F458277
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 518 | 180 | 1036 | 355 |
Family's Representative Sequence
| Representative Sequence | 3300035113|Ga0373936_0014154|Ga0373936_0014154_1064_2218 |
| Length | 384 |
| Sequence | VGRSSGSGSQFSGPARRNEQPRAEGSGLVRRLGVILVVAALAAPAAAHASGNPQIAGLQVALRAHGLYLAQIDGIAGPRTAAAVHAFQRRHHLPVGVADLRTRAALGPLGRPLFGSRTLRQGDFGWDVAVLQFLLVRRGVYDGALDGYMGKETGAALKRYQRAMHLHADAVVGPRTLTAIVRRDRVPIRARVPGSTGAPPVTYVVHEGDSLTAIARSHGTSVGAVATVNHLDVAKPIQIGQKLRLPAAAPGSLGAQSVDVRGVLDAWSTRLGVDPHLVRALAWMESGYQTSIRSPAGAVGVLQTLPTTRDYVETVLNGKPIPHTVNGDVEVGVLYLKHLLSVFNGDESLALAGWYQGERAVREHGVYAVSKPFVANVLALRARM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 24 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 27 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 28 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 29 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 34 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 46 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 48 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 49 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 73 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 74 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 75 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 76 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 77 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 78 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 79 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 80 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 81 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 82 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 83 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 84 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 85 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 86 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 87 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 88 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 89 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 90 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 91 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 92 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 93 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 94 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 95 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 96 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 97 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 98 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 99 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 100 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 101 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 102 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 103 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 104 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 105 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 106 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 107 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 150 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 151 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 152 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 153 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 154 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 155 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 156 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 157 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 158 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 159 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 160 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 161 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 162 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 163 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 164 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.23 |
| Metatranscriptomes | 0.77 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 11.2 |
| Rhizosphere | 88.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.69 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373936_0014154 | 3300035113 | Bacteria | 3048 |
| 2 | Ga0070658_10026425 | 3300005327 | Bacteria | 4657 |
| 3 | Ga0070658_10057663 | 3300005327 | Bacteria | 3159 |
| 4 | Ga0070658_10241248 | 3300005327 | Bacteria | 1532 |
| 5 | Ga0070658_10244036 | 3300005327 | Unclassified | 1523 |
| 6 | Ga0070683_100061886 | 3300005329 | Bacteria | 3479 |
| 7 | Ga0070683_100082241 | 3300005329 | Bacteria | 3015 |
| 8 | Ga0070683_100090870 | 3300005329 | Bacteria | 2867 |
| 9 | Ga0070683_100317988 | 3300005329 | Unclassified | 1481 |
| 10 | Ga0070680_100037518 | 3300005336 | Bacteria | 3916 |
| 11 | Ga0070680_100042553 | 3300005336 | Bacteria | 3686 |
| 12 | Ga0070680_100061682 | 3300005336 | Bacteria | 3070 |
| 13 | Ga0070680_100140120 | 3300005336 | Bacteria | 2028 |
| 14 | Ga0070680_100179252 | 3300005336 | Bacteria | 1785 |
| 15 | Ga0070680_100186185 | 3300005336 | Unclassified | 1749 |
| 16 | Ga0070682_100017077 | 3300005337 | Bacteria | 4228 |
| 17 | Ga0070660_100002028 | 3300005339 | Bacteria | 13962 |
| 18 | Ga0070660_100006126 | 3300005339 | Bacteria | 8320 |
| 19 | Ga0070660_100017495 | 3300005339 | Bacteria | 5227 |
| 20 | Ga0070660_100063735 | 3300005339 | Bacteria | 2865 |
| 21 | Ga0070660_100108568 | 3300005339 | Bacteria | 2206 |
| 22 | Ga0070691_10040990 | 3300005341 | Bacteria | 2189 |
| 23 | Ga0070661_100011983 | 3300005344 | Bacteria | 6057 |
| 24 | Ga0070661_100026605 | 3300005344 | Bacteria | 4161 |
| 25 | Ga0070661_100047549 | 3300005344 | Bacteria | 3140 |
| 26 | Ga0070659_100126892 | 3300005366 | Archaea | 2070 |
| 27 | Ga0070659_100202188 | 3300005366 | Unclassified | 1636 |
| 28 | Ga0070709_10040844 | 3300005434 | Bacteria | 2854 |
| 29 | Ga0070709_10126264 | 3300005434 | Unclassified | 1741 |
| 30 | Ga0070714_100109241 | 3300005435 | Bacteria | 2446 |
| 31 | Ga0070714_100152438 | 3300005435 | Unclassified | 2084 |
| 32 | Ga0070714_100238908 | 3300005435 | Bacteria | 1676 |
| 33 | Ga0070713_100031202 | 3300005436 | Bacteria | 4242 |
| 34 | Ga0070713_100059015 | 3300005436 | Bacteria | 3202 |
| 35 | Ga0070710_10067769 | 3300005437 | Bacteria | 2049 |
| 36 | Ga0070711_100039707 | 3300005439 | Bacteria | 3171 |
| 37 | Ga0070711_100258173 | 3300005439 | Unclassified | 1370 |
| 38 | Ga0070708_100090810 | 3300005445 | Bacteria | 2781 |
