F458245

General Info

Members Datasets Scaffolds Average Seq Length
518 291 1036 430

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10002077|Ga0105243_100020775
Length 459
Sequence MRDAIAMNAVDHPSKVLATFAAELRFDAIPAPVLRRTEDLMLDWLGSVLAARTARPVRSIERFAQMMGPAEGPSELLTSRRTTSPVFAALVNAAASHFVEQDDVHNGSVFHPAAVVIAPALAVAQSVGASGAQLLTAVVAGYEVGIRVGEFLGRSHYKTFHTTATAGTLAAAAAXXRLLDLTPQQMLHAFGSAGTQSAGVWEFLRDAADSKQLHCAHAAASGLMSAYLAQDGFTGAAKILEGAQGLGVGMSSDADPAKLVDGLGTRWTLAETSFKYHASCRHTHPAADALLQVMTQNKLKPADVSRVTTYVHQGAIDVLGRVTVPATVHQGKFSMGTVLGLIAVHGRAGLGEFDRDFLAPEVSAFRDKVTMQLDAEVDTAYPARWIGKVSVHTADGRTLQGRVDEPKGDPGNSLSRTEIEDKMQRLAHYGEGVTADEAKALCERVWQLADTPRVGRWLG

Samples

Sample ID Description Type Environment
1 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
10 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
11 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
12 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
13 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
62 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
68 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
70 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
74 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
77 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
79 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
103 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
104 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
105 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
106 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
107 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
108 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
109 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
110 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
111 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
112 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
113 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
116 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
117 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
118 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
119 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
120 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
121 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
126 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
127 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
128 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
129 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
130 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
131 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
132 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
133 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
134 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
135 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
136 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
137 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
138 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
139 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
140 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
141 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
142 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
143 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
144 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
145 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
146 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
147 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
148 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
149 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
150 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
151 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
152 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
153 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
154 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
155 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
156 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
157 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
158 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
159 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
160 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
161 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
162 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
163 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
164 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
165 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
166 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
167 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
168 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
169 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
170 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
171 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
172 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
173 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
174 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
175 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
176 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
177 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
178 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
179 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
180 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
181 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
182 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
183 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
184 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
185 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
186 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
187 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
188 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
189 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
190 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
191 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
192 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
193 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
194 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
195 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
196 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
197 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
198 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
199 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
200 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
201 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
