F458277

General Info

Members Datasets Scaffolds Average Seq Length
518 180 1036 355

Family's Representative Sequence

Representative Sequence 3300035113|Ga0373936_0014154|Ga0373936_0014154_1064_2218
Length 384
Sequence VGRSSGSGSQFSGPARRNEQPRAEGSGLVRRLGVILVVAALAAPAAAHASGNPQIAGLQVALRAHGLYLAQIDGIAGPRTAAAVHAFQRRHHLPVGVADLRTRAALGPLGRPLFGSRTLRQGDFGWDVAVLQFLLVRRGVYDGALDGYMGKETGAALKRYQRAMHLHADAVVGPRTLTAIVRRDRVPIRARVPGSTGAPPVTYVVHEGDSLTAIARSHGTSVGAVATVNHLDVAKPIQIGQKLRLPAAAPGSLGAQSVDVRGVLDAWSTRLGVDPHLVRALAWMESGYQTSIRSPAGAVGVLQTLPTTRDYVETVLNGKPIPHTVNGDVEVGVLYLKHLLSVFNGDESLALAGWYQGERAVREHGVYAVSKPFVANVLALRARM

Samples

Sample ID Description Type Environment
1 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
46 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
47 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
73 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
74 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
75 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
76 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
77 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
78 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
79 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
80 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
81 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
82 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
83 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
84 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
85 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
86 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
94 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
95 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
96 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
97 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
98 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
99 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
100 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
101 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
102 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
103 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
104 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
105 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
106 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
107 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
108 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
109 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
110 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
111 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
112 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
113 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
114 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
115 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
116 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
117 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
118 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
119 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
120 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
121 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
122 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
123 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
124 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
125 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
126 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
127 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
128 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
129 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
130 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
131 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
132 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
133 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
134 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
135 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
136 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
137 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
138 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
139 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
140 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
143 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
144 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
145 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
146 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
147 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
148 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
149 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
150 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
167 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
168 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
169 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
170 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
173 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
174 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
175 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
176 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
177 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