| 39 | Ga0070678_100221707 | 3300005456 | Bacteria | 1572 |
| 40 | Ga0070681_10003527 | 3300005458 | Bacteria | 14658 |
| 41 | Ga0070681_10006392 | 3300005458 | Bacteria | 11459 |
| 42 | Ga0070681_10021602 | 3300005458 | Bacteria | 6452 |
| 43 | Ga0070681_10060095 | 3300005458 | Bacteria | 3779 |
| 44 | Ga0070681_10068974 | 3300005458 | Bacteria | 3503 |
| 45 | Ga0070681_10107834 | 3300005458 | Bacteria | 2725 |
| 46 | Ga0070681_10330266 | 3300005458 | Bacteria | 1434 |
| 47 | Ga0070706_100052262 | 3300005467 | Bacteria | 3772 |
| 48 | Ga0070707_100002886 | 3300005468 | Bacteria | 16352 |
| 49 | Ga0070698_100142225 | 3300005471 | Unclassified | 2350 |
| 50 | Ga0070679_100003305 | 3300005530 | Bacteria | 14763 |
| 51 | Ga0070679_100087555 | 3300005530 | Bacteria | 3102 |
| 52 | Ga0070679_100090161 | 3300005530 | Bacteria | 3054 |
| 53 | Ga0070679_100100308 | 3300005530 | Bacteria | 2882 |
| 54 | Ga0070679_100130182 | 3300005530 | Bacteria | 2497 |
| 55 | Ga0070679_100257997 | 3300005530 | Bacteria | 1698 |
| 56 | Ga0070684_100007913 | 3300005535 | Bacteria | 8294 |
| 57 | Ga0070684_100018030 | 3300005535 | Bacteria | 5805 |
| 58 | Ga0070684_100023249 | 3300005535 | Bacteria | 5180 |
| 59 | Ga0070684_100072948 | 3300005535 | Bacteria | 3023 |
| 60 | Ga0070684_100181400 | 3300005535 | Archaea | 1914 |
| 61 | Ga0068853_100168314 | 3300005539 | Unclassified | 1982 |
| 62 | Ga0068853_100191998 | 3300005539 | Bacteria | 1856 |
| 63 | Ga0070695_100000042 | 3300005545 | Bacteria | 48840 |
| 64 | Ga0070696_100031278 | 3300005546 | Bacteria | 3647 |
| 65 | Ga0070696_100216981 | 3300005546 | Unclassified | 1434 |
| 66 | Ga0068855_100005440 | 3300005563 | Bacteria | 15529 |
| 67 | Ga0068855_100024596 | 3300005563 | Bacteria | 7204 |
| 68 | Ga0068855_100070219 | 3300005563 | Bacteria | 4075 |
| 69 | Ga0068855_100081024 | 3300005563 | Bacteria | 3763 |
| 70 | Ga0068855_100105630 | 3300005563 | Bacteria | 3237 |
| 71 | Ga0068855_100107418 | 3300005563 | Bacteria | 3206 |
| 72 | Ga0068855_100207066 | 3300005563 | Bacteria | 2206 |
| 73 | Ga0068856_100029889 | 3300005614 | Bacteria | 5325 |
| 74 | Ga0068856_100232360 | 3300005614 | Bacteria | 1859 |
| 75 | Ga0068856_100258504 | 3300005614 | Bacteria | 1757 |
| 76 | Ga0068852_100007704 | 3300005616 | Bacteria | 7876 |
| 77 | Ga0070717_10005123 | 3300006028 | Bacteria | 9558 |
| 78 | Ga0070717_10006038 | 3300006028 | Bacteria | 8878 |
| 79 | Ga0070717_10122360 | 3300006028 | Bacteria | 2230 |
| 80 | Ga0070717_10260218 | 3300006028 | Bacteria | 1535 |
| 81 | Ga0070715_10006525 | 3300006163 | Bacteria | 3973 |
| 82 | Ga0070712_100022004 | 3300006175 | Bacteria | 4194 |
| 83 | Ga0070712_100100513 | 3300006175 | Bacteria | 2137 |
| 84 | Ga0097621_100191315 | 3300006237 | Unclassified | 1772 |
| 85 | Ga0075435_100010341 | 3300007076 | Bacteria | 6821 |
| 86 | Ga0105240_10082537 | 3300009093 | Bacteria | 3947 |
| 87 | Ga0105240_10145505 | 3300009093 | Bacteria | 2828 |
| 88 | Ga0105240_10170327 | 3300009093 | Bacteria | 2580 |
| 89 | Ga0105240_10211345 | 3300009093 | Bacteria | 2267 |
| 90 | Ga0105245_10217828 | 3300009098 | Bacteria | 1840 |
| 91 | Ga0105242_10322160 | 3300009176 | Unclassified | 1418 |
| 92 | Ga0105237_10008196 | 3300009545 | Bacteria | 11351 |
| 93 | Ga0105237_10031338 | 3300009545 | Bacteria | 5392 |
| 94 | Ga0105237_10373278 | 3300009545 | Unclassified | 1431 |
| 95 | Ga0105238_10111953 | 3300009551 | Bacteria | 2709 |
| 96 | Ga0105239_10149461 | 3300010375 | Unclassified | 2607 |
| 97 | Ga0157370_10003420 | 3300013104 | Bacteria | 18639 |
| 98 | Ga0157370_10028045 | 3300013104 | Bacteria | 5544 |
| 99 | Ga0157370_10065872 | 3300013104 | Bacteria | 3427 |
| 100 | Ga0157370_10144142 | 3300013104 | Bacteria | 2219 |
| 101 | Ga0157370_10260716 | 3300013104 | Bacteria | 1602 |
| 102 | Ga0157370_10398472 | 3300013104 | Bacteria | 1267 |
| 103 | Ga0157369_10019204 | 3300013105 | Bacteria | 7649 |
| 104 | Ga0157369_10102654 | 3300013105 | Bacteria | 3047 |
| 105 | Ga0157369_10150272 | 3300013105 | Bacteria | 2462 |
| 106 | Ga0157369_10332001 | 3300013105 | Bacteria | 1580 |
| 107 | Ga0157369_10458406 | 3300013105 | Bacteria | 1320 |
| 108 | Ga0157378_10510892 | 3300013297 | Unclassified | 1202 |
| 109 | Ga0157372_10015541 | 3300013307 | Bacteria | 8157 |
| 110 | Ga0157372_10240883 | 3300013307 | Bacteria | 2099 |
| 111 | Ga0157372_10381442 | 3300013307 | Bacteria | 1642 |
| 112 | Ga0157372_10417526 | 3300013307 | Bacteria | 1563 |
| 113 | Ga0157375_10010295 | 3300013308 | Bacteria | 8229 |
| 114 | Ga0182008_10051151 | 3300014497 | Bacteria | 2050 |
| 115 | Ga0157377_10099031 | 3300014745 | Bacteria | 1734 |
| 116 | Ga0206354_10070558 | 3300020081 | Bacteria | 2241 |
| 117 | Ga0206354_10940914 | 3300020081 | Unclassified | 1308 |
| 118 | Ga0206353_10360123 | 3300020082 | Bacteria | 5526 |
| 119 | Ga0206353_10660535 | 3300020082 | Bacteria | 2971 |
| 120 | Ga0207692_10005863 | 3300025898 | Bacteria | 4951 |
| 121 | Ga0207692_10100160 | 3300025898 | Unclassified | 1588 |
| 122 | Ga0207705_10021376 | 3300025909 | Bacteria | 4617 |
| 123 | Ga0207705_10098361 | 3300025909 | Bacteria | 2150 |
| 124 | Ga0207705_10109728 | 3300025909 | Bacteria | 2038 |
| 125 | Ga0207705_10126563 | 3300025909 | Bacteria | 1899 |
| 126 | Ga0207705_10223707 | 3300025909 | Unclassified | 1430 |
| 127 | Ga0207705_10286149 | 3300025909 | Unclassified | 1262 |
| 128 | Ga0207707_10011301 | 3300025912 | Bacteria | 7771 |
| 129 | Ga0207707_10076985 | 3300025912 | Bacteria | 2911 |
| 130 | Ga0207707_10237163 | 3300025912 | Unclassified | 1586 |
| 131 | Ga0207695_10090971 | 3300025913 | Bacteria | 3066 |
| 132 | Ga0207695_10149456 | 3300025913 | Bacteria | 2276 |
| 133 | Ga0207671_10015509 | 3300025914 | Bacteria | 5960 |
| 134 | Ga0207693_10000641 | 3300025915 | Bacteria | 31336 |
| 135 | Ga0207693_10011938 | 3300025915 | Bacteria | 7022 |
| 136 | Ga0207693_10037448 | 3300025915 | Bacteria | 3823 |
| 137 | Ga0207663_10003801 | 3300025916 | Bacteria | 7452 |
| 138 | Ga0207663_10081345 | 3300025916 | Unclassified | 2121 |
| 139 | Ga0207660_10012560 | 3300025917 | Bacteria | 5546 |
| 140 | Ga0207660_10035678 | 3300025917 | Bacteria | 3454 |
| 141 | Ga0207660_10065184 | 3300025917 | Bacteria | 2631 |
| 142 | Ga0207660_10149519 | 3300025917 | Unclassified | 1793 |
| 143 | Ga0207657_10000467 | 3300025919 | Bacteria | 42840 |
| 144 | Ga0207657_10000955 | 3300025919 | Bacteria | 30552 |
| 145 | Ga0207657_10002911 | 3300025919 | Bacteria | 18375 |
| 146 | Ga0207657_10004917 | 3300025919 | Bacteria | 14052 |