202 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
212 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
213 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
214 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
215 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
216 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
217 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
218 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
219 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
220 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
221 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
222 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
225 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
226 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
228 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
229 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
230 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
231 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
232 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
233 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
234 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
235 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
236 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
237 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
238 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
239 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
240 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
241 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
242 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
243 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
244 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
245 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
246 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
247 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
248 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
249 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
250 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
251 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
252 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
253 2643221658 Variovorax sp. Root411 Isolate Unclassified
254 2643221672 Variovorax sp. Root434 Isolate Unclassified
255 2643221683 Variovorax sp. Root473 Isolate Unclassified
256 2738541277 Variovorax sp. GV051 Isolate Unclassified
257 2738541307 Variovorax sp. GV008 Isolate Unclassified
258 2738543019 Variovorax sp. GV040 Isolate Unclassified
259 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
260 2818991446 Variovorax sp. 1180 Isolate Unclassified
261 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
262 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
263 2842677519 Variovorax sp. R-72495 Isolate Unclassified
264 2842733646 Variovorax sp. R-72446 Isolate Unclassified
265 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
266 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
267 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
268 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
269 2885198086 Variovorax sp. 679 Isolate Unclassified
270 2885211737 Variovorax sp. 553 Isolate Unclassified
271 2899924645 Variovorax sp. 369 Isolate Unclassified
272 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
273 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
274 2904456579 Variovorax sp. 2002 Isolate Unclassified
275 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
276 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
277 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
278 2928037797 Variovorax sp. 1126 Isolate Unclassified
279 2928044640 Variovorax sp. 1128 Isolate Unclassified
280 2928051484 Variovorax sp. 1133 Isolate Unclassified
281 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
282 2928070936 Variovorax gossypii 1167 Isolate Unclassified
283 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
284 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
285 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
286 2929520902 Variovorax beijingensis 502 Isolate Unclassified
287 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
288 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
289 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
290 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
291 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.93
Metatranscriptomes 0.19
Isolates 8.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.68
Nodule 0.58
Rhizoplane 4.63
Rhizosphere 57.92
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105243_10002077 3300009148 Bacteria 16956
2 JGI25152J39213_1002713 3300002773 Bacteria 6467
3 JGI25150J39212_1000449 3300002774 Bacteria 18232
4 JGI25159J45721_1016891 3300002987 Bacteria 1535
5 JGI25151J46595_10000775 3300003187 Bacteria 25895
6 JGI25151J46595_10001976 3300003187 Bacteria 12906
7 JGI25151J46595_10003527 3300003187 Bacteria 8607
8 JGI25151J46595_10016368 3300003187 Bacteria 3244
9 rootH2_10000639 3300003320 Bacteria 2895
10 rootL2_10053547 3300003322 Bacteria 1543
11 rootH1_10077330 3300003323 Bacteria 2540
12 Ga0006562J51391_1104210 3300003578 Bacteria 3840
13 Ga0055535_1000674 3300003761 Bacteria 26614
14 Ga0055542_1000022 3300003762 Bacteria 302315
15 Ga0055529_1001690 3300003763 Bacteria 5699
16 Ga0055537_1000134 3300003773 Bacteria 56046
17 Ga0055536_1001312 3300003781 Bacteria 15270
18 Ga0055536_1002825 3300003781 Bacteria 9567
19 Ga0055536_1013506 3300003781 Bacteria 2939
20 Ga0055534_1000088 3300003784 Bacteria 72004
21 Ga0055534_1002458 3300003784 Bacteria 6399
22 Ga0055528_1000493 3300003790 Bacteria 31199
23 Ga0055530_10000353 3300003791 Bacteria 41463
24 Ga0055530_10004488 3300003791 Bacteria 7159
25 Ga0055540_1003252 3300003792 Bacteria 7961
26 Ga0055540_1003873 3300003792 Bacteria 7026
27 Ga0055540_1010241 3300003792 Bacteria 3134
28 Ga0055531_10003937 3300003794 Bacteria 9228
29 Ga0055543_1001125 3300004625 Bacteria 11480
30 Ga0055543_1007736 3300004625 Bacteria 2452
31 Ga0065165_1002482 3300005262 Bacteria 15509
32 Ga0065165_1003199 3300005262 Bacteria 11959
33 Ga0070658_10057855 3300005327 Bacteria 3154
34 Ga0070670_100012443 3300005331 Bacteria 7281
35 Ga0070666_10029535 3300005335 Bacteria 3605
36 Ga0068868_100009574 3300005338 Bacteria 6986
37 Ga0070661_100032326 3300005344 Bacteria 3788
38 Ga0070668_100033088 3300005347 Bacteria 3935
39 Ga0070668_100151262 3300005347 Bacteria 1877
40 Ga0070675_100123514 3300005354 Bacteria 2201
41 Ga0070667_100007851 3300005367 Bacteria 8849
42 Ga0070678_100062643 3300005456 Bacteria 2747
43 Ga0070662_100045814 3300005457 Bacteria 3140