178 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
179 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
180 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.23
Metatranscriptomes 0.77
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.2
Rhizosphere 88.42
Stem 0
Stem Tuber 0
Unclassified 8.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373936_0014154 3300035113 Bacteria 3048
2 Ga0070658_10026425 3300005327 Bacteria 4657
3 Ga0070658_10057663 3300005327 Bacteria 3159
4 Ga0070658_10241248 3300005327 Bacteria 1532
5 Ga0070658_10244036 3300005327 Unclassified 1523
6 Ga0070683_100061886 3300005329 Bacteria 3479
7 Ga0070683_100082241 3300005329 Bacteria 3015
8 Ga0070683_100090870 3300005329 Bacteria 2867
9 Ga0070683_100317988 3300005329 Unclassified 1481
10 Ga0070680_100037518 3300005336 Bacteria 3916
11 Ga0070680_100042553 3300005336 Bacteria 3686
12 Ga0070680_100061682 3300005336 Bacteria 3070
13 Ga0070680_100140120 3300005336 Bacteria 2028
14 Ga0070680_100179252 3300005336 Bacteria 1785
15 Ga0070680_100186185 3300005336 Unclassified 1749
16 Ga0070682_100017077 3300005337 Bacteria 4228
17 Ga0070660_100002028 3300005339 Bacteria 13962
18 Ga0070660_100006126 3300005339 Bacteria 8320
19 Ga0070660_100017495 3300005339 Bacteria 5227
20 Ga0070660_100063735 3300005339 Bacteria 2865
21 Ga0070660_100108568 3300005339 Bacteria 2206
22 Ga0070691_10040990 3300005341 Bacteria 2189
23 Ga0070661_100011983 3300005344 Bacteria 6057
24 Ga0070661_100026605 3300005344 Bacteria 4161
25 Ga0070661_100047549 3300005344 Bacteria 3140
26 Ga0070659_100126892 3300005366 Archaea 2070
27 Ga0070659_100202188 3300005366 Unclassified 1636
28 Ga0070709_10040844 3300005434 Bacteria 2854
29 Ga0070709_10126264 3300005434 Unclassified 1741
30 Ga0070714_100109241 3300005435 Bacteria 2446
31 Ga0070714_100152438 3300005435 Unclassified 2084
32 Ga0070714_100238908 3300005435 Bacteria 1676
33 Ga0070713_100031202 3300005436 Bacteria 4242
34 Ga0070713_100059015 3300005436 Bacteria 3202
35 Ga0070710_10067769 3300005437 Bacteria 2049
36 Ga0070711_100039707 3300005439 Bacteria 3171
37 Ga0070711_100258173 3300005439 Unclassified 1370
38 Ga0070708_100090810 3300005445 Bacteria 2781
39 Ga0070678_100221707 3300005456 Bacteria 1572
40 Ga0070681_10003527 3300005458 Bacteria 14658
41 Ga0070681_10006392 3300005458 Bacteria 11459
42 Ga0070681_10021602 3300005458 Bacteria 6452
43 Ga0070681_10060095 3300005458 Bacteria 3779
44 Ga0070681_10068974 3300005458 Bacteria 3503
45 Ga0070681_10107834 3300005458 Bacteria 2725
46 Ga0070681_10330266 3300005458 Bacteria 1434
47 Ga0070706_100052262 3300005467 Bacteria 3772
48 Ga0070707_100002886 3300005468 Bacteria 16352
49 Ga0070698_100142225 3300005471 Unclassified 2350
50 Ga0070679_100003305 3300005530 Bacteria 14763
51 Ga0070679_100087555 3300005530 Bacteria 3102
52 Ga0070679_100090161 3300005530 Bacteria 3054
53 Ga0070679_100100308 3300005530 Bacteria 2882
54 Ga0070679_100130182 3300005530 Bacteria 2497
55 Ga0070679_100257997 3300005530 Bacteria 1698
56 Ga0070684_100007913 3300005535 Bacteria 8294
57 Ga0070684_100018030 3300005535 Bacteria 5805
58 Ga0070684_100023249 3300005535 Bacteria 5180
59 Ga0070684_100072948 3300005535 Bacteria 3023
60 Ga0070684_100181400 3300005535 Archaea 1914
61 Ga0068853_100168314 3300005539 Unclassified 1982
62 Ga0068853_100191998 3300005539 Bacteria 1856
63 Ga0070695_100000042 3300005545 Bacteria 48840
64 Ga0070696_100031278 3300005546 Bacteria 3647
65 Ga0070696_100216981 3300005546 Unclassified 1434
66 Ga0068855_100005440 3300005563 Bacteria 15529
67 Ga0068855_100024596 3300005563 Bacteria 7204
68 Ga0068855_100070219 3300005563 Bacteria 4075
69 Ga0068855_100081024 3300005563 Bacteria 3763
70 Ga0068855_100105630 3300005563 Bacteria 3237
71 Ga0068855_100107418 3300005563 Bacteria 3206
72 Ga0068855_100207066 3300005563 Bacteria 2206
73 Ga0068856_100029889 3300005614 Bacteria 5325
74 Ga0068856_100232360 3300005614 Bacteria 1859
75 Ga0068856_100258504 3300005614 Bacteria 1757
76 Ga0068852_100007704 3300005616 Bacteria 7876
77 Ga0070717_10005123 3300006028 Bacteria 9558
78 Ga0070717_10006038 3300006028 Bacteria 8878
79 Ga0070717_10122360 3300006028 Bacteria 2230
80 Ga0070717_10260218 3300006028 Bacteria 1535
81 Ga0070715_10006525 3300006163 Bacteria 3973
82 Ga0070712_100022004 3300006175 Bacteria 4194
83 Ga0070712_100100513 3300006175 Bacteria 2137
84 Ga0097621_100191315 3300006237 Unclassified 1772
85 Ga0075435_100010341 3300007076 Bacteria 6821
86 Ga0105240_10082537 3300009093 Bacteria 3947
87 Ga0105240_10145505 3300009093 Bacteria 2828
88 Ga0105240_10170327 3300009093 Bacteria 2580
89 Ga0105240_10211345 3300009093 Bacteria 2267
90 Ga0105245_10217828 3300009098 Bacteria 1840
91 Ga0105242_10322160 3300009176 Unclassified 1418
92 Ga0105237_10008196 3300009545 Bacteria 11351
93 Ga0105237_10031338 3300009545 Bacteria 5392
94 Ga0105237_10373278 3300009545 Unclassified 1431
95 Ga0105238_10111953 3300009551 Bacteria 2709
96 Ga0105239_10149461 3300010375 Unclassified 2607
97 Ga0157370_10003420 3300013104 Bacteria 18639
98 Ga0157370_10028045 3300013104 Bacteria 5544
99 Ga0157370_10065872 3300013104 Bacteria 3427
100 Ga0157370_10144142 3300013104 Bacteria 2219
101 Ga0157370_10260716 3300013104 Bacteria 1602
102 Ga0157370_10398472 3300013104 Bacteria 1267