| 147 | Ga0207657_10016461 | 3300025919 | Bacteria | 7131 |
| 148 | Ga0207657_10047220 | 3300025919 | Bacteria | 3767 |
| 149 | Ga0207657_10142222 | 3300025919 | Bacteria | 1960 |
| 150 | Ga0207652_10046836 | 3300025921 | Bacteria | 3692 |
| 151 | Ga0207652_10054871 | 3300025921 | Bacteria | 3426 |
| 152 | Ga0207652_10077525 | 3300025921 | Bacteria | 2900 |
| 153 | Ga0207652_10077751 | 3300025921 | Bacteria | 2896 |
| 154 | Ga0207652_10078534 | 3300025921 | Bacteria | 2882 |
| 155 | Ga0207646_10019122 | 3300025922 | Bacteria | 6370 |
| 156 | Ga0207646_10158486 | 3300025922 | Unclassified | 2042 |
| 157 | Ga0207694_10119580 | 3300025924 | Bacteria | 2102 |
| 158 | Ga0207687_10048422 | 3300025927 | Bacteria | 2951 |
| 159 | Ga0207700_10102133 | 3300025928 | Bacteria | 2289 |
| 160 | Ga0207700_10122432 | 3300025928 | Bacteria | 2111 |
| 161 | Ga0207700_10261088 | 3300025928 | Unclassified | 1483 |
| 162 | Ga0207664_10048167 | 3300025929 | Unclassified | 3351 |
| 163 | Ga0207664_10145753 | 3300025929 | Unclassified | 2007 |
| 164 | Ga0207664_10158822 | 3300025929 | Bacteria | 1927 |
| 165 | Ga0207664_10190932 | 3300025929 | Archaea | 1763 |
| 166 | Ga0207686_10197434 | 3300025934 | Unclassified | 1439 |
| 167 | Ga0207709_10157418 | 3300025935 | Bacteria | 1580 |
| 168 | Ga0207665_10014623 | 3300025939 | Bacteria | 5166 |
| 169 | Ga0207665_10047389 | 3300025939 | Bacteria | 2882 |
| 170 | Ga0207661_10048955 | 3300025944 | Bacteria | 3362 |
| 171 | Ga0207661_10072913 | 3300025944 | Bacteria | 2810 |
| 172 | Ga0207661_10099685 | 3300025944 | Bacteria | 2437 |
| 173 | Ga0207679_10091657 | 3300025945 | Bacteria | 2352 |
| 174 | Ga0207667_10044902 | 3300025949 | Bacteria | 4681 |
| 175 | Ga0207667_10095140 | 3300025949 | Bacteria | 3075 |
| 176 | Ga0207667_10132621 | 3300025949 | Bacteria | 2566 |
| 177 | Ga0207702_10062292 | 3300026078 | Unclassified | 3185 |
| 178 | Ga0207702_10086857 | 3300026078 | Bacteria | 2729 |
| 179 | Ga0207702_10172709 | 3300026078 | Bacteria | 1983 |
| 180 | Ga0207698_10433695 | 3300026142 | Unclassified | 1264 |
| 181 | Ga0265318_10032061 | 3300028577 | Bacteria | 2035 |
| 182 | Ga0265338_10004355 | 3300028800 | Bacteria | 19163 |
| 183 | Ga0265338_10072410 | 3300028800 | Bacteria | 2942 |
| 184 | Ga0265338_10139240 | 3300028800 | Bacteria | 1903 |
| 185 | Ga0265324_10017960 | 3300029957 | Unclassified | 2568 |
| 186 | Ga0265327_10029272 | 3300031251 | Bacteria | 3135 |
| 187 | Ga0265327_10098266 | 3300031251 | Unclassified | 1416 |
| 188 | Ga0265314_10018445 | 3300031711 | Bacteria | 5439 |
| 189 | Ga0373926_0020872 | 3300035083 | Bacteria | 2265 |
| 190 | Ga0373944_0002819 | 3300035089 | Bacteria | 4449 |
| 191 | Ga0373944_0012218 | 3300035089 | Bacteria | 2364 |
| 192 | Ga0373936_0000709 | 3300035113 | Bacteria | 11615 |
| 193 | Ga0373945_0075269 | 3300035116 | Bacteria | 1285 |
| 194 | Ga0373943_0001472 | 3300035170 | Bacteria | 10662 |
| 195 | Ga0373943_0006130 | 3300035170 | Bacteria | 5403 |
| 196 | Ga0373943_0007210 | 3300035170 | Bacteria | 4990 |
| 197 | Ga0373946_0000349 | 3300035171 | Bacteria | 14955 |
| 198 | Ga0373946_0027139 | 3300035171 | Bacteria | 2263 |
| 199 | Ga0373955_0051195 | 3300035172 | Bacteria | 2249 |
| 200 | Ga0373935_0022630 | 3300035692 | Bacteria | 3856 |
| 201 | Ga0373935_0050798 | 3300035692 | Bacteria | 2632 |
| 202 | Ga0373927_0020339 | 3300035695 | Bacteria | 4353 |
| 203 | Ga0373947_0000798 | 3300035725 | Bacteria | 18982 |
| 204 | Ga0373947_0001443 | 3300035725 | Bacteria | 14620 |
| 205 | Ga0373937_0007692 | 3300036401 | Bacteria | 9341 |
| 206 | Ga0373925_0005687 | 3300037068 | Bacteria | 9268 |
| 207 | Ga0373925_0020936 | 3300037068 | Bacteria | 4766 |
| 208 | Ga0395900_0146864 | 3300037418 | Bacteria | 2411 |
| 209 | Ga0395900_0428023 | 3300037418 | Unclassified | 1283 |
| 210 | Ga0395898_0004508 | 3300037466 | Bacteria | 15219 |
| 211 | Ga0395898_0016045 | 3300037466 | Bacteria | 7672 |
| 212 | Ga0395898_0049965 | 3300037466 | Bacteria | 4095 |
| 213 | Ga0395898_0142575 | 3300037466 | Bacteria | 2294 |
| 214 | Ga0395898_0173272 | 3300037466 | Bacteria | 2062 |
| 215 | Ga0395905_0201846 | 3300037471 | Bacteria | 1864 |
| 216 | Ga0436364_0752779 | 3300037853 | Bacteria | 3551 |
| 217 | Ga0395901_0050833 | 3300038443 | Bacteria | 4306 |
| 218 | Ga0395901_0149065 | 3300038443 | Bacteria | 2458 |
| 219 | Ga0395901_0155831 | 3300038443 | Bacteria | 2399 |
| 220 | Ga0395901_0274552 | 3300038443 | Bacteria | 1753 |
| 221 | Ga0395901_0411588 | 3300038443 | Bacteria | 1388 |
| 222 | Ga0436363_1241766 | 3300039450 | Bacteria | 2016 |
| 223 | Ga0466969_0000426 | 3300044656 | Bacteria | 23045 |
| 224 | Ga0466965_0041392 | 3300044683 | Bacteria | 2270 |
| 225 | Ga0466966_0002767 | 3300044684 | Bacteria | 11526 |
| 226 | Ga0466966_0064358 | 3300044684 | Archaea | 2309 |
| 227 | Ga0466966_0064818 | 3300044684 | Bacteria | 2299 |
| 228 | Ga0466966_0065810 | 3300044684 | Bacteria | 2278 |
| 229 | Ga0466966_0073583 | 3300044684 | Bacteria | 2136 |
| 230 | Ga0466961_0008571 | 3300044693 | Bacteria | 6515 |
| 231 | Ga0466961_0016622 | 3300044693 | Bacteria | 4732 |
| 232 | Ga0466961_0094657 | 3300044693 | Bacteria | 1884 |
| 233 | Ga0466961_0108869 | 3300044693 | Unclassified | 1744 |
| 234 | Ga0466961_0156257 | 3300044693 | Bacteria | 1423 |
| 235 | Ga0466961_0175353 | 3300044693 | Bacteria | 1332 |
| 236 | Ga0466963_0000389 | 3300044694 | Bacteria | 20047 |
| 237 | Ga0466963_0001233 | 3300044694 | Bacteria | 13510 |
| 238 | Ga0466963_0003689 | 3300044694 | Bacteria | 8813 |
| 239 | Ga0466963_0005847 | 3300044694 | Bacteria | 7245 |
| 240 | Ga0466963_0010737 | 3300044694 | Bacteria | 5558 |
| 241 | Ga0466963_0012429 | 3300044694 | Bacteria | 5211 |
| 242 | Ga0466963_0015554 | 3300044694 | Bacteria | 4714 |
| 243 | Ga0466963_0018221 | 3300044694 | Bacteria | 4386 |
| 244 | Ga0466963_0024604 | 3300044694 | Bacteria | 3833 |
| 245 | Ga0466963_0037295 | 3300044694 | Bacteria | 3172 |
| 246 | Ga0466963_0050366 | 3300044694 | Bacteria | 2756 |
| 247 | Ga0466963_0057037 | 3300044694 | Bacteria | 2600 |
| 248 | Ga0466963_0077084 | 3300044694 | Bacteria | 2252 |
| 249 | Ga0466963_0222301 | 3300044694 | Bacteria | 1322 |
| 250 | Ga0466964_0004354 | 3300044706 | Bacteria | 5219 |
| 251 | Ga0466964_0009396 | 3300044706 | Bacteria | 3680 |
| 252 | Ga0466964_0025488 | 3300044706 | Bacteria | 2309 |
| 253 | Ga0466964_0025953 | 3300044706 | Bacteria | 2290 |
| 254 | Ga0466971_0001205 | 3300044719 | Bacteria | 10750 |
| 255 | Ga0466971_0001930 | 3300044719 | Bacteria | 8797 |