44 Ga0068853_100015297 3300005539 Bacteria 6306
45 Ga0070672_100095295 3300005543 Bacteria 2407
46 Ga0070664_100034669 3300005564 Bacteria 4234
47 Ga0070664_100045096 3300005564 Bacteria 3723
48 Ga0068859_100382031 3300005617 Bacteria 1504
49 Ga0068864_100054846 3300005618 Bacteria 3440
50 Ga0068851_10014260 3300005834 Bacteria 3772
51 Ga0068858_100050719 3300005842 Bacteria 3840
52 Ga0068860_100039137 3300005843 Bacteria 4535
53 Ga0068862_100143216 3300005844 Bacteria 2123
54 Ga0068862_100249239 3300005844 Bacteria 1618
55 Ga0075365_10025612 3300006038 Bacteria 3736
56 Ga0075365_10028890 3300006038 Bacteria 3539
57 Ga0075368_10021530 3300006042 Bacteria 2450
58 Ga0075363_100039817 3300006048 Bacteria 2475
59 Ga0075363_100060258 3300006048 Bacteria 2042
60 Ga0075363_100105825 3300006048 Bacteria 1560
61 Ga0075364_10039599 3300006051 Bacteria 3056
62 Ga0075362_10001557 3300006177 Bacteria 7404
63 Ga0075362_10016388 3300006177 Bacteria 3034
64 Ga0075362_10019060 3300006177 Bacteria 2848
65 Ga0075362_10059280 3300006177 Bacteria 1728
66 Ga0075369_10050626 3300006186 Bacteria 1797
67 Ga0075366_10008051 3300006195 Bacteria 5842
68 Ga0075366_10008256 3300006195 Bacteria 5781
69 Ga0075366_10022124 3300006195 Bacteria 3698
70 Ga0075366_10033547 3300006195 Bacteria 3024
71 Ga0075370_10009931 3300006353 Bacteria 4960
72 Ga0075370_10017168 3300006353 Bacteria 3906
73 Ga0075370_10018638 3300006353 Bacteria 3766
74 Ga0097620_100382013 3300006931 Bacteria 1504
75 Ga0099826_10016433 3300006948 Bacteria 5589
76 Ga0105240_10261175 3300009093 Bacteria 1998
77 Ga0105243_10001362 3300009148 Bacteria 21682
78 Ga0105243_10065010 3300009148 Bacteria 2929
79 Ga0105248_10017044 3300009177 Bacteria 8001
80 Ga0105248_10172547 3300009177 Bacteria 2438
81 Ga0105238_10064996 3300009551 Bacteria 3649
82 Ga0099796_10022148 3300010159 Bacteria 1968
83 Ga0157370_10046692 3300013104 Bacteria 4152
84 Ga0157369_10050853 3300013105 Bacteria 4486
85 Ga0163162_10010459 3300013306 Bacteria 9020
86 Ga0163162_10038765 3300013306 Bacteria 4757
87 Ga0157375_10055733 3300013308 Bacteria 3899
88 Ga0182008_10013840 3300014497 Bacteria 4237
89 Ga0157379_10021538 3300014968 Bacteria 5707
90 Ga0157379_10033507 3300014968 Bacteria 4580
91 Ga0182006_1003413 3300015261 Bacteria 8125
92 Ga0182006_1037892 3300015261 Bacteria 1909
93 Ga0183362_10001 3300015683 Bacteria 2046624
94 Ga0163161_10000677 3300017792 Bacteria 27208
95 Ga0163161_10019153 3300017792 Bacteria 4799
96 Ga0209672_101908 3300025228 Bacteria 5994
97 Ga0209147_100834 3300025229 Bacteria 14518
98 Ga0209258_100009 3300025242 Bacteria 996276
99 Ga0207425_1000622 3300025245 Bacteria 20279
100 Ga0209148_1000007 3300025254 Bacteria 1592273
101 Ga0209129_1000024 3300025258 Bacteria 417268
102 Ga0209129_1000085 3300025258 Bacteria 181765
103 Ga0209129_1006184 3300025258 Bacteria 3966
104 Ga0209565_1000046 3300025263 Bacteria 226073
105 Ga0209565_1000460 3300025263 Bacteria 31333
106 Ga0209455_1000566 3300025272 Bacteria 24635
107 Ga0209673_1000058 3300025273 Bacteria 269028
108 Ga0209673_1000571 3300025273 Bacteria 58695
109 Ga0209673_1000585 3300025273 Bacteria 57304
110 Ga0209673_1013344 3300025273 Bacteria 3248
111 Ga0209673_1033699 3300025273 Bacteria 1557
112 Ga0209130_1000801 3300025284 Bacteria 26718
113 Ga0209130_1001774 3300025284 Bacteria 12714
114 Ga0209130_1002358 3300025284 Bacteria 9577
115 Ga0209675_1000010 3300025291 Bacteria 541927
116 Ga0209675_1000387 3300025291 Bacteria 36710
117 Ga0209675_1001391 3300025291 Bacteria 14088
118 Ga0209675_1002180 3300025291 Bacteria 10281
119 Ga0209676_1000028 3300025292 Bacteria 559745
120 Ga0209676_1000098 3300025292 Bacteria 234305
121 Ga0209676_1000173 3300025292 Bacteria 153411
122 Ga0209676_1000194 3300025292 Bacteria 136666
123 Ga0209676_1005526 3300025292 Bacteria 6560
124 Ga0209676_1006445 3300025292 Bacteria 5791
125 Ga0209025_1000122 3300025294 Bacteria 206064
126 Ga0209025_1000267 3300025294 Bacteria 121798
127 Ga0209025_1000382 3300025294 Bacteria 91921
128 Ga0209025_1005401 3300025294 Bacteria 10443
129 Ga0209025_1045048 3300025294 Bacteria 1835
130 Ga0209564_1000183 3300025295 Bacteria 150409
131 Ga0209564_1000198 3300025295 Bacteria 138511
132 Ga0209758_1000049 3300025297 Bacteria 345104
133 Ga0209050_1000002 3300025298 Bacteria 1792849
134 Ga0209050_1000122 3300025298 Bacteria 195305
135 Ga0209050_1000554 3300025298 Bacteria 61514
136 Ga0209256_1000098 3300025299 Bacteria 204152
137 Ga0209256_1000140 3300025299 Bacteria 152770
138 Ga0207426_1000038 3300025302 Bacteria 441522
139 Ga0207426_1000053 3300025302 Bacteria 384818
140 Ga0209051_1000015 3300025303 Bacteria 546798
141 Ga0209051_1000159 3300025303 Bacteria 126836
142 Ga0209051_1000194 3300025303 Bacteria 107213
143 Ga0209051_1000282 3300025303 Bacteria 82787
144 Ga0209051_1000597 3300025303 Bacteria 42565
145 Ga0209051_1001760 3300025303 Bacteria 17204
146 Ga0209051_1013154 3300025303 Bacteria 3954
147 Ga0209051_1013188 3300025303 Bacteria 3948
148 Ga0209257_1000002 3300025304 Bacteria 1767052
149 Ga0209257_1000475 3300025304 Bacteria 73111
150 Ga0209257_1012069 3300025304 Bacteria 4054
151 Ga0209257_1013554 3300025304 Bacteria 3609
152 Ga0207680_10049177 3300025903 Bacteria 2508
153 Ga0207652_10146148 3300025921 Bacteria 2116
154 Ga0207681_10007610 3300025923 Bacteria 6639
155 Ga0207644_10183230 3300025931 Bacteria 1642
156 Ga0207706_10083407 3300025933 Bacteria 2810
157 Ga0207709_10000285 3300025935 Bacteria 57630
158 Ga0207709_10000702 3300025935 Bacteria 26997
159 Ga0207709_10006027 3300025935 Bacteria 6831
160 Ga0207691_10091968 3300025940 Bacteria 2717
161 Ga0207711_10056939 3300025941 Bacteria 3360
162 Ga0207679_10018262 3300025945 Bacteria 4696
163 Ga0207668_10135396 3300025972 Bacteria 1887
164 Ga0207703_10027382 3300026035 Bacteria 4489
165 Ga0207639_10051640 3300026041 Bacteria 3128
166 Ga0207641_10028333 3300026088 Bacteria 4628
167 Ga0207641_10072001 3300026088 Bacteria 2976
168 Ga0207648_10153530 3300026089 Bacteria 2032
169 Ga0207683_10115406 3300026121 Bacteria 2407
170 Ga0207698_10110315 3300026142 Bacteria 2304
171 Ga0209282_1032293 3300027666 Bacteria 3204
172 Ga0268264_10018614 3300028381 Bacteria 5678
173 Ga0307515_10000041 3300028794 Bacteria 319110
174 Ga0307515_10000195 3300028794 Bacteria 148138
175 Ga0307515_10184446 3300028794 Bacteria 2022
176 Ga0307515_10206663 3300028794 Bacteria 1821
177 Ga0316177_1038353 3300030731 Bacteria 7814
178 Ga0316176_1184500 3300030732 Bacteria 3074
179 Ga0314311_1073106 3300030733 Bacteria 10580
180 Ga0316183_1066259 3300030742 Bacteria 10511
181 Ga0265330_10008969 3300031235 Bacteria 4774
182 Ga0265332_10001322 3300031238 Bacteria 14068
183 Ga0265328_10022370 3300031239 Bacteria 2407
184 Ga0265325_10028172 3300031241 Bacteria 3030