103 Ga0157369_10019204 3300013105 Bacteria 7649
104 Ga0157369_10102654 3300013105 Bacteria 3047
105 Ga0157369_10150272 3300013105 Bacteria 2462
106 Ga0157369_10332001 3300013105 Bacteria 1580
107 Ga0157369_10458406 3300013105 Bacteria 1320
108 Ga0157378_10510892 3300013297 Unclassified 1202
109 Ga0157372_10015541 3300013307 Bacteria 8157
110 Ga0157372_10240883 3300013307 Bacteria 2099
111 Ga0157372_10381442 3300013307 Bacteria 1642
112 Ga0157372_10417526 3300013307 Bacteria 1563
113 Ga0157375_10010295 3300013308 Bacteria 8229
114 Ga0182008_10051151 3300014497 Bacteria 2050
115 Ga0157377_10099031 3300014745 Bacteria 1734
116 Ga0206354_10070558 3300020081 Bacteria 2241
117 Ga0206354_10940914 3300020081 Unclassified 1308
118 Ga0206353_10360123 3300020082 Bacteria 5526
119 Ga0206353_10660535 3300020082 Bacteria 2971
120 Ga0207692_10005863 3300025898 Bacteria 4951
121 Ga0207692_10100160 3300025898 Unclassified 1588
122 Ga0207705_10021376 3300025909 Bacteria 4617
123 Ga0207705_10098361 3300025909 Bacteria 2150
124 Ga0207705_10109728 3300025909 Bacteria 2038
125 Ga0207705_10126563 3300025909 Bacteria 1899
126 Ga0207705_10223707 3300025909 Unclassified 1430
127 Ga0207705_10286149 3300025909 Unclassified 1262
128 Ga0207707_10011301 3300025912 Bacteria 7771
129 Ga0207707_10076985 3300025912 Bacteria 2911
130 Ga0207707_10237163 3300025912 Unclassified 1586
131 Ga0207695_10090971 3300025913 Bacteria 3066
132 Ga0207695_10149456 3300025913 Bacteria 2276
133 Ga0207671_10015509 3300025914 Bacteria 5960
134 Ga0207693_10000641 3300025915 Bacteria 31336
135 Ga0207693_10011938 3300025915 Bacteria 7022
136 Ga0207693_10037448 3300025915 Bacteria 3823
137 Ga0207663_10003801 3300025916 Bacteria 7452
138 Ga0207663_10081345 3300025916 Unclassified 2121
139 Ga0207660_10012560 3300025917 Bacteria 5546
140 Ga0207660_10035678 3300025917 Bacteria 3454
141 Ga0207660_10065184 3300025917 Bacteria 2631
142 Ga0207660_10149519 3300025917 Unclassified 1793
143 Ga0207657_10000467 3300025919 Bacteria 42840
144 Ga0207657_10000955 3300025919 Bacteria 30552
145 Ga0207657_10002911 3300025919 Bacteria 18375
146 Ga0207657_10004917 3300025919 Bacteria 14052
147 Ga0207657_10016461 3300025919 Bacteria 7131
148 Ga0207657_10047220 3300025919 Bacteria 3767
149 Ga0207657_10142222 3300025919 Bacteria 1960
150 Ga0207652_10046836 3300025921 Bacteria 3692
151 Ga0207652_10054871 3300025921 Bacteria 3426
152 Ga0207652_10077525 3300025921 Bacteria 2900
153 Ga0207652_10077751 3300025921 Bacteria 2896
154 Ga0207652_10078534 3300025921 Bacteria 2882
155 Ga0207646_10019122 3300025922 Bacteria 6370
156 Ga0207646_10158486 3300025922 Unclassified 2042
157 Ga0207694_10119580 3300025924 Bacteria 2102
158 Ga0207687_10048422 3300025927 Bacteria 2951
159 Ga0207700_10102133 3300025928 Bacteria 2289
160 Ga0207700_10122432 3300025928 Bacteria 2111
161 Ga0207700_10261088 3300025928 Unclassified 1483
162 Ga0207664_10048167 3300025929 Unclassified 3351
163 Ga0207664_10145753 3300025929 Unclassified 2007
164 Ga0207664_10158822 3300025929 Bacteria 1927
165 Ga0207664_10190932 3300025929 Archaea 1763
166 Ga0207686_10197434 3300025934 Unclassified 1439
167 Ga0207709_10157418 3300025935 Bacteria 1580
168 Ga0207665_10014623 3300025939 Bacteria 5166
169 Ga0207665_10047389 3300025939 Bacteria 2882
170 Ga0207661_10048955 3300025944 Bacteria 3362
171 Ga0207661_10072913 3300025944 Bacteria 2810
172 Ga0207661_10099685 3300025944 Bacteria 2437
173 Ga0207679_10091657 3300025945 Bacteria 2352
174 Ga0207667_10044902 3300025949 Bacteria 4681
175 Ga0207667_10095140 3300025949 Bacteria 3075
176 Ga0207667_10132621 3300025949 Bacteria 2566
177 Ga0207702_10062292 3300026078 Unclassified 3185
178 Ga0207702_10086857 3300026078 Bacteria 2729
179 Ga0207702_10172709 3300026078 Bacteria 1983
180 Ga0207698_10433695 3300026142 Unclassified 1264
181 Ga0265318_10032061 3300028577 Bacteria 2035
182 Ga0265338_10004355 3300028800 Bacteria 19163
183 Ga0265338_10072410 3300028800 Bacteria 2942
184 Ga0265338_10139240 3300028800 Bacteria 1903
185 Ga0265324_10017960 3300029957 Unclassified 2568
186 Ga0265327_10029272 3300031251 Bacteria 3135
187 Ga0265327_10098266 3300031251 Unclassified 1416
188 Ga0265314_10018445 3300031711 Bacteria 5439
189 Ga0373926_0020872 3300035083 Bacteria 2265
190 Ga0373944_0002819 3300035089 Bacteria 4449
191 Ga0373944_0012218 3300035089 Bacteria 2364
192 Ga0373936_0000709 3300035113 Bacteria 11615
193 Ga0373945_0075269 3300035116 Bacteria 1285
194 Ga0373943_0001472 3300035170 Bacteria 10662
195 Ga0373943_0006130 3300035170 Bacteria 5403
196 Ga0373943_0007210 3300035170 Bacteria 4990
197 Ga0373946_0000349 3300035171 Bacteria 14955
198 Ga0373946_0027139 3300035171 Bacteria 2263
199 Ga0373955_0051195 3300035172 Bacteria 2249
200 Ga0373935_0022630 3300035692 Bacteria 3856
201 Ga0373935_0050798 3300035692 Bacteria 2632
202 Ga0373927_0020339 3300035695 Bacteria 4353
203 Ga0373947_0000798 3300035725 Bacteria 18982
204 Ga0373947_0001443 3300035725 Bacteria 14620
205 Ga0373937_0007692 3300036401 Bacteria 9341
206 Ga0373925_0005687 3300037068 Bacteria 9268
207 Ga0373925_0020936 3300037068 Bacteria 4766
208 Ga0395900_0146864 3300037418 Bacteria 2411
209 Ga0395900_0428023 3300037418 Unclassified 1283
210 Ga0395898_0004508 3300037466 Bacteria 15219
211 Ga0395898_0016045 3300037466 Bacteria 7672