| 256 | Ga0466971_0026927 | 3300044719 | Bacteria | 2573 |
| 257 | Ga0466971_0040071 | 3300044719 | Bacteria | 2103 |
| 258 | Ga0466971_0042793 | 3300044719 | Bacteria | 2035 |
| 259 | Ga0466971_0073286 | 3300044719 | Archaea | 1556 |
| 260 | Ga0466968_0001920 | 3300044735 | Bacteria | 7517 |
| 261 | Ga0466968_0019216 | 3300044735 | Unclassified | 2749 |
| 262 | Ga0466968_0039686 | 3300044735 | Bacteria | 1982 |
| 263 | Ga0466968_0065033 | 3300044735 | Bacteria | 1578 |
| 264 | Ga0466968_0087680 | 3300044735 | Bacteria | 1375 |
| 265 | Ga0466957_0002552 | 3300044842 | Bacteria | 9798 |
| 266 | Ga0466957_0004904 | 3300044842 | Bacteria | 7490 |
| 267 | Ga0466957_0019520 | 3300044842 | Bacteria | 3986 |
| 268 | Ga0466957_0021553 | 3300044842 | Bacteria | 3798 |
| 269 | Ga0466957_0024586 | 3300044842 | Bacteria | 3565 |
| 270 | Ga0466957_0062102 | 3300044842 | Bacteria | 2294 |
| 271 | Ga0466957_0062141 | 3300044842 | Bacteria | 2293 |
| 272 | Ga0466957_0073722 | 3300044842 | Bacteria | 2116 |
| 273 | Ga0466957_0131765 | 3300044842 | Bacteria | 1602 |
| 274 | Ga0466960_0033916 | 3300044901 | Bacteria | 2375 |
| 275 | Ga0466959_0000804 | 3300045049 | Bacteria | 18495 |
| 276 | Ga0466959_0003865 | 3300045049 | Bacteria | 9938 |
| 277 | Ga0466959_0012385 | 3300045049 | Bacteria | 6161 |
| 278 | Ga0466959_0016607 | 3300045049 | Bacteria | 5383 |
| 279 | Ga0466959_0028261 | 3300045049 | Bacteria | 4158 |
| 280 | Ga0466959_0036913 | 3300045049 | Bacteria | 3610 |
| 281 | Ga0466958_0000599 | 3300045836 | Bacteria | 15371 |
| 282 | Ga0466958_0000739 | 3300045836 | Bacteria | 14300 |
| 283 | Ga0466958_0002801 | 3300045836 | Bacteria | 8876 |
| 284 | Ga0466958_0002846 | 3300045836 | Bacteria | 8807 |
| 285 | Ga0466958_0006586 | 3300045836 | Bacteria | 6333 |
| 286 | Ga0466958_0026749 | 3300045836 | Bacteria | 3411 |
| 287 | Ga0466958_0030800 | 3300045836 | Bacteria | 3188 |
| 288 | Ga0466958_0031038 | 3300045836 | Bacteria | 3176 |
| 289 | Ga0466958_0050442 | 3300045836 | Bacteria | 2519 |
| 290 | Ga0466958_0167142 | 3300045836 | Bacteria | 1392 |
| 291 | Ga0466967_0000058 | 3300045976 | Bacteria | 40166 |
| 292 | Ga0466967_0002773 | 3300045976 | Bacteria | 11095 |
| 293 | Ga0466967_0007096 | 3300045976 | Bacteria | 8034 |
| 294 | Ga0466967_0009351 | 3300045976 | Bacteria | 7267 |
| 295 | Ga0466967_0011173 | 3300045976 | Bacteria | 6784 |
| 296 | Ga0466967_0016475 | 3300045976 | Bacteria | 5831 |
| 297 | Ga0466967_0018678 | 3300045976 | Bacteria | 5550 |
| 298 | Ga0466967_0034251 | 3300045976 | Bacteria | 4309 |
| 299 | Ga0466967_0039457 | 3300045976 | Bacteria | 4060 |
| 300 | Ga0466967_0040738 | 3300045976 | Bacteria | 4000 |
| 301 | Ga0466967_0073272 | 3300045976 | Unclassified | 3072 |
| 302 | Ga0466967_0081490 | 3300045976 | Bacteria | 2923 |
| 303 | Ga0466967_0091479 | 3300045976 | Bacteria | 2765 |
| 304 | Ga0466967_0095416 | 3300045976 | Bacteria | 2710 |
| 305 | Ga0466967_0116012 | 3300045976 | Bacteria | 2466 |
| 306 | Ga0466967_0124613 | 3300045976 | Unclassified | 2385 |
| 307 | Ga0466967_0137597 | 3300045976 | Bacteria | 2272 |
| 308 | Ga0466967_0140055 | 3300045976 | Bacteria | 2252 |
| 309 | Ga0466967_0152318 | 3300045976 | Bacteria | 2162 |
| 310 | Ga0466967_0156225 | 3300045976 | Bacteria | 2137 |
| 311 | Ga0466967_0192144 | 3300045976 | Unclassified | 1930 |
| 312 | Ga0466967_0195710 | 3300045976 | Bacteria | 1912 |
| 313 | Ga0466967_0197771 | 3300045976 | Bacteria | 1902 |
| 314 | Ga0466967_0284883 | 3300045976 | Bacteria | 1586 |
| 315 | Ga0466967_0322873 | 3300045976 | Unclassified | 1489 |
| 316 | Ga0466967_0397973 | 3300045976 | Bacteria | 1339 |
| 317 | Ga0495592_0000660 | 3300046454 | Bacteria | 23996 |
| 318 | Ga0495592_0086293 | 3300046454 | Bacteria | 2261 |
| 319 | Ga0495629_0010186 | 3300046459 | Bacteria | 6850 |
| 320 | Ga0495641_0067557 | 3300046461 | Unclassified | 1608 |
| 321 | Ga0495651_0000034 | 3300046462 | Bacteria | 99213 |
| 322 | Ga0495651_0005402 | 3300046462 | Bacteria | 9750 |
| 323 | Ga0495651_0029901 | 3300046462 | Bacteria | 4247 |
| 324 | Ga0495653_0005998 | 3300046463 | Bacteria | 9949 |
| 325 | Ga0495653_0030750 | 3300046463 | Bacteria | 4273 |
| 326 | Ga0495653_0048694 | 3300046463 | Bacteria | 3270 |
| 327 | Ga0495653_0073523 | 3300046463 | Bacteria | 2550 |
| 328 | Ga0495580_0005080 | 3300046472 | Bacteria | 10961 |
| 329 | Ga0495582_0000240 | 3300046473 | Bacteria | 30558 |
| 330 | Ga0495582_0011744 | 3300046473 | Bacteria | 4827 |
| 331 | Ga0495582_0041228 | 3300046473 | Bacteria | 2544 |
| 332 | Ga0495639_0004163 | 3300046475 | Bacteria | 6201 |
| 333 | Ga0495662_0007404 | 3300046476 | Bacteria | 5423 |
| 334 | Ga0495664_0003164 | 3300046477 | Bacteria | 8937 |
| 335 | Ga0495664_0035282 | 3300046477 | Bacteria | 2944 |
| 336 | Ga0495664_0038550 | 3300046477 | Bacteria | 2821 |
| 337 | Ga0495584_0024625 | 3300046491 | Bacteria | 3052 |
| 338 | Ga0495608_0009189 | 3300046511 | Bacteria | 6911 |
| 339 | Ga0495608_0012515 | 3300046511 | Bacteria | 5886 |
| 340 | Ga0495608_0043680 | 3300046511 | Bacteria | 2994 |
| 341 | Ga0495618_0003698 | 3300046514 | Bacteria | 9481 |
| 342 | Ga0495618_0023350 | 3300046514 | Bacteria | 3823 |
| 343 | Ga0495618_0023392 | 3300046514 | Bacteria | 3820 |
| 344 | Ga0495618_0073558 | 3300046514 | Bacteria | 2176 |
| 345 | Ga0495618_0166504 | 3300046514 | Unclassified | 1404 |
| 346 | Ga0495628_0000184 | 3300046516 | Bacteria | 54832 |
| 347 | Ga0495630_0018163 | 3300046517 | Bacteria | 5164 |
| 348 | Ga0495630_0061650 | 3300046517 | Bacteria | 2816 |
| 349 | Ga0495630_0062721 | 3300046517 | Bacteria | 2792 |
| 350 | Ga0495630_0075860 | 3300046517 | Bacteria | 2532 |
| 351 | Ga0495630_0093439 | 3300046517 | Bacteria | 2273 |
| 352 | Ga0495666_0000713 | 3300046526 | Bacteria | 15149 |
| 353 | Ga0495652_0000319 | 3300046529 | Bacteria | 56845 |
| 354 | Ga0495652_0064783 | 3300046529 | Bacteria | 3073 |
| 355 | Ga0495652_0066653 | 3300046529 | Bacteria | 3020 |
| 356 | Ga0495652_0099012 | 3300046529 | Bacteria | 2368 |
| 357 | Ga0495652_0102585 | 3300046529 | Bacteria | 2317 |
| 358 | Ga0495652_0109292 | 3300046529 | Bacteria | 2226 |
| 359 | Ga0495652_0169053 | 3300046529 | Bacteria | 1689 |
| 360 | Ga0495652_0368399 | 3300046529 | Bacteria | 1025 |
| 361 | Ga0495665_0006461 | 3300046531 | Bacteria | 6330 |
| 362 | Ga0495665_0048671 | 3300046531 | Bacteria | 2247 |
| 363 | Ga0495665_0062701 | 3300046531 | Bacteria | 1963 |
| 364 | Ga0495640_0001210 | 3300046533 | Bacteria | 20182 |