185 Ga0265331_10001354 3300031250 Bacteria 18014
186 Ga0265327_10001008 3300031251 Bacteria 39934
187 Ga0265327_10001077 3300031251 Bacteria 38014
188 Ga0265327_10001501 3300031251 Bacteria 28923
189 Ga0307513_10045647 3300031456 Bacteria 4787
190 Ga0307408_100063620 3300031548 Bacteria 2699
191 Ga0307408_100079021 3300031548 Bacteria 2453
192 Ga0307514_10035377 3300031649 Bacteria 3975
193 Ga0307516_10023636 3300031730 Bacteria 6292
194 Ga0307405_10003231 3300031731 Bacteria 7432
195 Ga0307405_10059710 3300031731 Bacteria 2404
196 Ga0307405_10102228 3300031731 Bacteria 1924
197 Ga0307405_10170105 3300031731 Bacteria 1553
198 Ga0307410_10105245 3300031852 Bacteria 2031
199 Ga0307406_10001508 3300031901 Bacteria 12853
200 Ga0307412_10003780 3300031911 Bacteria 8413
201 Ga0307414_10014116 3300032004 Bacteria 4774
202 Ga0307411_10083226 3300032005 Bacteria 2209
203 Ga0307411_10098595 3300032005 Bacteria 2060
204 Ga0307510_10000109 3300033180 Bacteria 65353
205 Ga0395905_0009187 3300037471 Bacteria 9678
206 Ga0439436_0008222 3300041404 Bacteria 3206
207 Ga0439436_0010473 3300041404 Bacteria 2827
208 Ga0439447_010896 3300041407 Bacteria 2680
209 Ga0439466_0005840 3300041411 Bacteria 4688
210 Ga0439465_0000294 3300041413 Bacteria 14107
211 Ga0451853_2290554 3300041512 Bacteria 2046
212 Ga0439433_0001790 3300041999 Bacteria 4468
213 Ga0439433_0014642 3300041999 Bacteria 1727
214 Ga0439442_002957 3300042002 Bacteria 3350
215 Ga0439432_007882 3300042006 Bacteria 3754
216 Ga0439449_0012008 3300042007 Bacteria 3254
217 Ga0439449_0028602 3300042007 Bacteria 2077
218 Ga0439452_004972 3300042010 Bacteria 4352
219 Ga0439457_013080 3300042014 Bacteria 1865
220 Ga0439462_0009362 3300042015 Bacteria 2476
221 Ga0450910_001215 3300042147 Bacteria 3207
222 Ga0439446_0003127 3300042156 Bacteria 4072
223 Ga0439446_0031743 3300042156 Bacteria 1529
224 Ga0450918_001143 3300042531 Bacteria 5444
225 Ga0451577_0072898 3300042876 Bacteria 3064
226 Ga0453683_0007056 3300044673 Bacteria 7654
227 Ga0466965_0013343 3300044683 Bacteria 3877
228 Ga0451576_0021669 3300045051 Bacteria 6981
229 Ga0451576_0390735 3300045051 Bacteria 1458
230 Ga0495627_005557 3300046453 Bacteria 5053
231 Ga0495627_015540 3300046453 Bacteria 2626
232 Ga0495627_015872 3300046453 Bacteria 2591
233 Ga0495627_019229 3300046453 Bacteria 2294
234 Ga0495590_0000049 3300046457 Bacteria 113002
235 Ga0495590_0003539 3300046457 Bacteria 6365
236 Ga0495590_0024748 3300046457 Bacteria 2114
237 Ga0495591_000456 3300046458 Bacteria 33134
238 Ga0495629_0062722 3300046459 Bacteria 2595
239 Ga0495638_0004900 3300046460 Bacteria 10064
240 Ga0495638_0022925 3300046460 Bacteria 4092
241 Ga0495650_0007724 3300046471 Bacteria 6408
242 Ga0495650_0046497 3300046471 Bacteria 1821
243 Ga0495582_0007810 3300046473 Bacteria 5914
244 Ga0495605_0002224 3300046474 Bacteria 12116
245 Ga0495605_0014954 3300046474 Bacteria 4231
246 Ga0495605_0055769 3300046474 Bacteria 1907
247 Ga0495584_0000189 3300046491 Bacteria 43548
248 Ga0495584_0001749 3300046491 Bacteria 12670
249 Ga0495584_0012713 3300046491 Bacteria 4296
250 Ga0495584_0035077 3300046491 Bacteria 2535
251 Ga0495585_0001953 3300046492 Bacteria 15407
252 Ga0495585_0011657 3300046492 Bacteria 5200
253 Ga0495585_0012315 3300046492 Bacteria 5039
254 Ga0495585_0014402 3300046492 Bacteria 4608
255 Ga0495585_0028239 3300046492 Bacteria 3200
256 Ga0495594_0014414 3300046499 Bacteria 4143
257 Ga0495594_0027877 3300046499 Bacteria 3045
258 Ga0495594_0048344 3300046499 Bacteria 2337
259 Ga0495594_0072138 3300046499 Bacteria 1920
260 Ga0495596_0000778 3300046500 Bacteria 19414
261 Ga0495596_0001924 3300046500 Bacteria 11506
262 Ga0495596_0009290 3300046500 Bacteria 4328
263 Ga0495596_0013432 3300046500 Bacteria 3474
264 Ga0495596_0014290 3300046500 Bacteria 3345
265 Ga0495596_0043414 3300046500 Bacteria 1772
266 Ga0495607_0018291 3300046501 Bacteria 4470
267 Ga0495607_0036952 3300046501 Bacteria 2937
268 Ga0495607_0065411 3300046501 Bacteria 2050
269 Ga0495583_0000068 3300046506 Bacteria 188922
270 Ga0495583_0009580 3300046506 Bacteria 5769
271 Ga0495583_0017223 3300046506 Bacteria 3846
272 Ga0495583_0018138 3300046506 Bacteria 3713
273 Ga0495583_0019244 3300046506 Bacteria 3568
274 Ga0495583_0022496 3300046506 Bacteria 3214
275 Ga0495610_0000442 3300046512 Bacteria 42791
276 Ga0495616_0000817 3300046513 Bacteria 22704
277 Ga0495616_0011365 3300046513 Bacteria 5107
278 Ga0495616_0027279 3300046513 Bacteria 3032
279 Ga0495616_0028617 3300046513 Bacteria 2949
280 Ga0495616_0034665 3300046513 Bacteria 2618
281 Ga0495620_0047724 3300046515 Bacteria 1841
282 Ga0495631_0001994 3300046518 Bacteria 11931
283 Ga0495631_0003028 3300046518 Bacteria 9292
284 Ga0495631_0005448 3300046518 Bacteria 6657
285 Ga0495631_0005904 3300046518 Bacteria 6375
286 Ga0495631_0019955 3300046518 Bacteria 3136
287 Ga0495631_0022699 3300046518 Bacteria 2916
288 Ga0495631_0094318 3300046518 Bacteria 1288
289 Ga0495632_0000887 3300046519 Bacteria 26268
290 Ga0495632_0000946 3300046519 Bacteria 25368
291 Ga0495632_0066619 3300046519 Bacteria 1737
292 Ga0495637_0000014 3300046520 Bacteria 228956
293 Ga0495637_0032633 3300046520 Bacteria 2292
294 Ga0495643_0027595 3300046522 Bacteria 3189
295 Ga0495643_0075099 3300046522 Bacteria 1769
296 Ga0495644_0003582 3300046523 Bacteria 6127
297 Ga0495644_0045345 3300046523 Bacteria 1653
298 Ga0495648_0009209 3300046524 Bacteria 7682
299 Ga0495648_0042362 3300046524 Bacteria 2864
300 Ga0495666_0001223 3300046526 Bacteria 12419
301 Ga0495666_0005745 3300046526 Bacteria 6253
302 Ga0495666_0018308 3300046526 Bacteria 3486
303 Ga0495642_0000657 3300046528 Bacteria 17307
304 Ga0495642_0015988 3300046528 Bacteria 2921
305 Ga0495642_0016446 3300046528 Bacteria 2882
306 Ga0495654_0001281 3300046530 Bacteria 17634
307 Ga0495654_0013926 3300046530 Bacteria 4291
308 Ga0495640_0056556 3300046533 Bacteria 2680
309 Ga0495609_0009700 3300046538 Bacteria 4644
310 Ga0495609_0018662 3300046538 Bacteria 3213
311 Ga0495609_0031399 3300046538 Bacteria 2415
312 Ga0495609_0092202 3300046538 Bacteria 1317
313 Ga0495621_0043741 3300046539 Bacteria 1580
314 Ga0495597_0002422 3300046542 Bacteria 11860
315 Ga0495622_0006675 3300046557 Bacteria 5350
316 Ga0495622_0019767 3300046557 Bacteria 3135
317 Ga0495622_0034608 3300046557 Bacteria 2356
318 Ga0495633_0004436 3300046558 Bacteria 8931
319 Ga0495668_0000768 3300046616 Bacteria 37462
320 Ga0495668_0028886 3300046616 Bacteria 3135
321 Ga0495668_0039309 3300046616 Bacteria 2641
322 Ga0495668_0107325 3300046616 Bacteria 1527
323 Ga0495611_0000377 3300046648 Bacteria 28700
324 Ga0495611_0004255 3300046648 Bacteria 6228
325 Ga0495611_0028017 3300046648 Bacteria 2466
326 Ga0495625_0000245 3300046660 Bacteria 85443
327 Ga0495625_0001493 3300046660 Bacteria 28141
