR5-F1-model_v4 HEAT repeat domain-containing protein 0.8846 284 382 GO:0008033
GO:0008616
GO:0051539
GO:0052693
AF-A0A525IXR0-F1-model_v4 tRNA epoxyqueuosine(34) reductase QueG 0.8838 228 385 GO:0008033
GO:0008616
GO:0051539
GO:0052693

Map