| 365 | Ga0495640_0038191 | 3300046533 | Bacteria | 3378 |
| 366 | Ga0495640_0046656 | 3300046533 | Bacteria | 3000 |
| 367 | Ga0495587_0004503 | 3300046536 | Bacteria | 9165 |
| 368 | Ga0495587_0040308 | 3300046536 | Bacteria | 2792 |
| 369 | Ga0495587_0090546 | 3300046536 | Bacteria | 1767 |
| 370 | Ga0495645_0000646 | 3300046543 | Bacteria | 24016 |
| 371 | Ga0495645_0036150 | 3300046543 | Bacteria | 3601 |
| 372 | Ga0495645_0050338 | 3300046543 | Bacteria | 3033 |
| 373 | Ga0495645_0118035 | 3300046543 | Bacteria | 1871 |
| 374 | Ga0495645_0150612 | 3300046543 | Bacteria | 1616 |
| 375 | Ga0495667_0008504 | 3300046559 | Bacteria | 6966 |
| 376 | Ga0495667_0043539 | 3300046559 | Bacteria | 2974 |
| 377 | Ga0495667_0057550 | 3300046559 | Bacteria | 2555 |
| 378 | Ga0495667_0063124 | 3300046559 | Bacteria | 2426 |
| 379 | Ga0495634_0036506 | 3300046642 | Bacteria | 3361 |
| 380 | Ga0495634_0118799 | 3300046642 | Bacteria | 1694 |
| 381 | Ga0495635_0031700 | 3300046663 | Bacteria | 3668 |
| 382 | Ga0495635_0043874 | 3300046663 | Bacteria | 3085 |
| 383 | Ga0495635_0076756 | 3300046663 | Bacteria | 2289 |
| 384 | Ga0495635_0087231 | 3300046663 | Bacteria | 2135 |
| 385 | Ga0495657_0053305 | 3300046675 | Bacteria | 2707 |
| 386 | Ga0495657_0068779 | 3300046675 | Bacteria | 2319 |
| 387 | Ga0495657_0073935 | 3300046675 | Bacteria | 2218 |
| 388 | Ga0495599_0000227 | 3300046678 | Bacteria | 35652 |
| 389 | Ga0495623_0000601 | 3300046679 | Bacteria | 23980 |
| 390 | Ga0495646_0002007 | 3300046680 | Bacteria | 12316 |
| 391 | Ga0495646_0085456 | 3300046680 | Bacteria | 1831 |
| 392 | Ga0495658_0000553 | 3300046683 | Bacteria | 20442 |
| 393 | Ga0495658_0002644 | 3300046683 | Bacteria | 9002 |
| 394 | Ga0495613_0004334 | 3300046689 | Bacteria | 10627 |
| 395 | Ga0495613_0103420 | 3300046689 | Bacteria | 2056 |
| 396 | Ga0495613_0107418 | 3300046689 | Bacteria | 2013 |
| 397 | Ga0495624_0001309 | 3300046690 | Bacteria | 19540 |
| 398 | Ga0495624_0023559 | 3300046690 | Bacteria | 4060 |
| 399 | Ga0495600_0030876 | 3300046809 | Bacteria | 3470 |
| 400 | Ga0495600_0059983 | 3300046809 | Bacteria | 2484 |
| 401 | Ga0495581_0002313 | 3300047315 | Bacteria | 10737 |
| 402 | Ga0495581_0006461 | 3300047315 | Bacteria | 6803 |
| 403 | Ga0495581_0041604 | 3300047315 | Bacteria | 2660 |
| 404 | Ga0495604_0000194 | 3300047317 | Bacteria | 54877 |
| 405 | Ga0495604_0033633 | 3300047317 | Bacteria | 4057 |
| 406 | Ga0495674_0001271 | 3300047319 | Bacteria | 24493 |
| 407 | Ga0495674_0065059 | 3300047319 | Bacteria | 3168 |
| 408 | Ga0495674_0070534 | 3300047319 | Bacteria | 3019 |
| 409 | Ga0495676_0000116 | 3300047321 | Bacteria | 61181 |
| 410 | Ga0495676_0018066 | 3300047321 | Bacteria | 6221 |
| 411 | Ga0495676_0060029 | 3300047321 | Bacteria | 2983 |
| 412 | Ga0495680_0001616 | 3300047322 | Bacteria | 23967 |
| 413 | Ga0495680_0005719 | 3300047322 | Bacteria | 11643 |
| 414 | Ga0495680_0007777 | 3300047322 | Bacteria | 9790 |
| 415 | Ga0495680_0078025 | 3300047322 | Bacteria | 2507 |
| 416 | Ga0495680_0078446 | 3300047322 | Bacteria | 2499 |
| 417 | Ga0495675_0000224 | 3300047444 | Bacteria | 40977 |
| 418 | Ga0495675_0097359 | 3300047444 | Bacteria | 1844 |
| 419 | Ga0495684_0001289 | 3300047471 | Bacteria | 20130 |
| 420 | Ga0495684_0011609 | 3300047471 | Bacteria | 6801 |
| 421 | Ga0495684_0026271 | 3300047471 | Bacteria | 4473 |
| 422 | Ga0495593_0001212 | 3300047673 | Bacteria | 15080 |
| 423 | Ga0495593_0002914 | 3300047673 | Bacteria | 10305 |
| 424 | Ga0495602_0001529 | 3300048088 | Bacteria | 23007 |
| 425 | Ga0495602_0164789 | 3300048088 | Archaea | 1726 |
| 426 | Ga0495614_0003570 | 3300048089 | Bacteria | 6970 |
| 427 | Ga0495614_0004174 | 3300048089 | Bacteria | 6507 |
| 428 | Ga0496100_0002232 | 3300048903 | Bacteria | 9785 |
| 429 | Ga0496100_0003049 | 3300048903 | Bacteria | 8650 |
| 430 | Ga0496100_0024374 | 3300048903 | Bacteria | 3690 |
| 431 | Ga0496100_0054878 | 3300048903 | Unclassified | 2601 |
| 432 | Ga0496101_0001684 | 3300048904 | Bacteria | 13245 |
| 433 | Ga0496101_0222352 | 3300048904 | Bacteria | 1465 |
| 434 | Ga0496101_0234029 | 3300048904 | Bacteria | 1429 |
| 435 | Ga0496102_0010430 | 3300048905 | Bacteria | 7991 |
| 436 | Ga0496102_0034465 | 3300048905 | Bacteria | 4553 |
| 437 | Ga0496102_0039115 | 3300048905 | Bacteria | 4284 |
| 438 | Ga0496102_0044042 | 3300048905 | Bacteria | 4049 |
| 439 | Ga0496103_0007355 | 3300048906 | Bacteria | 6566 |
| 440 | Ga0496103_0049297 | 3300048906 | Unclassified | 2604 |
| 441 | Ga0496103_0050518 | 3300048906 | Bacteria | 2572 |
| 442 | Ga0496103_0109076 | 3300048906 | Unclassified | 1757 |
| 443 | Ga0496104_0021635 | 3300048907 | Bacteria | 5906 |
| 444 | Ga0496104_0029914 | 3300048907 | Bacteria | 5057 |
| 445 | Ga0496104_0134592 | 3300048907 | Bacteria | 2374 |
| 446 | Ga0496105_0001600 | 3300048908 | Bacteria | 16035 |
| 447 | Ga0496105_0021838 | 3300048908 | Bacteria | 5181 |
| 448 | Ga0496105_0059364 | 3300048908 | Bacteria | 3156 |
| 449 | Ga0496105_0086980 | 3300048908 | Bacteria | 2583 |
| 450 | Ga0496105_0099115 | 3300048908 | Bacteria | 2406 |
| 451 | Ga0496106_0030949 | 3300048909 | Bacteria | 3989 |
| 452 | Ga0496106_0043988 | 3300048909 | Bacteria | 3352 |
| 453 | Ga0496106_0044007 | 3300048909 | Bacteria | 3351 |
| 454 | Ga0496106_0074918 | 3300048909 | Bacteria | 2592 |
| 455 | Ga0496107_0001643 | 3300048910 | Bacteria | 13948 |
| 456 | Ga0496107_0027340 | 3300048910 | Bacteria | 4050 |
| 457 | Ga0496107_0047745 | 3300048910 | Bacteria | 3083 |
| 458 | Ga0496107_0054021 | 3300048910 | Bacteria | 2898 |
| 459 | Ga0496107_0297704 | 3300048910 | Bacteria | 1201 |
| 460 | Ga0496108_0086558 | 3300048911 | Bacteria | 2660 |
| 461 | Ga0496108_0137977 | 3300048911 | Bacteria | 2100 |
| 462 | Ga0496109_0020547 | 3300048912 | Bacteria | 5832 |
| 463 | Ga0496109_0126980 | 3300048912 | Bacteria | 2378 |
| 464 | Ga0496110_0002333 | 3300048913 | Bacteria | 14192 |
| 465 | Ga0496110_0059576 | 3300048913 | Bacteria | 3366 |
| 466 | Ga0496111_0006852 | 3300048914 | Bacteria | 7435 |
| 467 | Ga0496111_0016481 | 3300048914 | Bacteria | 5092 |
| 468 | Ga0496111_0089962 | 3300048914 | Bacteria | 2248 |
| 469 | Ga0496111_0142725 | 3300048914 | Archaea | 1775 |
| 470 | Ga0496112_0002503 | 3300048915 | Bacteria | 14824 |
| 471 | Ga0496112_0028642 | 3300048915 | Bacteria | 5378 |
| 472 | Ga0496114_0015969 | 3300048917 | Bacteria | 6042 |
| 473 | Ga0496114_0029478 | 3300048917 | Bacteria | 4511 |
| 474 | Ga0496114_0044886 | 3300048917 | Bacteria | 3669 |