328 Ga0495625_0023747 3300046660 Bacteria 4680
329 Ga0495635_0156854 3300046663 Bacteria 1549
330 Ga0495661_0000932 3300046665 Bacteria 26643
331 Ga0495661_0053598 3300046665 Bacteria 2424
332 Ga0495661_0077890 3300046665 Bacteria 1919
333 Ga0495661_0080429 3300046665 Bacteria 1880
334 Ga0495588_0014996 3300046674 Bacteria 3721
335 Ga0495588_0018236 3300046674 Bacteria 3418
336 Ga0495588_0062580 3300046674 Bacteria 1929
337 Ga0495669_0000218 3300046684 Bacteria 34510
338 Ga0495669_0001840 3300046684 Bacteria 8688
339 Ga0495669_0009191 3300046684 Bacteria 4164
340 Ga0495669_0012758 3300046684 Bacteria 3577
341 Ga0495624_0008402 3300046690 Bacteria 7200
342 Ga0495624_0066303 3300046690 Bacteria 2254
343 Ga0495670_0032292 3300046691 Bacteria 2603
344 Ga0495670_0038697 3300046691 Bacteria 2378
345 Ga0495670_0068482 3300046691 Bacteria 1793
346 Ga0495671_0027587 3300046692 Bacteria 2931
347 Ga0495671_0040202 3300046692 Bacteria 2359
348 Ga0495671_0048113 3300046692 Bacteria 2128
349 Ga0495649_0000039 3300046694 Bacteria 126399
350 Ga0495649_0000255 3300046694 Bacteria 47515
351 Ga0495649_0019899 3300046694 Bacteria 3768
352 Ga0495649_0057152 3300046694 Bacteria 2104
353 Ga0495589_0004718 3300046794 Bacteria 7234
354 Ga0495589_0020133 3300046794 Bacteria 3413
355 Ga0495589_0025318 3300046794 Bacteria 3011
356 Ga0495660_0032572 3300046810 Bacteria 2926
357 Ga0495660_0056801 3300046810 Bacteria 2114
358 Ga0495660_0076544 3300046810 Bacteria 1762
359 Ga0495672_0000102 3300047320 Bacteria 137373
360 Ga0495672_0003038 3300047320 Bacteria 14731
361 Ga0495676_0000034 3300047321 Bacteria 124977
362 Ga0495676_0046415 3300047321 Bacteria 3525
363 Ga0495676_0054703 3300047321 Bacteria 3170
364 Ga0495683_0000833 3300047323 Bacteria 21993
365 Ga0495683_0030498 3300047323 Bacteria 2750
366 Ga0495683_0049174 3300047323 Bacteria 2112
367 Ga0495687_000060 3300047443 Bacteria 179124
368 Ga0495687_002333 3300047443 Bacteria 15437
369 Ga0495677_0004370 3300047445 Bacteria 5433
370 Ga0495677_0010117 3300047445 Bacteria 3469
371 Ga0495679_005605 3300047446 Bacteria 5536
372 Ga0495685_002470 3300047447 Bacteria 5792
373 Ga0495685_007234 3300047447 Bacteria 3659
374 Ga0495681_0001235 3300047470 Bacteria 19424
375 Ga0495681_0020172 3300047470 Bacteria 3621
376 Ga0495681_0043511 3300047470 Bacteria 2165
377 Ga0495686_0000048 3300047472 Bacteria 278044
378 Ga0495686_0002274 3300047472 Bacteria 18494
379 Ga0495686_0015172 3300047472 Bacteria 5275
380 Ga0495602_0156874 3300048088 Bacteria 1781
381 Ga0495614_0006982 3300048089 Bacteria 5041
382 Ga0495614_0015166 3300048089 Bacteria 3362
383 Ga0495626_0008646 3300048091 Bacteria 5563
384 Ga0495626_0017624 3300048091 Bacteria 3602
385 Ga0495626_0037230 3300048091 Bacteria 2313
386 Ga0495626_0039668 3300048091 Bacteria 2227
387 Ga0495626_0040650 3300048091 Bacteria 2195
388 Ga0496100_0003754 3300048903 Bacteria 7954
389 Ga0496100_0038582 3300048903 Bacteria 3028
390 Ga0496100_0065376 3300048903 Bacteria 2410
391 Ga0496101_0051878 3300048904 Bacteria 2956
392 Ga0496101_0075302 3300048904 Bacteria 2484
393 Ga0496102_0014323 3300048905 Bacteria 6888
394 Ga0496102_0027897 3300048905 Bacteria 5043
395 Ga0496102_0034998 3300048905 Bacteria 4520
396 Ga0496102_0045723 3300048905 Bacteria 3975
397 Ga0496104_0006940 3300048907 Bacteria 9990
398 Ga0496105_0057232 3300048908 Bacteria 3219
399 Ga0496105_0092607 3300048908 Bacteria 2496
400 Ga0496106_0000007 3300048909 Bacteria 248548
401 Ga0496106_0059473 3300048909 Bacteria 2895
402 Ga0496109_0031638 3300048912 Bacteria 4751
403 Ga0496110_0000719 3300048913 Bacteria 22855
404 Ga0496110_0033809 3300048913 Bacteria 4425
405 Ga0496110_0041222 3300048913 Bacteria 4028
406 Ga0496110_0105681 3300048913 Bacteria 2526
407 Ga0496112_0099540 3300048915 Bacteria 2877
408 Ga0496113_0064772 3300048916 Bacteria 2764
409 Ga0496116_0022751 3300048919 Bacteria 4688
410 Ga0496116_0047200 3300048919 Bacteria 2900
411 Ga0496116_0061687 3300048919 Bacteria 2426
412 Ga0496117_0070008 3300048920 Bacteria 2359
413 Ga0496118_0015310 3300048921 Bacteria 7108
414 Ga0496118_0033324 3300048921 Bacteria 4228
415 Ga0496118_0063137 3300048921 Bacteria 2727
416 Ga0496118_0085575 3300048921 Bacteria 2194
417 Ga0496121_0008318 3300048924 Bacteria 12263
418 Ga0496122_0000337 3300048925 Bacteria 101830
419 Ga0496122_0002995 3300048925 Bacteria 22991
420 Ga0496122_0091817 3300048925 Bacteria 2066
421 Ga0496123_0000905 3300048926 Bacteria 46722
422 Ga0496123_0006291 3300048926 Bacteria 11545
423 Ga0496123_0098335 3300048926 Bacteria 1711
424 Ga0496124_0074351 3300048927 Bacteria 2809
425 Ga0496125_0022086 3300048928 Bacteria 5916
426 Ga0496125_0100605 3300048928 Bacteria 2130
427 Ga0496126_0000065 3300048929 Bacteria 252549
428 Ga0495678_000150 3300049459 Bacteria 84562
429 Ga0495678_002016 3300049459 Bacteria 14566
430 Ga0495678_023674 3300049459 Bacteria 2664
431 Ga0495682_0000494 3300049460 Bacteria 27318
432 Ga0495682_0006013 3300049460 Bacteria 4958
433 Ga0495682_0023015 3300049460 Bacteria 2327
434 Ga0495682_0023582 3300049460 Bacteria 2296
435 Ga0501033_0030346 3300049570 Bacteria 4063
436 Ga0501047_0025856 3300049581 Bacteria 5645
437 Ga0501225_0005945 3300049705 Bacteria 3573
438 Ga0501262_002421 3300049759 Bacteria 2115
439 Ga0501035_0009870 3300049822 Bacteria 8861
440 Ga0501035_0064926 3300049822 Bacteria 3243
441 Ga0501044_0000022 3300049823 Bacteria 201689
442 Ga0501044_0002878 3300049823 Bacteria 19586
443 nmdc:mga03683_10147_c1 3300050489 Bacteria 3371
444 nmdc:mga03683_16812_c2 3300050489 Bacteria 2178
445 nmdc:mga03683_871_c1 3300050489 Bacteria 8700
446 nmdc:mga03n38_12586_c1 3300050490 Bacteria 3189
447 nmdc:mga00v17_13763_c1 3300050491 Bacteria 4497
448 nmdc:mga00v17_7488_c1 3300050491 Bacteria 5827
449 nmdc:mga0yw44_16395_c1 3300050492 Bacteria 4001
450 nmdc:mga0k408_1592_c1 3300050493 Bacteria 12280
451 nmdc:mga0k408_7436_c1 3300050493 Bacteria 5849
452 nmdc:mga0k408_7971_c2 3300050493 Bacteria 5160
453 nmdc:mga0k408_89142_c1 3300050493 Bacteria 1811
454 nmdc:mga0k408_9254_c1 3300050493 Bacteria 5308
455 nmdc:mga07m45_35196_c1 3300050496 Bacteria 2785
456 nmdc:mga07m45_42693_c1 3300050496 Bacteria 2543
457 nmdc:mga07m45_683_c1 3300050496 Bacteria 14405
458 Ga0500643_001764 3300053087 Bacteria 11905
459 Ga0500651_0000167 3300053093 Bacteria 42663
460 Ga0500651_0013064 3300053093 Bacteria 5047
461 Ga0500571_000040 3300053110 Bacteria 40510
462 Ga0500593_038068 3300053117 Bacteria 2152
463 Ga0500607_006400 3300053121 Bacteria 7445
464 Ga0500608_004410 3300053122 Bacteria 5446
465 Ga0500608_048174 3300053122 Bacteria 2047
466 Ga0500626_028632 3300053128 Bacteria 2514
467 Ga0500655_001075 3300053133 Bacteria 5252
468 Ga0500658_0002017 3300053134 Bacteria 7928