212 Ga0395898_0049965 3300037466 Bacteria 4095
213 Ga0395898_0142575 3300037466 Bacteria 2294
214 Ga0395898_0173272 3300037466 Bacteria 2062
215 Ga0395905_0201846 3300037471 Bacteria 1864
216 Ga0436364_0752779 3300037853 Bacteria 3551
217 Ga0395901_0050833 3300038443 Bacteria 4306
218 Ga0395901_0149065 3300038443 Bacteria 2458
219 Ga0395901_0155831 3300038443 Bacteria 2399
220 Ga0395901_0274552 3300038443 Bacteria 1753
221 Ga0395901_0411588 3300038443 Bacteria 1388
222 Ga0436363_1241766 3300039450 Bacteria 2016
223 Ga0466969_0000426 3300044656 Bacteria 23045
224 Ga0466965_0041392 3300044683 Bacteria 2270
225 Ga0466966_0002767 3300044684 Bacteria 11526
226 Ga0466966_0064358 3300044684 Archaea 2309
227 Ga0466966_0064818 3300044684 Bacteria 2299
228 Ga0466966_0065810 3300044684 Bacteria 2278
229 Ga0466966_0073583 3300044684 Bacteria 2136
230 Ga0466961_0008571 3300044693 Bacteria 6515
231 Ga0466961_0016622 3300044693 Bacteria 4732
232 Ga0466961_0094657 3300044693 Bacteria 1884
233 Ga0466961_0108869 3300044693 Unclassified 1744
234 Ga0466961_0156257 3300044693 Bacteria 1423
235 Ga0466961_0175353 3300044693 Bacteria 1332
236 Ga0466963_0000389 3300044694 Bacteria 20047
237 Ga0466963_0001233 3300044694 Bacteria 13510
238 Ga0466963_0003689 3300044694 Bacteria 8813
239 Ga0466963_0005847 3300044694 Bacteria 7245
240 Ga0466963_0010737 3300044694 Bacteria 5558
241 Ga0466963_0012429 3300044694 Bacteria 5211
242 Ga0466963_0015554 3300044694 Bacteria 4714
243 Ga0466963_0018221 3300044694 Bacteria 4386
244 Ga0466963_0024604 3300044694 Bacteria 3833
245 Ga0466963_0037295 3300044694 Bacteria 3172
246 Ga0466963_0050366 3300044694 Bacteria 2756
247 Ga0466963_0057037 3300044694 Bacteria 2600
248 Ga0466963_0077084 3300044694 Bacteria 2252
249 Ga0466963_0222301 3300044694 Bacteria 1322
250 Ga0466964_0004354 3300044706 Bacteria 5219
251 Ga0466964_0009396 3300044706 Bacteria 3680
252 Ga0466964_0025488 3300044706 Bacteria 2309
253 Ga0466964_0025953 3300044706 Bacteria 2290
254 Ga0466971_0001205 3300044719 Bacteria 10750
255 Ga0466971_0001930 3300044719 Bacteria 8797
256 Ga0466971_0026927 3300044719 Bacteria 2573
257 Ga0466971_0040071 3300044719 Bacteria 2103
258 Ga0466971_0042793 3300044719 Bacteria 2035
259 Ga0466971_0073286 3300044719 Archaea 1556
260 Ga0466968_0001920 3300044735 Bacteria 7517
261 Ga0466968_0019216 3300044735 Unclassified 2749
262 Ga0466968_0039686 3300044735 Bacteria 1982
263 Ga0466968_0065033 3300044735 Bacteria 1578
264 Ga0466968_0087680 3300044735 Bacteria 1375
265 Ga0466957_0002552 3300044842 Bacteria 9798
266 Ga0466957_0004904 3300044842 Bacteria 7490
267 Ga0466957_0019520 3300044842 Bacteria 3986
268 Ga0466957_0021553 3300044842 Bacteria 3798
269 Ga0466957_0024586 3300044842 Bacteria 3565
270 Ga0466957_0062102 3300044842 Bacteria 2294
271 Ga0466957_0062141 3300044842 Bacteria 2293
272 Ga0466957_0073722 3300044842 Bacteria 2116
273 Ga0466957_0131765 3300044842 Bacteria 1602
274 Ga0466960_0033916 3300044901 Bacteria 2375
275 Ga0466959_0000804 3300045049 Bacteria 18495
276 Ga0466959_0003865 3300045049 Bacteria 9938
277 Ga0466959_0012385 3300045049 Bacteria 6161
278 Ga0466959_0016607 3300045049 Bacteria 5383
279 Ga0466959_0028261 3300045049 Bacteria 4158
280 Ga0466959_0036913 3300045049 Bacteria 3610
281 Ga0466958_0000599 3300045836 Bacteria 15371
282 Ga0466958_0000739 3300045836 Bacteria 14300
283 Ga0466958_0002801 3300045836 Bacteria 8876
284 Ga0466958_0002846 3300045836 Bacteria 8807
285 Ga0466958_0006586 3300045836 Bacteria 6333
286 Ga0466958_0026749 3300045836 Bacteria 3411
287 Ga0466958_0030800 3300045836 Bacteria 3188
288 Ga0466958_0031038 3300045836 Bacteria 3176
289 Ga0466958_0050442 3300045836 Bacteria 2519
290 Ga0466958_0167142 3300045836 Bacteria 1392
291 Ga0466967_0000058 3300045976 Bacteria 40166
292 Ga0466967_0002773 3300045976 Bacteria 11095
293 Ga0466967_0007096 3300045976 Bacteria 8034
294 Ga0466967_0009351 3300045976 Bacteria 7267
295 Ga0466967_0011173 3300045976 Bacteria 6784
296 Ga0466967_0016475 3300045976 Bacteria 5831
297 Ga0466967_0018678 3300045976 Bacteria 5550
298 Ga0466967_0034251 3300045976 Bacteria 4309
299 Ga0466967_0039457 3300045976 Bacteria 4060
300 Ga0466967_0040738 3300045976 Bacteria 4000
301 Ga0466967_0073272 3300045976 Unclassified 3072
302 Ga0466967_0081490 3300045976 Bacteria 2923
303 Ga0466967_0091479 3300045976 Bacteria 2765
304 Ga0466967_0095416 3300045976 Bacteria 2710
305 Ga0466967_0116012 3300045976 Bacteria 2466
306 Ga0466967_0124613 3300045976 Unclassified 2385
307 Ga0466967_0137597 3300045976 Bacteria 2272
308 Ga0466967_0140055 3300045976 Bacteria 2252
309 Ga0466967_0152318 3300045976 Bacteria 2162
310 Ga0466967_0156225 3300045976 Bacteria 2137
311 Ga0466967_0192144 3300045976 Unclassified 1930
312 Ga0466967_0195710 3300045976 Bacteria 1912
313 Ga0466967_0197771 3300045976 Bacteria 1902
314 Ga0466967_0284883 3300045976 Bacteria 1586
315 Ga0466967_0322873 3300045976 Unclassified 1489
316 Ga0466967_0397973 3300045976 Bacteria 1339
317 Ga0495592_0000660 3300046454 Bacteria 23996
318 Ga0495592_0086293 3300046454 Bacteria 2261
319 Ga0495629_0010186 3300046459 Bacteria 6850
320 Ga0495641_0067557 3300046461 Unclassified 1608
321 Ga0495651_0000034 3300046462 Bacteria 99213
322 Ga0495651_0005402 3300046462 Bacteria 9750
323 Ga0495651_0029901 3300046462 Bacteria 4247