| 475 | Ga0496114_0063633 | 3300048917 | Bacteria | 3088 |
| 476 | Ga0496114_0079786 | 3300048917 | Bacteria | 2763 |
| 477 | Ga0496114_0095251 | 3300048917 | Bacteria | 2533 |
| 478 | Ga0496114_0095610 | 3300048917 | Bacteria | 2528 |
| 479 | Ga0496115_0000431 | 3300048918 | Bacteria | 33991 |
| 480 | Ga0496115_0001960 | 3300048918 | Bacteria | 14690 |
| 481 | Ga0496115_0011103 | 3300048918 | Bacteria | 6750 |
| 482 | Ga0496115_0078365 | 3300048918 | Bacteria | 2688 |
| 483 | Ga0496115_0141480 | 3300048918 | Bacteria | 1985 |
| 484 | Ga0496115_0190929 | 3300048918 | Bacteria | 1692 |
| 485 | Ga0496115_0206791 | 3300048918 | Unclassified | 1621 |
| 486 | Ga0501034_0068905 | 3300049571 | Bacteria | 3548 |
| 487 | Ga0501047_0136501 | 3300049581 | Bacteria | 2333 |
| 488 | Ga0501067_0019520 | 3300049583 | Bacteria | 3754 |
| 489 | Ga0501067_0062039 | 3300049583 | Bacteria | 2069 |
| 490 | Ga0501070_0001687 | 3300049586 | Bacteria | 19581 |
| 491 | Ga0501070_0020136 | 3300049586 | Bacteria | 5596 |
| 492 | Ga0501070_0030335 | 3300049586 | Bacteria | 4530 |
| 493 | Ga0501070_0156012 | 3300049586 | Bacteria | 1882 |
| 494 | Ga0501072_0000771 | 3300049588 | Bacteria | 23377 |
| 495 | Ga0501073_0107017 | 3300049589 | Bacteria | 1940 |
| 496 | Ga0501074_0025466 | 3300049590 | Bacteria | 4297 |
| 497 | Ga0501080_0005810 | 3300049742 | Bacteria | 11045 |
| 498 | Ga0501083_0002221 | 3300049744 | Bacteria | 13267 |
| 499 | nmdc:mga0n895_35395_c1 | 3300050512 | Bacteria | 4814 |
| 500 | nmdc:mga0rr50_2179_c1 | 3300050513 | Bacteria | 10969 |
| 501 | Ga0495601_0002650 | 3300053077 | Bacteria | 10149 |
| 502 | Ga0495601_0011962 | 3300053077 | Bacteria | 5202 |
| 503 | Ga0495601_0016415 | 3300053077 | Bacteria | 4486 |
| 504 | Ga0495601_0021168 | 3300053077 | Bacteria | 3980 |
| 505 | Ga0495601_0056438 | 3300053077 | Bacteria | 2487 |
| 506 | Ga0495601_0104613 | 3300053077 | Bacteria | 1830 |
| 507 | Ga0495612_0018370 | 3300053078 | Bacteria | 2800 |
| 508 | Ga0495655_0024144 | 3300053083 | Unclassified | 1409 |
| 509 | Ga0495595_0011444 | 3300053084 | Bacteria | 3709 |
| 510 | Ga0495595_0031092 | 3300053084 | Bacteria | 2398 |
| 511 | Ga0495619_0000370 | 3300053085 | Bacteria | 30945 |
| 512 | Ga0495619_0001120 | 3300053085 | Bacteria | 17601 |
| 513 | Ga0495619_0021157 | 3300053085 | Bacteria | 4151 |
| 514 | Ga0466962_0000178 | 3300061719 | Bacteria | 26342 |
| 515 | Ga0466962_0014521 | 3300061719 | Bacteria | 3796 |
| 516 | Ga0466962_0028798 | 3300061719 | Bacteria | 2660 |
| 517 | Ga0466962_0029679 | 3300061719 | Bacteria | 2618 |
| 518 | Ga0466962_0064058 | 3300061719 | Bacteria | 1755 |
| 519 | Ga0373936_0014154 | |||
| 520 | Ga0070658_10026425 | |||
| 521 | Ga0070658_10057663 | |||
| 522 | Ga0070658_10241248 | |||
| 523 | Ga0070658_10244036 | |||
| 524 | Ga0070683_100061886 | |||
| 525 | Ga0070683_100082241 | |||
| 526 | Ga0070683_100090870 | |||
| 527 | Ga0070683_100317988 | |||
| 528 | Ga0070680_100037518 | |||
| 529 | Ga0070680_100042553 | |||
| 530 | Ga0070680_100061682 | |||
| 531 | Ga0070680_100140120 | |||
| 532 | Ga0070680_100179252 | |||
| 533 | Ga0070680_100186185 | |||
| 534 | Ga0070682_100017077 | |||
| 535 | Ga0070660_100002028 | |||
| 536 | Ga0070660_100006126 | |||
| 537 | Ga0070660_100017495 | |||
| 538 | Ga0070660_100063735 | |||
| 539 | Ga0070660_100108568 | |||
| 540 | Ga0070691_10040990 | |||
| 541 | Ga0070661_100011983 | |||
| 542 | Ga0070661_100026605 | |||
| 543 | Ga0070661_100047549 | |||
| 544 | Ga0070659_100126892 | |||
| 545 | Ga0070659_100202188 | |||
| 546 | Ga0070709_10040844 | |||
| 547 | Ga0070709_10126264 | |||
| 548 | Ga0070714_100109241 | |||
| 549 | Ga0070714_100152438 | |||
| 550 | Ga0070714_100238908 | |||
| 551 | Ga0070713_100031202 | |||
| 552 | Ga0070713_100059015 | |||
| 553 | Ga0070710_10067769 | |||
| 554 | Ga0070711_100039707 | |||
| 555 | Ga0070711_100258173 | |||
| 556 | Ga0070708_100090810 | |||
| 557 | Ga0070678_100221707 | |||
| 558 | Ga0070681_10003527 | |||
| 559 | Ga0070681_10006392 | |||
| 560 | Ga0070681_10021602 | |||
| 561 | Ga0070681_10060095 | |||
| 562 | Ga0070681_10068974 | |||
| 563 | Ga0070681_10107834 | |||
| 564 | Ga0070681_10330266 | |||
| 565 | Ga0070706_100052262 | |||
| 566 | Ga0070707_100002886 | |||
| 567 | Ga0070698_100142225 | |||
| 568 | Ga0070679_100003305 | |||
| 569 | Ga0070679_100087555 | |||
| 570 | Ga0070679_100090161 | |||
| 571 | Ga0070679_100100308 | |||
| 572 | Ga0070679_100130182 | |||
| 573 | Ga0070679_100257997 | |||
| 574 | Ga0070684_100007913 | |||
| 575 | Ga0070684_100018030 | |||
| 576 | Ga0070684_100023249 | |||
| 577 | Ga0070684_100072948 | |||
| 578 | Ga0070684_100181400 | |||
| 579 | Ga0068853_100168314 | |||
| 580 | Ga0068853_100191998 | |||
| 581 | Ga0070695_100000042 | |||
| 582 | Ga0070696_100031278 | |||
| 583 | Ga0070696_100216981 | |||
| 584 | Ga0068855_100005440 | |||
| 585 | Ga0068855_100024596 | |||
| 586 | Ga0068855_100070219 | |||
| 587 | Ga0068855_100081024 | |||
| 588 | Ga0068855_100105630 | |||
| 589 | Ga0068855_100107418 | |||
| 590 | Ga0068855_100207066 | |||
| 591 | Ga0068856_100029889 | |||
| 592 | Ga0068856_100232360 | |||
| 593 | Ga0068856_100258504 | |||
| 594 | Ga0068852_100007704 | |||
| 595 | Ga0070717_10005123 | |||
| 596 | Ga0070717_10006038 | |||
| 597 | Ga0070717_10122360 | |||
| 598 | Ga0070717_10260218 | |||
| 599 | Ga0070715_10006525 | |||
| 600 | Ga0070712_100022004 | |||
| 601 | Ga0070712_100100513 | |||
| 602 | Ga0097621_100191315 | |||
| 603 | Ga0075435_100010341 | |||
| 604 | Ga0105240_10082537 | |||
| 605 | Ga0105240_10145505 | |||
| 606 | Ga0105240_10170327 | |||
| 607 | Ga0105240_10211345 | |||
| 608 | Ga0105245_10217828 | |||
| 609 | Ga0105242_10322160 | |||
| 610 | Ga0105237_10008196 | |||
| 611 | Ga0105237_10031338 | |||
| 612 | Ga0105237_10373278 | |||
| 613 | Ga0105238_10111953 | |||
| 614 | Ga0105239_10149461 | |||
| 615 | Ga0157370_10003420 | |||
| 616 | Ga0157370_10028045 | |||
| 617 | Ga0157370_10065872 | |||
| 618 | Ga0157370_10144142 | |||
| 619 | Ga0157370_10260716 | |||
| 620 | Ga0157370_10398472 | |||
| 621 | Ga0157369_10019204 | |||
| 622 | Ga0157369_10102654 | |||
| 623 | Ga0157369_10150272 | |||
| 624 | Ga0157369_10332001 | |||
| 625 | Ga0157369_10458406 | |||
| 626 | Ga0157378_10510892 | |||
| 627 | Ga0157372_10015541 | |||
| 628 | Ga0157372_10240883 | |||
| 629 | Ga0157372_10381442 | |||
| 630 | Ga0157372_10417526 | |||
| 631 | Ga0157375_10010295 | |||
| 632 | Ga0182008_10051151 | |||
| 633 | Ga0157377_10099031 | |||
| 634 | Ga0206354_10070558 | |||