469 Ga0500658_0002095 3300053134 Bacteria 7759
470 Ga0500568_0007188 3300053139 Bacteria 5489
471 Ga0500616_0014204 3300053153 Bacteria 4583
472 Ga0500627_0005195 3300053158 Bacteria 4294
473 2513227696 2513020051 Bacteria 6053213
474 2599625598 2599185214 Bacteria 8209958
475 2599673611 2599185226 Bacteria 8233575
476 2599683281 2599185227 Bacteria 8246414
477 2599695231 2599185229 Bacteria 8216126
478 2644026752 2643221603 Bacteria 6147767
479 2644162304 2643221628 Bacteria 5745828
480 2644324465 2643221658 Bacteria 6064537
481 2644396306 2643221672 Bacteria 6322190
482 2644464648 2643221683 Bacteria 5749203
483 2738719190 2738541277 Bacteria 7458140
484 2738880211 2738541307 Bacteria 8606193
485 2739281952 2738543019 Bacteria 7459457
486 2739612452 2739367655 Bacteria 4051151
487 2819599690 2818991446 Bacteria 7757362
488 2831271778 2831265667 Bacteria 7184833
489 2838055626 2838054893 Bacteria 7451788
490 2842682675 2842677519 Bacteria 5615038
491 2842735861 2842733646 Bacteria 5716726
492 2857360808 2857357740 Bacteria 9937880
493 2881928662 2881927736 Bacteria 3993927
494 2883087863 2883087390 Bacteria 9532701
495 2885197377 2885192300 Bacteria 5882526
496 2885200840 2885198086 Bacteria 7212419
497 2885214377 2885211737 Bacteria 7212420
498 2899927677 2899924645 Bacteria 7487985
499 2900639629 2900634093 Bacteria 10263517
500 2904450621 2904449895 Bacteria 6927402
501 2904459879 2904456579 Bacteria 6819253
502 2904547755 2904541872 Bacteria 8915136
503 2919462850 2919462493 Bacteria 5817112
504 2919708742 2919704043 Bacteria 5560311
505 2928042046 2928037797 Bacteria 7273642
506 2928049610 2928044640 Bacteria 7271509
507 2928051716 2928051484 Bacteria 7773759
508 2928065592 2928064002 Bacteria 7419480
509 2928073059 2928070936 Bacteria 8062541
510 2928086847 2928084124 Bacteria 7159212
511 2928120225 2928115317 Bacteria 6477646
512 2929167004 2929160207 Bacteria 9075316
513 2929521338 2929520902 Bacteria 6765052
514 2945913792 2945909444 Bacteria 7065066
515 2945949355 2945945610 Bacteria 5951079
516 2945973397 2945972063 Bacteria 6086495
517 2945990816 2945984333 Bacteria 7358892
518 2954771002 2954767861 Bacteria 5535784
519 Ga0105243_10002077
520 JGI25152J39213_1002713
521 JGI25150J39212_1000449
522 JGI25159J45721_1016891
523 JGI25151J46595_10000775
524 JGI25151J46595_10001976
525 JGI25151J46595_10003527
526 JGI25151J46595_10016368
527 rootH2_10000639
528 rootL2_10053547
529 rootH1_10077330
530 Ga0006562J51391_1104210
531 Ga0055535_1000674
532 Ga0055542_1000022
533 Ga0055529_1001690
534 Ga0055537_1000134
535 Ga0055536_1001312
536 Ga0055536_1002825
537 Ga0055536_1013506
538 Ga0055534_1000088
539 Ga0055534_1002458
540 Ga0055528_1000493
541 Ga0055530_10000353
542 Ga0055530_10004488
543 Ga0055540_1003252
544 Ga0055540_1003873
545 Ga0055540_1010241
546 Ga0055531_10003937
547 Ga0055543_1001125
548 Ga0055543_1007736
549 Ga0065165_1002482
550 Ga0065165_1003199
551 Ga0070658_10057855
552 Ga0070670_100012443
553 Ga0070666_10029535
554 Ga0068868_100009574
555 Ga0070661_100032326
556 Ga0070668_100033088
557 Ga0070668_100151262
558 Ga0070675_100123514
559 Ga0070667_100007851
560 Ga0070678_100062643
561 Ga0070662_100045814
562 Ga0068853_100015297
563 Ga0070672_100095295
564 Ga0070664_100034669
565 Ga0070664_100045096
566 Ga0068859_100382031
567 Ga0068864_100054846
568 Ga0068851_10014260
569 Ga0068858_100050719
570 Ga0068860_100039137
571 Ga0068862_100143216
572 Ga0068862_100249239
573 Ga0075365_10025612
574 Ga0075365_10028890
575 Ga0075368_10021530
576 Ga0075363_100039817
577 Ga0075363_100060258
578 Ga0075363_100105825
579 Ga0075364_10039599
580 Ga0075362_10001557
581 Ga0075362_10016388
582 Ga0075362_10019060
583 Ga0075362_10059280
584 Ga0075369_10050626
585 Ga0075366_10008051
586 Ga0075366_10008256
587 Ga0075366_10022124
588 Ga0075366_10033547
589 Ga0075370_10009931
590 Ga0075370_10017168
591 Ga0075370_10018638
592 Ga0097620_100382013
593 Ga0099826_10016433
594 Ga0105240_10261175
595 Ga0105243_10001362
596 Ga0105243_10065010
597 Ga0105248_10017044
598 Ga0105248_10172547
599 Ga0105238_10064996
600 Ga0099796_10022148
601 Ga0157370_10046692
602 Ga0157369_10050853
603 Ga0163162_10010459
604 Ga0163162_10038765
605 Ga0157375_10055733
606 Ga0182008_10013840
607 Ga0157379_10021538
608 Ga0157379_10033507
609 Ga0182006_1003413
610 Ga0182006_1037892
611 Ga0183362_10001
612 Ga0163161_10000677
613 Ga0163161_10019153
614 Ga0209672_101908
615 Ga0209147_100834
616 Ga0209258_100009
617 Ga0207425_1000622
618 Ga0209148_1000007
619 Ga0209129_1000024
620 Ga0209129_1000085
621 Ga0209129_1006184
622 Ga0209565_1000046
623 Ga0209565_1000460
624 Ga0209455_1000566
625 Ga0209673_1000058
626 Ga0209673_1000571
627 Ga0209673_1000585
628 Ga0209673_1013344
629 Ga0209673_1033699
630 Ga0209130_1000801
631 Ga0209130_1001774
632 Ga0209130_1002358
633 Ga0209675_1000010
634 Ga0209675_1000387
635 Ga0209675_1001391
636 Ga0209675_1002180
637 Ga0209676_1000028
638 Ga0209676_1000098
639 Ga0209676_1000173
640 Ga0209676_1000194
641 Ga0209676_1005526
642 Ga0209676_1006445
643 Ga0209025_1000122
644 Ga0209025_1000267
645 Ga0209025_1000382
646 Ga0209025_1005401
647 Ga0209025_1045048
648 Ga0209564_1000183
649 Ga0209564_1000198
650 Ga0209758_1000049
651 Ga0209050_1000002
652 Ga0209050_1000122
653 Ga0209050_1000554
654 Ga0209256_1000098
655 Ga0209256_1000140
656 Ga0207426_1000038
657 Ga0207426_1000053
658 Ga0209051_1000015
659 Ga0209051_1000159
660 Ga0209051_1000194
661 Ga0209051_1000282
662 Ga0209051_1000597
663 Ga0209051_1001760
664 Ga0209051_1013154
665 Ga0209051_1013188
666 Ga0209257_1000002
667 Ga0209257_1000475
668 Ga0209257_1012069
669 Ga0209257_1013554
670 Ga0207680_10049177
671 Ga0207652_10146148
672 Ga0207681_10007610
673 Ga0207644_10183230
674 Ga0207706_10083407
675 Ga0207709_10000285
676 Ga0207709_10000702
677 Ga0207709_10006027
678 Ga0207691_10091968
679 Ga0207711_10056939
680 Ga0207679_10018262
681 Ga0207668_10135396
682 Ga0207703_10027382
683 Ga0207639_10051640
684 Ga0207641_10028333
685 Ga0207641_10072001
686 Ga0207648_10153530
687 Ga0207683_10115406
688 Ga0207698_10110315
689 Ga0209282_1032293
690 Ga0268264_10018614
691 Ga0307515_10000041
692 Ga0307515_10000195
693 Ga0307515_10184446
694 Ga0307515_10206663
695 Ga0316177_1038353
696 Ga0316176_1184500
697 Ga0314311_1073106
698 Ga0316183_1066259
699 Ga0265330_10008969
700 Ga0265332_10001322
701 Ga0265328_10022370
702 Ga0265325_10028172
703 Ga0265331_10001354
704 Ga0265327_10001008
705 Ga0265327_10001077
706 Ga0265327_10001501
707 Ga0307513_10045647
708 Ga0307408_100063620
709 Ga0307408_100079021
710 Ga0307514_10035377
711 Ga0307516_10023636
712 Ga0307405_10003231
713 Ga0307405_10059710
714 Ga0307405_10102228
715 Ga0307405_10170105
716 Ga0307410_10105245
717 Ga0307406_10001508
718 Ga0307412_10003780
719 Ga0307414_10014116