324 Ga0495653_0005998 3300046463 Bacteria 9949
325 Ga0495653_0030750 3300046463 Bacteria 4273
326 Ga0495653_0048694 3300046463 Bacteria 3270
327 Ga0495653_0073523 3300046463 Bacteria 2550
328 Ga0495580_0005080 3300046472 Bacteria 10961
329 Ga0495582_0000240 3300046473 Bacteria 30558
330 Ga0495582_0011744 3300046473 Bacteria 4827
331 Ga0495582_0041228 3300046473 Bacteria 2544
332 Ga0495639_0004163 3300046475 Bacteria 6201
333 Ga0495662_0007404 3300046476 Bacteria 5423
334 Ga0495664_0003164 3300046477 Bacteria 8937
335 Ga0495664_0035282 3300046477 Bacteria 2944
336 Ga0495664_0038550 3300046477 Bacteria 2821
337 Ga0495584_0024625 3300046491 Bacteria 3052
338 Ga0495608_0009189 3300046511 Bacteria 6911
339 Ga0495608_0012515 3300046511 Bacteria 5886
340 Ga0495608_0043680 3300046511 Bacteria 2994
341 Ga0495618_0003698 3300046514 Bacteria 9481
342 Ga0495618_0023350 3300046514 Bacteria 3823
343 Ga0495618_0023392 3300046514 Bacteria 3820
344 Ga0495618_0073558 3300046514 Bacteria 2176
345 Ga0495618_0166504 3300046514 Unclassified 1404
346 Ga0495628_0000184 3300046516 Bacteria 54832
347 Ga0495630_0018163 3300046517 Bacteria 5164
348 Ga0495630_0061650 3300046517 Bacteria 2816
349 Ga0495630_0062721 3300046517 Bacteria 2792
350 Ga0495630_0075860 3300046517 Bacteria 2532
351 Ga0495630_0093439 3300046517 Bacteria 2273
352 Ga0495666_0000713 3300046526 Bacteria 15149
353 Ga0495652_0000319 3300046529 Bacteria 56845
354 Ga0495652_0064783 3300046529 Bacteria 3073
355 Ga0495652_0066653 3300046529 Bacteria 3020
356 Ga0495652_0099012 3300046529 Bacteria 2368
357 Ga0495652_0102585 3300046529 Bacteria 2317
358 Ga0495652_0109292 3300046529 Bacteria 2226
359 Ga0495652_0169053 3300046529 Bacteria 1689
360 Ga0495652_0368399 3300046529 Bacteria 1025
361 Ga0495665_0006461 3300046531 Bacteria 6330
362 Ga0495665_0048671 3300046531 Bacteria 2247
363 Ga0495665_0062701 3300046531 Bacteria 1963
364 Ga0495640_0001210 3300046533 Bacteria 20182
365 Ga0495640_0038191 3300046533 Bacteria 3378
366 Ga0495640_0046656 3300046533 Bacteria 3000
367 Ga0495587_0004503 3300046536 Bacteria 9165
368 Ga0495587_0040308 3300046536 Bacteria 2792
369 Ga0495587_0090546 3300046536 Bacteria 1767
370 Ga0495645_0000646 3300046543 Bacteria 24016
371 Ga0495645_0036150 3300046543 Bacteria 3601
372 Ga0495645_0050338 3300046543 Bacteria 3033
373 Ga0495645_0118035 3300046543 Bacteria 1871
374 Ga0495645_0150612 3300046543 Bacteria 1616
375 Ga0495667_0008504 3300046559 Bacteria 6966
376 Ga0495667_0043539 3300046559 Bacteria 2974
377 Ga0495667_0057550 3300046559 Bacteria 2555
378 Ga0495667_0063124 3300046559 Bacteria 2426
379 Ga0495634_0036506 3300046642 Bacteria 3361
380 Ga0495634_0118799 3300046642 Bacteria 1694
381 Ga0495635_0031700 3300046663 Bacteria 3668
382 Ga0495635_0043874 3300046663 Bacteria 3085
383 Ga0495635_0076756 3300046663 Bacteria 2289
384 Ga0495635_0087231 3300046663 Bacteria 2135
385 Ga0495657_0053305 3300046675 Bacteria 2707
386 Ga0495657_0068779 3300046675 Bacteria 2319
387 Ga0495657_0073935 3300046675 Bacteria 2218
388 Ga0495599_0000227 3300046678 Bacteria 35652
389 Ga0495623_0000601 3300046679 Bacteria 23980
390 Ga0495646_0002007 3300046680 Bacteria 12316
391 Ga0495646_0085456 3300046680 Bacteria 1831
392 Ga0495658_0000553 3300046683 Bacteria 20442
393 Ga0495658_0002644 3300046683 Bacteria 9002
394 Ga0495613_0004334 3300046689 Bacteria 10627
395 Ga0495613_0103420 3300046689 Bacteria 2056
396 Ga0495613_0107418 3300046689 Bacteria 2013
397 Ga0495624_0001309 3300046690 Bacteria 19540
398 Ga0495624_0023559 3300046690 Bacteria 4060
399 Ga0495600_0030876 3300046809 Bacteria 3470
400 Ga0495600_0059983 3300046809 Bacteria 2484
401 Ga0495581_0002313 3300047315 Bacteria 10737
402 Ga0495581_0006461 3300047315 Bacteria 6803
403 Ga0495581_0041604 3300047315 Bacteria 2660
404 Ga0495604_0000194 3300047317 Bacteria 54877
405 Ga0495604_0033633 3300047317 Bacteria 4057
406 Ga0495674_0001271 3300047319 Bacteria 24493
407 Ga0495674_0065059 3300047319 Bacteria 3168
408 Ga0495674_0070534 3300047319 Bacteria 3019
409 Ga0495676_0000116 3300047321 Bacteria 61181
410 Ga0495676_0018066 3300047321 Bacteria 6221
411 Ga0495676_0060029 3300047321 Bacteria 2983
412 Ga0495680_0001616 3300047322 Bacteria 23967
413 Ga0495680_0005719 3300047322 Bacteria 11643
414 Ga0495680_0007777 3300047322 Bacteria 9790
415 Ga0495680_0078025 3300047322 Bacteria 2507
416 Ga0495680_0078446 3300047322 Bacteria 2499
417 Ga0495675_0000224 3300047444 Bacteria 40977
418 Ga0495675_0097359 3300047444 Bacteria 1844
419 Ga0495684_0001289 3300047471 Bacteria 20130
420 Ga0495684_0011609 3300047471 Bacteria 6801
421 Ga0495684_0026271 3300047471 Bacteria 4473
422 Ga0495593_0001212 3300047673 Bacteria 15080
423 Ga0495593_0002914 3300047673 Bacteria 10305
424 Ga0495602_0001529 3300048088 Bacteria 23007
425 Ga0495602_0164789 3300048088 Archaea 1726
426 Ga0495614_0003570 3300048089 Bacteria 6970
427 Ga0495614_0004174 3300048089 Bacteria 6507
428 Ga0496100_0002232 3300048903 Bacteria 9785
429 Ga0496100_0003049 3300048903 Bacteria 8650
430 Ga0496100_0024374 3300048903 Bacteria 3690
431 Ga0496100_0054878 3300048903 Unclassified 2601
432 Ga0496101_0001684 3300048904 Bacteria 13245
433 Ga0496101_0222352 3300048904 Bacteria 1465
434 Ga0496101_0234029 3300048904 Bacteria 1429
435 Ga0496102_0010430 3300048905 Bacteria 7991
436 Ga0496102_0034465 3300048905 Bacteria 4553