| 635 | Ga0206354_10940914 | |||
| 636 | Ga0206353_10360123 | |||
| 637 | Ga0206353_10660535 | |||
| 638 | Ga0207692_10005863 | |||
| 639 | Ga0207692_10100160 | |||
| 640 | Ga0207705_10021376 | |||
| 641 | Ga0207705_10098361 | |||
| 642 | Ga0207705_10109728 | |||
| 643 | Ga0207705_10126563 | |||
| 644 | Ga0207705_10223707 | |||
| 645 | Ga0207705_10286149 | |||
| 646 | Ga0207707_10011301 | |||
| 647 | Ga0207707_10076985 | |||
| 648 | Ga0207707_10237163 | |||
| 649 | Ga0207695_10090971 | |||
| 650 | Ga0207695_10149456 | |||
| 651 | Ga0207671_10015509 | |||
| 652 | Ga0207693_10000641 | |||
| 653 | Ga0207693_10011938 | |||
| 654 | Ga0207693_10037448 | |||
| 655 | Ga0207663_10003801 | |||
| 656 | Ga0207663_10081345 | |||
| 657 | Ga0207660_10012560 | |||
| 658 | Ga0207660_10035678 | |||
| 659 | Ga0207660_10065184 | |||
| 660 | Ga0207660_10149519 | |||
| 661 | Ga0207657_10000467 | |||
| 662 | Ga0207657_10000955 | |||
| 663 | Ga0207657_10002911 | |||
| 664 | Ga0207657_10004917 | |||
| 665 | Ga0207657_10016461 | |||
| 666 | Ga0207657_10047220 | |||
| 667 | Ga0207657_10142222 | |||
| 668 | Ga0207652_10046836 | |||
| 669 | Ga0207652_10054871 | |||
| 670 | Ga0207652_10077525 | |||
| 671 | Ga0207652_10077751 | |||
| 672 | Ga0207652_10078534 | |||
| 673 | Ga0207646_10019122 | |||
| 674 | Ga0207646_10158486 | |||
| 675 | Ga0207694_10119580 | |||
| 676 | Ga0207687_10048422 | |||
| 677 | Ga0207700_10102133 | |||
| 678 | Ga0207700_10122432 | |||
| 679 | Ga0207700_10261088 | |||
| 680 | Ga0207664_10048167 | |||
| 681 | Ga0207664_10145753 | |||
| 682 | Ga0207664_10158822 | |||
| 683 | Ga0207664_10190932 | |||
| 684 | Ga0207686_10197434 | |||
| 685 | Ga0207709_10157418 | |||
| 686 | Ga0207665_10014623 | |||
| 687 | Ga0207665_10047389 | |||
| 688 | Ga0207661_10048955 | |||
| 689 | Ga0207661_10072913 | |||
| 690 | Ga0207661_10099685 | |||
| 691 | Ga0207679_10091657 | |||
| 692 | Ga0207667_10044902 | |||
| 693 | Ga0207667_10095140 | |||
| 694 | Ga0207667_10132621 | |||
| 695 | Ga0207702_10062292 | |||
| 696 | Ga0207702_10086857 | |||
| 697 | Ga0207702_10172709 | |||
| 698 | Ga0207698_10433695 | |||
| 699 | Ga0265318_10032061 | |||
| 700 | Ga0265338_10004355 | |||
| 701 | Ga0265338_10072410 | |||
| 702 | Ga0265338_10139240 | |||
| 703 | Ga0265324_10017960 | |||
| 704 | Ga0265327_10029272 | |||
| 705 | Ga0265327_10098266 | |||
| 706 | Ga0265314_10018445 | |||
| 707 | Ga0373926_0020872 | |||
| 708 | Ga0373944_0002819 | |||
| 709 | Ga0373944_0012218 | |||
| 710 | Ga0373936_0000709 | |||
| 711 | Ga0373945_0075269 | |||
| 712 | Ga0373943_0001472 | |||
| 713 | Ga0373943_0006130 | |||
| 714 | Ga0373943_0007210 | |||
| 715 | Ga0373946_0000349 | |||
| 716 | Ga0373946_0027139 | |||
| 717 | Ga0373955_0051195 | |||
| 718 | Ga0373935_0022630 | |||
| 719 | Ga0373935_0050798 | |||
| 720 | Ga0373927_0020339 | |||
| 721 | Ga0373947_0000798 | |||
| 722 | Ga0373947_0001443 | |||
| 723 | Ga0373937_0007692 | |||
| 724 | Ga0373925_0005687 | |||
| 725 | Ga0373925_0020936 | |||
| 726 | Ga0395900_0146864 | |||
| 727 | Ga0395900_0428023 | |||
| 728 | Ga0395898_0004508 | |||
| 729 | Ga0395898_0016045 | |||
| 730 | Ga0395898_0049965 | |||
| 731 | Ga0395898_0142575 | |||
| 732 | Ga0395898_0173272 | |||
| 733 | Ga0395905_0201846 | |||
| 734 | Ga0436364_0752779 | |||
| 735 | Ga0395901_0050833 | |||
| 736 | Ga0395901_0149065 | |||
| 737 | Ga0395901_0155831 | |||
| 738 | Ga0395901_0274552 | |||
| 739 | Ga0395901_0411588 | |||
| 740 | Ga0436363_1241766 | |||
| 741 | Ga0466969_0000426 | |||
| 742 | Ga0466965_0041392 | |||
| 743 | Ga0466966_0002767 | |||
| 744 | Ga0466966_0064358 | |||
| 745 | Ga0466966_0064818 | |||
| 746 | Ga0466966_0065810 | |||
| 747 | Ga0466966_0073583 | |||
| 748 | Ga0466961_0008571 | |||
| 749 | Ga0466961_0016622 | |||
| 750 | Ga0466961_0094657 | |||
| 751 | Ga0466961_0108869 | |||
| 752 | Ga0466961_0156257 | |||
| 753 | Ga0466961_0175353 | |||
| 754 | Ga0466963_0000389 | |||
| 755 | Ga0466963_0001233 | |||
| 756 | Ga0466963_0003689 | |||
| 757 | Ga0466963_0005847 | |||
| 758 | Ga0466963_0010737 | |||
| 759 | Ga0466963_0012429 | |||
| 760 | Ga0466963_0015554 | |||
| 761 | Ga0466963_0018221 | |||
| 762 | Ga0466963_0024604 | |||
| 763 | Ga0466963_0037295 | |||
| 764 | Ga0466963_0050366 | |||
| 765 | Ga0466963_0057037 | |||
| 766 | Ga0466963_0077084 | |||
| 767 | Ga0466963_0222301 | |||
| 768 | Ga0466964_0004354 | |||
| 769 | Ga0466964_0009396 | |||
| 770 | Ga0466964_0025488 | |||
| 771 | Ga0466964_0025953 | |||
| 772 | Ga0466971_0001205 | |||
| 773 | Ga0466971_0001930 | |||
| 774 | Ga0466971_0026927 | |||
| 775 | Ga0466971_0040071 | |||
| 776 | Ga0466971_0042793 | |||
| 777 | Ga0466971_0073286 | |||
| 778 | Ga0466968_0001920 | |||
| 779 | Ga0466968_0019216 | |||
| 780 | Ga0466968_0039686 | |||
| 781 | Ga0466968_0065033 | |||
| 782 | Ga0466968_0087680 | |||
| 783 | Ga0466957_0002552 | |||
| 784 | Ga0466957_0004904 | |||
| 785 | Ga0466957_0019520 | |||
| 786 | Ga0466957_0021553 | |||
| 787 | Ga0466957_0024586 | |||
| 788 | Ga0466957_0062102 | |||
| 789 | Ga0466957_0062141 | |||
| 790 | Ga0466957_0073722 | |||
| 791 | Ga0466957_0131765 | |||
| 792 | Ga0466960_0033916 | |||
| 793 | Ga0466959_0000804 | |||
| 794 | Ga0466959_0003865 | |||
| 795 | Ga0466959_0012385 | |||
| 796 | Ga0466959_0016607 | |||
| 797 | Ga0466959_0028261 | |||
| 798 | Ga0466959_0036913 | |||
| 799 | Ga0466958_0000599 | |||
| 800 | Ga0466958_0000739 | |||
| 801 | Ga0466958_0002801 | |||
| 802 | Ga0466958_0002846 | |||
| 803 | Ga0466958_0006586 | |||
| 804 | Ga0466958_0026749 | |||
| 805 | Ga0466958_0030800 | |||
| 806 | Ga0466958_0031038 | |||
| 807 | Ga0466958_0050442 | |||
| 808 | Ga0466958_0167142 | |||
| 809 | Ga0466967_0000058 | |||
| 810 | Ga0466967_0002773 | |||
| 811 | Ga0466967_0007096 | |||
| 812 | Ga0466967_0009351 | |||
| 813 | Ga0466967_0011173 | |||
| 814 | Ga0466967_0016475 | |||
| 815 | Ga0466967_0018678 | |||
| 816 | Ga0466967_0034251 | |||
| 817 | Ga0466967_0039457 | |||
| 818 | Ga0466967_0040738 | |||
| 819 | Ga0466967_0073272 | |||
| 820 | Ga0466967_0081490 | |||
| 821 | Ga0466967_0091479 | |||
| 822 | Ga0466967_0095416 | |||
| 823 | Ga0466967_0116012 | |||
| 824 | Ga0466967_0124613 | |||
| 825 | Ga0466967_0137597 | |||
| 826 | Ga0466967_0140055 | |||
| 827 | Ga0466967_0152318 | |||
| 828 | Ga0466967_0156225 | |||
| 829 | Ga0466967_0192144 | |||
| 830 | Ga0466967_0195710 | |||
| 831 | Ga0466967_0197771 | |||
| 832 | Ga0466967_0284883 | |||
| 833 | Ga0466967_0322873 | |||
| 834 | Ga0466967_0397973 | |||
| 835 | Ga0495592_0000660 | |||