720 Ga0307411_10083226
721 Ga0307411_10098595
722 Ga0307510_10000109
723 Ga0395905_0009187
724 Ga0439436_0008222
725 Ga0439436_0010473
726 Ga0439447_010896
727 Ga0439466_0005840
728 Ga0439465_0000294
729 Ga0451853_2290554
730 Ga0439433_0001790
731 Ga0439433_0014642
732 Ga0439442_002957
733 Ga0439432_007882
734 Ga0439449_0012008
735 Ga0439449_0028602
736 Ga0439452_004972
737 Ga0439457_013080
738 Ga0439462_0009362
739 Ga0450910_001215
740 Ga0439446_0003127
741 Ga0439446_0031743
742 Ga0450918_001143
743 Ga0451577_0072898
744 Ga0453683_0007056
745 Ga0466965_0013343
746 Ga0451576_0021669
747 Ga0451576_0390735
748 Ga0495627_005557
749 Ga0495627_015540
750 Ga0495627_015872
751 Ga0495627_019229
752 Ga0495590_0000049
753 Ga0495590_0003539
754 Ga0495590_0024748
755 Ga0495591_000456
756 Ga0495629_0062722
757 Ga0495638_0004900
758 Ga0495638_0022925
759 Ga0495650_0007724
760 Ga0495650_0046497
761 Ga0495582_0007810
762 Ga0495605_0002224
763 Ga0495605_0014954
764 Ga0495605_0055769
765 Ga0495584_0000189
766 Ga0495584_0001749
767 Ga0495584_0012713
768 Ga0495584_0035077
769 Ga0495585_0001953
770 Ga0495585_0011657
771 Ga0495585_0012315
772 Ga0495585_0014402
773 Ga0495585_0028239
774 Ga0495594_0014414
775 Ga0495594_0027877
776 Ga0495594_0048344
777 Ga0495594_0072138
778 Ga0495596_0000778
779 Ga0495596_0001924
780 Ga0495596_0009290
781 Ga0495596_0013432
782 Ga0495596_0014290
783 Ga0495596_0043414
784 Ga0495607_0018291
785 Ga0495607_0036952
786 Ga0495607_0065411
787 Ga0495583_0000068
788 Ga0495583_0009580
789 Ga0495583_0017223
790 Ga0495583_0018138
791 Ga0495583_0019244
792 Ga0495583_0022496
793 Ga0495610_0000442
794 Ga0495616_0000817
795 Ga0495616_0011365
796 Ga0495616_0027279
797 Ga0495616_0028617
798 Ga0495616_0034665
799 Ga0495620_0047724
800 Ga0495631_0001994
801 Ga0495631_0003028
802 Ga0495631_0005448
803 Ga0495631_0005904
804 Ga0495631_0019955
805 Ga0495631_0022699
806 Ga0495631_0094318
807 Ga0495632_0000887
808 Ga0495632_0000946
809 Ga0495632_0066619
810 Ga0495637_0000014
811 Ga0495637_0032633
812 Ga0495643_0027595
813 Ga0495643_0075099
814 Ga0495644_0003582
815 Ga0495644_0045345
816 Ga0495648_0009209
817 Ga0495648_0042362
818 Ga0495666_0001223
819 Ga0495666_0005745
820 Ga0495666_0018308
821 Ga0495642_0000657
822 Ga0495642_0015988
823 Ga0495642_0016446
824 Ga0495654_0001281
825 Ga0495654_0013926
826 Ga0495640_0056556
827 Ga0495609_0009700
828 Ga0495609_0018662
829 Ga0495609_0031399
830 Ga0495609_0092202
831 Ga0495621_0043741
832 Ga0495597_0002422
833 Ga0495622_0006675
834 Ga0495622_0019767
835 Ga0495622_0034608
836 Ga0495633_0004436
837 Ga0495668_0000768
838 Ga0495668_0028886
839 Ga0495668_0039309
840 Ga0495668_0107325
841 Ga0495611_0000377
842 Ga0495611_0004255
843 Ga0495611_0028017
844 Ga0495625_0000245
845 Ga0495625_0001493
846 Ga0495625_0023747
847 Ga0495635_0156854
848 Ga0495661_0000932
849 Ga0495661_0053598
850 Ga0495661_0077890
851 Ga0495661_0080429
852 Ga0495588_0014996
853 Ga0495588_0018236
854 Ga0495588_0062580
855 Ga0495669_0000218
856 Ga0495669_0001840
857 Ga0495669_0009191
858 Ga0495669_0012758
859 Ga0495624_0008402
860 Ga0495624_0066303
861 Ga0495670_0032292
862 Ga0495670_0038697
863 Ga0495670_0068482
864 Ga0495671_0027587
865 Ga0495671_0040202
866 Ga0495671_0048113
867 Ga0495649_0000039
868 Ga0495649_0000255
869 Ga0495649_0019899
870 Ga0495649_0057152
871 Ga0495589_0004718
872 Ga0495589_0020133
873 Ga0495589_0025318
874 Ga0495660_0032572
875 Ga0495660_0056801
876 Ga0495660_0076544
877 Ga0495672_0000102
878 Ga0495672_0003038
879 Ga0495676_0000034
880 Ga0495676_0046415
881 Ga0495676_0054703
882 Ga0495683_0000833
883 Ga0495683_0030498
884 Ga0495683_0049174
885 Ga0495687_000060
886 Ga0495687_002333
887 Ga0495677_0004370
888 Ga0495677_0010117
889 Ga0495679_005605
890 Ga0495685_002470
891 Ga0495685_007234
892 Ga0495681_0001235
893 Ga0495681_0020172
894 Ga0495681_0043511
895 Ga0495686_0000048
896 Ga0495686_0002274
897 Ga0495686_0015172
898 Ga0495602_0156874
899 Ga0495614_0006982
900 Ga0495614_0015166
901 Ga0495626_0008646
902 Ga0495626_0017624
903 Ga0495626_0037230
904 Ga0495626_0039668
905 Ga0495626_0040650
906 Ga0496100_0003754
907 Ga0496100_0038582
908 Ga0496100_0065376
909 Ga0496101_0051878
910 Ga0496101_0075302
911 Ga0496102_0014323
912 Ga0496102_0027897
913 Ga0496102_0034998
914 Ga0496102_0045723
915 Ga0496104_0006940
916 Ga0496105_0057232
917 Ga0496105_0092607
918 Ga0496106_0000007
919 Ga0496106_0059473
920 Ga0496109_0031638
921 Ga0496110_0000719
922 Ga0496110_0033809
923 Ga0496110_0041222
924 Ga0496110_0105681
925 Ga0496112_0099540
926 Ga0496113_0064772
927 Ga0496116_0022751
928 Ga0496116_0047200
929 Ga0496116_0061687
930 Ga0496117_0070008
931 Ga0496118_0015310
932 Ga0496118_0033324
933 Ga0496118_0063137
934 Ga0496118_0085575
935 Ga0496121_0008318
936 Ga0496122_0000337
937 Ga0496122_0002995
938 Ga0496122_0091817
939 Ga0496123_0000905
940 Ga0496123_0006291
941 Ga0496123_0098335
942 Ga0496124_0074351
943 Ga0496125_0022086
944 Ga0496125_0100605
945 Ga0496126_0000065
946 Ga0495678_000150
947 Ga0495678_002016
948 Ga0495678_023674
949 Ga0495682_0000494
950 Ga0495682_0006013
951 Ga0495682_0023015
952 Ga0495682_0023582
953 Ga0501033_0030346
954 Ga0501047_0025856
955 Ga0501225_0005945
956 Ga0501262_002421
957 Ga0501035_0009870
958 Ga0501035_0064926
959 Ga0501044_0000022
960 Ga0501044_0002878
961 nmdc:mga03683_10147_c1
962 nmdc:mga03683_16812_c2
963 nmdc:mga03683_871_c1
964 nmdc:mga03n38_12586_c1
965 nmdc:mga00v17_13763_c1
966 nmdc:mga00v17_7488_c1
967 nmdc:mga0yw44_16395_c1
968 nmdc:mga0k408_1592_c1
969 nmdc:mga0k408_7436_c1
970 nmdc:mga0k408_7971_c2
971 nmdc:mga0k408_89142_c1
972 nmdc:mga0k408_9254_c1
973 nmdc:mga07m45_35196_c1
974 nmdc:mga07m45_42693_c1
975 nmdc:mga07m45_683_c1
976 Ga0500643_001764
977 Ga0500651_0000167
978 Ga0500651_0013064
979 Ga0500571_000040
980 Ga0500593_038068
981 Ga0500607_006400
982 Ga0500608_004410
983 Ga0500608_048174
984 Ga0500626_028632
985 Ga0500655_001075
986 Ga0500658_0002017
987 Ga0500658_0002095
988 Ga0500568_0007188
989 Ga0500616_0014204
990 Ga0500627_0005195
991 2513227696
992 2599625598
993 2599673611
994 2599683281
995 2599695231
996 2644026752
997 2644162304
998 2644324465
999 2644396306
1000 2644464648
1001 2738719190
1002 2738880211
1003 2739281952
1004 2739612452
1005 2819599690
1006 2831271778
1007 2838055626
1008 2842682675
1009 2842735861
1010 2857360808
1011 2881928662
1012 2883087863
1013 2885197377
1014 2885200840
1015 2885214377
1016 2899927677
1017 2900639629
1018 2904450621
1019 2904459879
1020 2904547755
1021 2919462850
1022 2919708742
1023 2928042046
1024 2928049610
1025 2928051716
1026 2928065592
1027 2928073059
1028 2928086847
1029 2928120225
1030 2929167004
1031 2929521338
1032 2945913792
1033 2945949355
1034 2945973397
1035 2945990816
1036 2954771002

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03972

MmgE_PrpD_N

MmgE/PrpD N-terminal domain

15

259

0.97

PF19305

MmgE_PrpD_C

MmgE/PrpD C-terminal domain

277

448

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hp0-assembly1.cif.gz_A crystal structure of iminodisuccinate epimerase 0.9129 5 448
2hp0-assembly1.cif.gz_A crystal structure of iminodisuccinate epimerase 0.9012 5 448
7br9-assembly1.cif.gz_A crystal structure of mus musculus irg1 0.8998 8 445
6r6t-assembly1.cif.gz_A crystal structure of mouse cis-aconitate decarboxylase 0.8976 8 445
6r6t-assembly1.cif.gz_B crystal structure of mouse cis-aconitate decarboxylase 0.8888 4 445
ID Description Score Start End Superfamily
2hp3B01 Mainly Alpha;Orthogonal Bundle;2-methylcitrate dehydratase PrpD;2-methylcitrate dehydratase PrpD 0.9083 8 263 1.10.4100.10
1szqB02 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-methylcitrate dehydratase PrpD 0.8644 270 400 3.30.1330.120
5mviA02 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-methylcitrate dehydratase PrpD 0.8582 273 400 3.30.1330.120
af_O06582_36_312_1.10.4100.10 Mainly Alpha;Orthogonal Bundle;2-methylcitrate dehydratase PrpD;2-methylcitrate dehydratase PrpD 0.8572 1 273 1.10.4100.10
af_O06582_36_312_1.10.4100.10 Mainly Alpha;Orthogonal Bundle;2-methylcitrate dehydratase PrpD;2-methylcitrate dehydratase PrpD 0.8398 1 273 1.10.4100.10
ID Description Score Start End GO Terms
AF-A0A353Y886-F1-model_v4 2-methylcitrate dehydratase 0.9931 6 402 GO:0016829
AF-A0A353Y886-F1-model_v4 2-methylcitrate dehydratase 0.9832 6 402 GO:0016829
AF-A0A257JG64-F1-model_v4 2-methylcitrate dehydratase 0.9776 1 211 GO:0016829
AF-A0A1V0BIT4-F1-model_v4 Uncharacterized protein 0.9731 11 193 GO:0000287
GO:0006107
GO:0016829
AF-A0A257JG64-F1-model_v4 2-methylcitrate dehydratase 0.973 1 211 GO:0016829

Map