437 Ga0496102_0039115 3300048905 Bacteria 4284
438 Ga0496102_0044042 3300048905 Bacteria 4049
439 Ga0496103_0007355 3300048906 Bacteria 6566
440 Ga0496103_0049297 3300048906 Unclassified 2604
441 Ga0496103_0050518 3300048906 Bacteria 2572
442 Ga0496103_0109076 3300048906 Unclassified 1757
443 Ga0496104_0021635 3300048907 Bacteria 5906
444 Ga0496104_0029914 3300048907 Bacteria 5057
445 Ga0496104_0134592 3300048907 Bacteria 2374
446 Ga0496105_0001600 3300048908 Bacteria 16035
447 Ga0496105_0021838 3300048908 Bacteria 5181
448 Ga0496105_0059364 3300048908 Bacteria 3156
449 Ga0496105_0086980 3300048908 Bacteria 2583
450 Ga0496105_0099115 3300048908 Bacteria 2406
451 Ga0496106_0030949 3300048909 Bacteria 3989
452 Ga0496106_0043988 3300048909 Bacteria 3352
453 Ga0496106_0044007 3300048909 Bacteria 3351
454 Ga0496106_0074918 3300048909 Bacteria 2592
455 Ga0496107_0001643 3300048910 Bacteria 13948
456 Ga0496107_0027340 3300048910 Bacteria 4050
457 Ga0496107_0047745 3300048910 Bacteria 3083
458 Ga0496107_0054021 3300048910 Bacteria 2898
459 Ga0496107_0297704 3300048910 Bacteria 1201
460 Ga0496108_0086558 3300048911 Bacteria 2660
461 Ga0496108_0137977 3300048911 Bacteria 2100
462 Ga0496109_0020547 3300048912 Bacteria 5832
463 Ga0496109_0126980 3300048912 Bacteria 2378
464 Ga0496110_0002333 3300048913 Bacteria 14192
465 Ga0496110_0059576 3300048913 Bacteria 3366
466 Ga0496111_0006852 3300048914 Bacteria 7435
467 Ga0496111_0016481 3300048914 Bacteria 5092
468 Ga0496111_0089962 3300048914 Bacteria 2248
469 Ga0496111_0142725 3300048914 Archaea 1775
470 Ga0496112_0002503 3300048915 Bacteria 14824
471 Ga0496112_0028642 3300048915 Bacteria 5378
472 Ga0496114_0015969 3300048917 Bacteria 6042
473 Ga0496114_0029478 3300048917 Bacteria 4511
474 Ga0496114_0044886 3300048917 Bacteria 3669
475 Ga0496114_0063633 3300048917 Bacteria 3088
476 Ga0496114_0079786 3300048917 Bacteria 2763
477 Ga0496114_0095251 3300048917 Bacteria 2533
478 Ga0496114_0095610 3300048917 Bacteria 2528
479 Ga0496115_0000431 3300048918 Bacteria 33991
480 Ga0496115_0001960 3300048918 Bacteria 14690
481 Ga0496115_0011103 3300048918 Bacteria 6750
482 Ga0496115_0078365 3300048918 Bacteria 2688
483 Ga0496115_0141480 3300048918 Bacteria 1985
484 Ga0496115_0190929 3300048918 Bacteria 1692
485 Ga0496115_0206791 3300048918 Unclassified 1621
486 Ga0501034_0068905 3300049571 Bacteria 3548
487 Ga0501047_0136501 3300049581 Bacteria 2333
488 Ga0501067_0019520 3300049583 Bacteria 3754
489 Ga0501067_0062039 3300049583 Bacteria 2069
490 Ga0501070_0001687 3300049586 Bacteria 19581
491 Ga0501070_0020136 3300049586 Bacteria 5596
492 Ga0501070_0030335 3300049586 Bacteria 4530
493 Ga0501070_0156012 3300049586 Bacteria 1882
494 Ga0501072_0000771 3300049588 Bacteria 23377
495 Ga0501073_0107017 3300049589 Bacteria 1940
496 Ga0501074_0025466 3300049590 Bacteria 4297
497 Ga0501080_0005810 3300049742 Bacteria 11045
498 Ga0501083_0002221 3300049744 Bacteria 13267
499 nmdc:mga0n895_35395_c1 3300050512 Bacteria 4814
500 nmdc:mga0rr50_2179_c1 3300050513 Bacteria 10969
501 Ga0495601_0002650 3300053077 Bacteria 10149
502 Ga0495601_0011962 3300053077 Bacteria 5202
503 Ga0495601_0016415 3300053077 Bacteria 4486
504 Ga0495601_0021168 3300053077 Bacteria 3980
505 Ga0495601_0056438 3300053077 Bacteria 2487
506 Ga0495601_0104613 3300053077 Bacteria 1830
507 Ga0495612_0018370 3300053078 Bacteria 2800
508 Ga0495655_0024144 3300053083 Unclassified 1409
509 Ga0495595_0011444 3300053084 Bacteria 3709
510 Ga0495595_0031092 3300053084 Bacteria 2398
511 Ga0495619_0000370 3300053085 Bacteria 30945
512 Ga0495619_0001120 3300053085 Bacteria 17601
513 Ga0495619_0021157 3300053085 Bacteria 4151
514 Ga0466962_0000178 3300061719 Bacteria 26342
515 Ga0466962_0014521 3300061719 Bacteria 3796
516 Ga0466962_0028798 3300061719 Bacteria 2660
517 Ga0466962_0029679 3300061719 Bacteria 2618
518 Ga0466962_0064058 3300061719 Bacteria 1755
519 Ga0373936_0014154
520 Ga0070658_10026425
521 Ga0070658_10057663
522 Ga0070658_10241248
523 Ga0070658_10244036
524 Ga0070683_100061886
525 Ga0070683_100082241
526 Ga0070683_100090870
527 Ga0070683_100317988
528 Ga0070680_100037518
529 Ga0070680_100042553
530 Ga0070680_100061682
531 Ga0070680_100140120
532 Ga0070680_100179252
533 Ga0070680_100186185
534 Ga0070682_100017077
535 Ga0070660_100002028
536 Ga0070660_100006126
537 Ga0070660_100017495
538 Ga0070660_100063735
539 Ga0070660_100108568
540 Ga0070691_10040990
541 Ga0070661_100011983
542 Ga0070661_100026605
543 Ga0070661_100047549
544 Ga0070659_100126892
545 Ga0070659_100202188
546 Ga0070709_10040844
547 Ga0070709_10126264
548 Ga0070714_100109241
549 Ga0070714_100152438
550 Ga0070714_100238908
551 Ga0070713_100031202
552 Ga0070713_100059015
553 Ga0070710_10067769
554 Ga0070711_100039707
555 Ga0070711_100258173
556 Ga0070708_100090810
557 Ga0070678_100221707
558 Ga0070681_10003527
559 Ga0070681_10006392
560 Ga0070681_10021602
561 Ga0070681_10060095
562 Ga0070681_10068974
563 Ga0070681_10107834
564 Ga0070681_10330266
565 Ga0070706_100052262
566 Ga0070707_100002886
567 Ga0070698_100142225
568 Ga0070679_100003305
569 Ga0070679_100087555
570 Ga0070679_100090161
571 Ga0070679_100100308
572 Ga0070679_100130182
573 Ga0070679_100257997
574 Ga0070684_100007913
575 Ga0070684_100018030
576 Ga0070684_100023249
577 Ga0070684_100072948
578 Ga0070684_100181400
579 Ga0068853_100168314
580 Ga0068853_100191998
581 Ga0070695_100000042
582 Ga0070696_100031278
583 Ga0070696_100216981
584 Ga0068855_100005440
585 Ga0068855_100024596
586 Ga0068855_100070219
587 Ga0068855_100081024
588 Ga0068855_100105630
589 Ga0068855_100107418
590 Ga0068855_100207066
591 Ga0068856_100029889
592 Ga0068856_100232360
593 Ga0068856_100258504
594 Ga0068852_100007704
595 Ga0070717_10005123
596 Ga0070717_10006038
597 Ga0070717_10122360
598 Ga0070717_10260218
599 Ga0070715_10006525
600 Ga0070712_100022004
601 Ga0070712_100100513
602 Ga0097621_100191315
603 Ga0075435_100010341
604 Ga0105240_10082537
605 Ga0105240_10145505
606 Ga0105240_10170327
607 Ga0105240_10211345
608 Ga0105245_10217828
609 Ga0105242_10322160
610 Ga0105237_10008196
611 Ga0105237_10031338
612 Ga0105237_10373278
613 Ga0105238_10111953
614 Ga0105239_10149461
615 Ga0157370_10003420
616 Ga0157370_10028045
617 Ga0157370_10065872
618 Ga0157370_10144142
619 Ga0157370_10260716
620 Ga0157370_10398472
621 Ga0157369_10019204
622 Ga0157369_10102654
623 Ga0157369_10150272
624 Ga0157369_10332001
625 Ga0157369_10458406
626 Ga0157378_10510892
627 Ga0157372_10015541
628 Ga0157372_10240883
629 Ga0157372_10381442
630 Ga0157372_10417526
631 Ga0157375_10010295
632 Ga0182008_10051151
633 Ga0157377_10099031
634 Ga0206354_10070558
635 Ga0206354_10940914
636 Ga0206353_10360123
637 Ga0206353_10660535
638 Ga0207692_10005863
639 Ga0207692_10100160
640 Ga0207705_10021376
641 Ga0207705_10098361
642 Ga0207705_10109728
643 Ga0207705_10126563
644 Ga0207705_10223707
645 Ga0207705_10286149
646 Ga0207707_10011301
647 Ga0207707_10076985
648 Ga0207707_10237163
649 Ga0207695_10090971
650 Ga0207695_10149456
651 Ga0207671_10015509
652 Ga0207693_10000641
653 Ga0207693_10011938
654 Ga0207693_10037448
655 Ga0207663_10003801
656 Ga0207663_10081345
657 Ga0207660_10012560
658 Ga0207660_10035678
659 Ga0207660_10065184
660 Ga0207660_10149519
661 Ga0207657_10000467
662 Ga0207657_10000955
663 Ga0207657_10002911
664 Ga0207657_10004917
665 Ga0207657_10016461
666 Ga0207657_10047220
667 Ga0207657_10142222
668 Ga0207652_10046836
669 Ga0207652_10054871
670 Ga0207652_10077525
671 Ga0207652_10077751
672 Ga0207652_10078534
673 Ga0207646_10019122
674 Ga0207646_10158486
675 Ga0207694_10119580
676 Ga0207687_10048422
677 Ga0207700_10102133
678 Ga0207700_10122432
679 Ga0207700_10261088
680 Ga0207664_10048167
681 Ga0207664_10145753
682 Ga0207664_10158822
683 Ga0207664_10190932
684 Ga0207686_10197434
685 Ga0207709_10157418
686 Ga0207665_10014623
687 Ga0207665_10047389
688 Ga0207661_10048955
689 Ga0207661_10072913
690 Ga0207661_10099685
691 Ga0207679_10091657
692 Ga0207667_10044902
693 Ga0207667_10095140
694 Ga0207667_10132621
695 Ga0207702_10062292
696 Ga0207702_10086857
697 Ga0207702_10172709
698 Ga0207698_10433695
699 Ga0265318_10032061
700 Ga0265338_10004355
701 Ga0265338_10072410
702 Ga0265338_10139240
703 Ga0265324_10017960
704 Ga0265327_10029272
705 Ga0265327_10098266
706 Ga0265314_10018445
707 Ga0373926_0020872
708 Ga0373944_0002819
709 Ga0373944_0012218
710 Ga0373936_0000709
711 Ga0373945_0075269
712 Ga0373943_0001472
713 Ga0373943_0006130
714 Ga0373943_0007210
715 Ga0373946_0000349
716 Ga0373946_0027139
717 Ga0373955_0051195
718 Ga0373935_0022630
719 Ga0373935_0050798
720 Ga0373927_0020339
721 Ga0373947_0000798
722 Ga0373947_0001443
723 Ga0373937_0007692
724 Ga0373925_0005687
725 Ga0373925_0020936
726 Ga0395900_0146864
727 Ga0395900_0428023
728 Ga0395898_0004508
729 Ga0395898_0016045
730 Ga0395898_0049965
731 Ga0395898_0142575
732 Ga0395898_0173272
733 Ga0395905_0201846
734 Ga0436364_0752779
735 Ga0395901_0050833
736 Ga0395901_0149065
737 Ga0395901_0155831
738 Ga0395901_0274552
739 Ga0395901_0411588
740 Ga0436363_1241766
741 Ga0466969_0000426
742 Ga0466965_0041392
743 Ga0466966_0002767
744 Ga0466966_0064358
745 Ga0466966_0064818
746 Ga0466966_0065810
747 Ga0466966_0073583
748 Ga0466961_0008571
749 Ga0466961_0016622
750 Ga0466961_0094657
751 Ga0466961_0108869
752 Ga0466961_0156257
753 Ga0466961_0175353
754 Ga0466963_0000389
755 Ga0466963_0001233
756 Ga0466963_0003689
757 Ga0466963_0005847
758 Ga0466963_0010737
759 Ga0466963_0012429
760 Ga0466963_0015554
761 Ga0466963_0018221
762 Ga0466963_0024604
763 Ga0466963_0037295
764 Ga0466963_0050366
765 Ga0466963_0057037
766 Ga0466963_0077084
767 Ga0466963_0222301
768 Ga0466964_0004354
769 Ga0466964_0009396
770 Ga0466964_0025488
771 Ga0466964_0025953
772 Ga0466971_0001205
773 Ga0466971_0001930
774 Ga0466971_0026927
775 Ga0466971_0040071
776 Ga0466971_0042793
777 Ga0466971_0073286
778 Ga0466968_0001920
779 Ga0466968_0019216
780 Ga0466968_0039686
781 Ga0466968_0065033
782 Ga0466968_0087680
783 Ga0466957_0002552
784 Ga0466957_0004904
785 Ga0466957_0019520
786 Ga0466957_0021553
787 Ga0466957_0024586
788 Ga0466957_0062102
789 Ga0466957_0062141
790 Ga0466957_0073722
791 Ga0466957_0131765
792 Ga0466960_0033916
793 Ga0466959_0000804
794 Ga0466959_0003865
795 Ga0466959_0012385
796 Ga0466959_0016607
797 Ga0466959_0028261
798 Ga0466959_0036913
799 Ga0466958_0000599
800 Ga0466958_0000739
801 Ga0466958_0002801
802 Ga0466958_0002846
803 Ga0466958_0006586
804 Ga0466958_0026749
805 Ga0466958_0030800
806 Ga0466958_0031038
807 Ga0466958_0050442
808 Ga0466958_0167142
809 Ga0466967_0000058
810 Ga0466967_0002773
811 Ga0466967_0007096
812 Ga0466967_0009351
813 Ga0466967_0011173
814 Ga0466967_0016475
815 Ga0466967_0018678
816 Ga0466967_0034251
817 Ga0466967_0039457
818 Ga0466967_0040738
819 Ga0466967_0073272
820 Ga0466967_0081490
821 Ga0466967_0091479
822 Ga0466967_0095416
823 Ga0466967_0116012
824 Ga0466967_0124613
825 Ga0466967_0137597
826 Ga0466967_0140055
827 Ga0466967_0152318
828 Ga0466967_0156225
829 Ga0466967_0192144
830 Ga0466967_0195710
831 Ga0466967_0197771
832 Ga0466967_0284883
833 Ga0466967_0322873
834 Ga0466967_0397973
835 Ga0495592_0000660
836 Ga0495592_0086293
837 Ga0495629_0010186
838 Ga0495641_0067557
839 Ga0495651_0000034
840 Ga0495651_0005402
841 Ga0495651_0029901
842 Ga0495653_0005998
843 Ga0495653_0030750
844 Ga0495653_0048694
845 Ga0495653_0073523
846 Ga0495580_0005080
847 Ga0495582_0000240
848 Ga0495582_0011744
849 Ga0495582_0041228
850 Ga0495639_0004163
851 Ga0495662_0007404
852 Ga0495664_0003164
853 Ga0495664_0035282
854 Ga0495664_0038550
855 Ga0495584_0024625
856 Ga0495608_0009189
857 Ga0495608_0012515
858 Ga0495608_0043680
859 Ga0495618_0003698
860 Ga0495618_0023350
861 Ga0495618_0023392
862 Ga0495618_0073558
863 Ga0495618_0166504
864 Ga0495628_0000184
865 Ga0495630_0018163
866 Ga0495630_0061650
867 Ga0495630_0062721
868 Ga0495630_0075860
869 Ga0495630_0093439
870 Ga0495666_0000713
871 Ga0495652_0000319
872 Ga0495652_0064783
873 Ga0495652_0066653
874 Ga0495652_0099012
875 Ga0495652_0102585
876 Ga0495652_0109292
877 Ga0495652_0169053
878 Ga0495652_0368399
879 Ga0495665_0006461
880 Ga0495665_0048671
881 Ga0495665_0062701
882 Ga0495640_0001210
883 Ga0495640_0038191
884 Ga0495640_0046656
885 Ga0495587_0004503
886 Ga0495587_0040308
887 Ga0495587_0090546
888 Ga0495645_0000646
889 Ga0495645_0036150
890 Ga0495645_0050338
891 Ga0495645_0118035
892 Ga0495645_0150612
893 Ga0495667_0008504
894 Ga0495667_0043539
895 Ga0495667_0057550
896 Ga0495667_0063124
897 Ga0495634_0036506
898 Ga0495634_0118799
899 Ga0495635_0031700
900 Ga0495635_0043874
901 Ga0495635_0076756
902 Ga0495635_0087231
903 Ga0495657_0053305
904 Ga0495657_0068779
905 Ga0495657_0073935
906 Ga0495599_0000227
907 Ga0495623_0000601
908 Ga0495646_0002007
909 Ga0495646_0085456
910 Ga0495658_0000553
911 Ga0495658_0002644
912 Ga0495613_0004334
913 Ga0495613_0103420
914 Ga0495613_0107418
915 Ga0495624_0001309
916 Ga0495624_0023559
917 Ga0495600_0030876
918 Ga0495600_0059983
919 Ga0495581_0002313
920 Ga0495581_0006461
921 Ga0495581_0041604
922 Ga0495604_0000194
923 Ga0495604_0033633
924 Ga0495674_0001271
925 Ga0495674_0065059
926 Ga0495674_0070534
927 Ga0495676_0000116
928 Ga0495676_0018066
929 Ga0495676_0060029
930 Ga0495680_0001616
931 Ga0495680_0005719
932 Ga0495680_0007777
933 Ga0495680_0078025
934 Ga0495680_0078446
935 Ga0495675_0000224
936 Ga0495675_0097359
937 Ga0495684_0001289
938 Ga0495684_0011609
939 Ga0495684_0026271
940 Ga0495593_0001212
941 Ga0495593_0002914
942 Ga0495602_0001529
943 Ga0495602_0164789
944 Ga0495614_0003570
945 Ga0495614_0004174
946 Ga0496100_0002232
947 Ga0496100_0003049
948 Ga0496100_0024374
949 Ga0496100_0054878
950 Ga0496101_0001684
951 Ga0496101_0222352
952 Ga0496101_0234029
953 Ga0496102_0010430
954 Ga0496102_0034465
955 Ga0496102_0039115
956 Ga0496102_0044042
957 Ga0496103_0007355
958 Ga0496103_0049297
959 Ga0496103_0050518
960 Ga0496103_0109076
961 Ga0496104_0021635
962 Ga0496104_0029914
963 Ga0496104_0134592
964 Ga0496105_0001600
965 Ga0496105_0021838
966 Ga0496105_0059364
967 Ga0496105_0086980
968 Ga0496105_0099115
969 Ga0496106_0030949
970 Ga0496106_0043988
971 Ga0496106_0044007
972 Ga0496106_0074918
973 Ga0496107_0001643
974 Ga0496107_0027340
975 Ga0496107_0047745
976 Ga0496107_0054021
977 Ga0496107_0297704
978 Ga0496108_0086558
979 Ga0496108_0137977
980 Ga0496109_0020547
981 Ga0496109_0126980
982 Ga0496110_0002333
983 Ga0496110_0059576
984 Ga0496111_0006852
985 Ga0496111_0016481
986 Ga0496111_0089962
987 Ga0496111_0142725
988 Ga0496112_0002503
989 Ga0496112_0028642
990 Ga0496114_0015969
991 Ga0496114_0029478
992 Ga0496114_0044886
993 Ga0496114_0063633
994 Ga0496114_0079786
995 Ga0496114_0095251
996 Ga0496114_0095610
997 Ga0496115_0000431
998 Ga0496115_0001960
999 Ga0496115_0011103
1000 Ga0496115_0078365
1001 Ga0496115_0141480
1002 Ga0496115_0190929
1003 Ga0496115_0206791
1004 Ga0501034_0068905
1005 Ga0501047_0136501
1006 Ga0501067_0019520
1007 Ga0501067_0062039
1008 Ga0501070_0001687
1009 Ga0501070_0020136
1010 Ga0501070_0030335
1011 Ga0501070_0156012
1012 Ga0501072_0000771
1013 Ga0501073_0107017
1014 Ga0501074_0025466
1015 Ga0501080_0005810
1016 Ga0501083_0002221
1017 nmdc:mga0n895_35395_c1
1018 nmdc:mga0rr50_2179_c1
1019 Ga0495601_0002650
1020 Ga0495601_0011962
1021 Ga0495601_0016415
1022 Ga0495601_0021168
1023 Ga0495601_0056438
1024 Ga0495601_0104613
1025 Ga0495612_0018370
1026 Ga0495655_0024144
1027 Ga0495595_0011444
1028 Ga0495595_0031092
1029 Ga0495619_0000370
1030 Ga0495619_0001120
1031 Ga0495619_0021157
1032 Ga0466962_0000178
1033 Ga0466962_0014521
1034 Ga0466962_0028798
1035 Ga0466962_0029679
1036 Ga0466962_0064058

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01476

LysM

LysM domain

203

246

0.99

PF01471

PG_binding_1

Putative peptidoglycan binding domain

125

180

0.97

PF01471

PG_binding_1

Putative peptidoglycan binding domain

51

106

0.95

PF01464

SLT

Transglycosylase SLT domain

262

374

0.91

Map