| 836 | Ga0495592_0086293 | |||
| 837 | Ga0495629_0010186 | |||
| 838 | Ga0495641_0067557 | |||
| 839 | Ga0495651_0000034 | |||
| 840 | Ga0495651_0005402 | |||
| 841 | Ga0495651_0029901 | |||
| 842 | Ga0495653_0005998 | |||
| 843 | Ga0495653_0030750 | |||
| 844 | Ga0495653_0048694 | |||
| 845 | Ga0495653_0073523 | |||
| 846 | Ga0495580_0005080 | |||
| 847 | Ga0495582_0000240 | |||
| 848 | Ga0495582_0011744 | |||
| 849 | Ga0495582_0041228 | |||
| 850 | Ga0495639_0004163 | |||
| 851 | Ga0495662_0007404 | |||
| 852 | Ga0495664_0003164 | |||
| 853 | Ga0495664_0035282 | |||
| 854 | Ga0495664_0038550 | |||
| 855 | Ga0495584_0024625 | |||
| 856 | Ga0495608_0009189 | |||
| 857 | Ga0495608_0012515 | |||
| 858 | Ga0495608_0043680 | |||
| 859 | Ga0495618_0003698 | |||
| 860 | Ga0495618_0023350 | |||
| 861 | Ga0495618_0023392 | |||
| 862 | Ga0495618_0073558 | |||
| 863 | Ga0495618_0166504 | |||
| 864 | Ga0495628_0000184 | |||
| 865 | Ga0495630_0018163 | |||
| 866 | Ga0495630_0061650 | |||
| 867 | Ga0495630_0062721 | |||
| 868 | Ga0495630_0075860 | |||
| 869 | Ga0495630_0093439 | |||
| 870 | Ga0495666_0000713 | |||
| 871 | Ga0495652_0000319 | |||
| 872 | Ga0495652_0064783 | |||
| 873 | Ga0495652_0066653 | |||
| 874 | Ga0495652_0099012 | |||
| 875 | Ga0495652_0102585 | |||
| 876 | Ga0495652_0109292 | |||
| 877 | Ga0495652_0169053 | |||
| 878 | Ga0495652_0368399 | |||
| 879 | Ga0495665_0006461 | |||
| 880 | Ga0495665_0048671 | |||
| 881 | Ga0495665_0062701 | |||
| 882 | Ga0495640_0001210 | |||
| 883 | Ga0495640_0038191 | |||
| 884 | Ga0495640_0046656 | |||
| 885 | Ga0495587_0004503 | |||
| 886 | Ga0495587_0040308 | |||
| 887 | Ga0495587_0090546 | |||
| 888 | Ga0495645_0000646 | |||
| 889 | Ga0495645_0036150 | |||
| 890 | Ga0495645_0050338 | |||
| 891 | Ga0495645_0118035 | |||
| 892 | Ga0495645_0150612 | |||
| 893 | Ga0495667_0008504 | |||
| 894 | Ga0495667_0043539 | |||
| 895 | Ga0495667_0057550 | |||
| 896 | Ga0495667_0063124 | |||
| 897 | Ga0495634_0036506 | |||
| 898 | Ga0495634_0118799 | |||
| 899 | Ga0495635_0031700 | |||
| 900 | Ga0495635_0043874 | |||
| 901 | Ga0495635_0076756 | |||
| 902 | Ga0495635_0087231 | |||
| 903 | Ga0495657_0053305 | |||
| 904 | Ga0495657_0068779 | |||
| 905 | Ga0495657_0073935 | |||
| 906 | Ga0495599_0000227 | |||
| 907 | Ga0495623_0000601 | |||
| 908 | Ga0495646_0002007 | |||
| 909 | Ga0495646_0085456 | |||
| 910 | Ga0495658_0000553 | |||
| 911 | Ga0495658_0002644 | |||
| 912 | Ga0495613_0004334 | |||
| 913 | Ga0495613_0103420 | |||
| 914 | Ga0495613_0107418 | |||
| 915 | Ga0495624_0001309 | |||
| 916 | Ga0495624_0023559 | |||
| 917 | Ga0495600_0030876 | |||
| 918 | Ga0495600_0059983 | |||
| 919 | Ga0495581_0002313 | |||
| 920 | Ga0495581_0006461 | |||
| 921 | Ga0495581_0041604 | |||
| 922 | Ga0495604_0000194 | |||
| 923 | Ga0495604_0033633 | |||
| 924 | Ga0495674_0001271 | |||
| 925 | Ga0495674_0065059 | |||
| 926 | Ga0495674_0070534 | |||
| 927 | Ga0495676_0000116 | |||
| 928 | Ga0495676_0018066 | |||
| 929 | Ga0495676_0060029 | |||
| 930 | Ga0495680_0001616 | |||
| 931 | Ga0495680_0005719 | |||
| 932 | Ga0495680_0007777 | |||
| 933 | Ga0495680_0078025 | |||
| 934 | Ga0495680_0078446 | |||
| 935 | Ga0495675_0000224 | |||
| 936 | Ga0495675_0097359 | |||
| 937 | Ga0495684_0001289 | |||
| 938 | Ga0495684_0011609 | |||
| 939 | Ga0495684_0026271 | |||
| 940 | Ga0495593_0001212 | |||
| 941 | Ga0495593_0002914 | |||
| 942 | Ga0495602_0001529 | |||
| 943 | Ga0495602_0164789 | |||
| 944 | Ga0495614_0003570 | |||
| 945 | Ga0495614_0004174 | |||
| 946 | Ga0496100_0002232 | |||
| 947 | Ga0496100_0003049 | |||
| 948 | Ga0496100_0024374 | |||
| 949 | Ga0496100_0054878 | |||
| 950 | Ga0496101_0001684 | |||
| 951 | Ga0496101_0222352 | |||
| 952 | Ga0496101_0234029 | |||
| 953 | Ga0496102_0010430 | |||
| 954 | Ga0496102_0034465 | |||
| 955 | Ga0496102_0039115 | |||
| 956 | Ga0496102_0044042 | |||
| 957 | Ga0496103_0007355 | |||
| 958 | Ga0496103_0049297 | |||
| 959 | Ga0496103_0050518 | |||
| 960 | Ga0496103_0109076 | |||
| 961 | Ga0496104_0021635 | |||
| 962 | Ga0496104_0029914 | |||
| 963 | Ga0496104_0134592 | |||
| 964 | Ga0496105_0001600 | |||
| 965 | Ga0496105_0021838 | |||
| 966 | Ga0496105_0059364 | |||
| 967 | Ga0496105_0086980 | |||
| 968 | Ga0496105_0099115 | |||
| 969 | Ga0496106_0030949 | |||
| 970 | Ga0496106_0043988 | |||
| 971 | Ga0496106_0044007 | |||
| 972 | Ga0496106_0074918 | |||
| 973 | Ga0496107_0001643 | |||
| 974 | Ga0496107_0027340 | |||
| 975 | Ga0496107_0047745 | |||
| 976 | Ga0496107_0054021 | |||
| 977 | Ga0496107_0297704 | |||
| 978 | Ga0496108_0086558 | |||
| 979 | Ga0496108_0137977 | |||
| 980 | Ga0496109_0020547 | |||
| 981 | Ga0496109_0126980 | |||
| 982 | Ga0496110_0002333 | |||
| 983 | Ga0496110_0059576 | |||
| 984 | Ga0496111_0006852 | |||
| 985 | Ga0496111_0016481 | |||
| 986 | Ga0496111_0089962 | |||
| 987 | Ga0496111_0142725 | |||
| 988 | Ga0496112_0002503 | |||
| 989 | Ga0496112_0028642 | |||
| 990 | Ga0496114_0015969 | |||
| 991 | Ga0496114_0029478 | |||
| 992 | Ga0496114_0044886 | |||
| 993 | Ga0496114_0063633 | |||
| 994 | Ga0496114_0079786 | |||
| 995 | Ga0496114_0095251 | |||
| 996 | Ga0496114_0095610 | |||
| 997 | Ga0496115_0000431 | |||
| 998 | Ga0496115_0001960 | |||
| 999 | Ga0496115_0011103 | |||
| 1000 | Ga0496115_0078365 | |||
| 1001 | Ga0496115_0141480 | |||
| 1002 | Ga0496115_0190929 | |||
| 1003 | Ga0496115_0206791 | |||
| 1004 | Ga0501034_0068905 | |||
| 1005 | Ga0501047_0136501 | |||
| 1006 | Ga0501067_0019520 | |||
| 1007 | Ga0501067_0062039 | |||
| 1008 | Ga0501070_0001687 | |||
| 1009 | Ga0501070_0020136 | |||
| 1010 | Ga0501070_0030335 | |||
| 1011 | Ga0501070_0156012 | |||
| 1012 | Ga0501072_0000771 | |||
| 1013 | Ga0501073_0107017 | |||
| 1014 | Ga0501074_0025466 | |||
| 1015 | Ga0501080_0005810 | |||
| 1016 | Ga0501083_0002221 | |||
| 1017 | nmdc:mga0n895_35395_c1 | |||
| 1018 | nmdc:mga0rr50_2179_c1 | |||
| 1019 | Ga0495601_0002650 | |||
| 1020 | Ga0495601_0011962 | |||
| 1021 | Ga0495601_0016415 | |||
| 1022 | Ga0495601_0021168 | |||
| 1023 | Ga0495601_0056438 | |||
| 1024 | Ga0495601_0104613 | |||
| 1025 | Ga0495612_0018370 | |||
| 1026 | Ga0495655_0024144 | |||
| 1027 | Ga0495595_0011444 | |||
| 1028 | Ga0495595_0031092 | |||
| 1029 | Ga0495619_0000370 | |||
| 1030 | Ga0495619_0001120 | |||
| 1031 | Ga0495619_0021157 | |||
| 1032 | Ga0466962_0000178 | |||
| 1033 | Ga0466962_0014521 | |||
| 1034 | Ga0466962_0028798 | |||
| 1035 | Ga0466962_0029679 | |||
| 1036 | Ga0466962_0064058 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy