F458244

General Info

Members Datasets Scaffolds Average Seq Length
518 273 1036 238

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10010192|Ga0114129_1001019212
Length 270
Sequence MRVFLERISFSRQADKVIAMPDPETATGEVPRGRARMEPPDLSEKGASKGGQPQRSNERLFMQLLAFGGCHDARGLAKHLETAGIAGVLYADVNDPRGVAVLALTETPATFVDHVRPVLNSGPCADLTLKPEFTMLGRTYSLGYEPDLRDVLIDRPRRTVLNPAWPWAVWYPLRRSGRFAQLSAEEQRNILAEHGAIGMSYGAADYVHDVRLACHGLDRDDNDFVIGLIGKDLFPLSAIVQAMRKTQQTALYLDRLGPFFVGRALWQSPI

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
163 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
164 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
165 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
166 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
170 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
171 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
172 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
173 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
174 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
175 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
176 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
177 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
178 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
179 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
180 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
181 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
182 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
183 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
184 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
185 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
186 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
187 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
188 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
189 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
190 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
191 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
192 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
193 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
194 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
195 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
196 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
197 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
198 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
199 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
200 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
201 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
202 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
203 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
215 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
216 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
217 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
218 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
233 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
234 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
235 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
236 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
237 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
238 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
239 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
240 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
241 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
242 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
243 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
244 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
245 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
246 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
247 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
248 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
249 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
250 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
252 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
253 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
254 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
255 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
256 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
257 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
258 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
259 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
260 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
263 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
264 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
265 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
266 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
267 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
268 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
269 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
270 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
271 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
272 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
273 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.7
Nodule 0
Rhizoplane 4.05
Rhizosphere 93.24
Stem 0
Stem Tuber 0
Unclassified 13.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10010192 3300009147 Bacteria 13398
2 Ga0065712_10075893 3300005290 Bacteria 3769
3 Ga0065712_10171630 3300005290 Bacteria 1240
4 Ga0065715_10139928 3300005293 Bacteria 1869
5 Ga0065715_10179507 3300005293 Unclassified 1487
6 Ga0070676_10188994 3300005328 Bacteria 1343
7 Ga0070676_10499578 3300005328 Bacteria 863
8 Ga0070683_100003650 3300005329 Bacteria 12541
9 Ga0070683_100273396 3300005329 Bacteria 1607
10 Ga0070690_100049491 3300005330 Bacteria 2679
11 Ga0070670_100006265 3300005331 Bacteria 10071
12 Ga0070670_100021473 3300005331 Bacteria 5553
13 Ga0070670_100039177 3300005331 Bacteria 4075
14 Ga0070670_100205982 3300005331 Bacteria 1710
15 Ga0070677_10170094 3300005333 Bacteria 1029
16 Ga0068869_100049589 3300005334 Bacteria 3040
17 Ga0070666_10018108 3300005335 Bacteria 4523
18 Ga0070666_10076526 3300005335 Bacteria 2283
19 Ga0068868_100070842 3300005338 Bacteria 2780
20 Ga0070691_10002730 3300005341 Bacteria 7861
21 Ga0070687_100158978 3300005343 Unclassified 1334
22 Ga0070687_100166945 3300005343 Bacteria 1306
23 Ga0070661_100063140 3300005344 Bacteria 2720
24 Ga0070661_100082376 3300005344 Unclassified 2376
25 Ga0070668_100014229 3300005347 Bacteria 5944
26 Ga0070669_100106274 3300005353 Bacteria 2124
27 Ga0070675_100729945 3300005354 Bacteria 903
28 Ga0070671_100018222 3300005355 Bacteria 5700
29 Ga0070671_100069797 3300005355 Bacteria 2931
30 Ga0070674_100395985 3300005356 Bacteria 1127
31 Ga0070674_100813205 3300005356 Bacteria 808
32 Ga0070673_100013372 3300005364 Bacteria 5675
33 Ga0070673_100230399 3300005364 Bacteria 1607
34 Ga0070673_100264250 3300005364 Unclassified 1504
35 Ga0070688_100252757 3300005365 Bacteria 1255
36 Ga0070659_100059758 3300005366 Bacteria 3010
37 Ga0070659_100125533 3300005366 Unclassified 2082
38 Ga0070713_100024369 3300005436 Bacteria 4711
39 Ga0070701_10050052 3300005438 Bacteria 2162
40 Ga0070701_10056783 3300005438 Bacteria 2049
41 Ga0070701_10266725 3300005438 Bacteria 1040
42 Ga0070701_10377495 3300005438 Bacteria 892
43 Ga0070711_100034795 3300005439 Bacteria 3363
44 Ga0070705_100000617 3300005440 Bacteria 20539
45 Ga0070705_100359406 3300005440 Bacteria 1064
46 Ga0070700_100098028 3300005441 Bacteria 1926
47 Ga0070694_100093944 3300005444 Bacteria 2109
48 Ga0070694_100116046 3300005444 Bacteria 1914
49 Ga0070694_100824093 3300005444 Unclassified 762
50 Ga0070678_100113752 3300005456 Bacteria 2122
51 Ga0070678_100311067 3300005456 Bacteria 1342
52 Ga0070662_100039211 3300005457 Bacteria 3369
53 Ga0070662_100267064 3300005457 Bacteria 1380
54 Ga0070681_10851135 3300005458 Unclassified 830
55 Ga0068867_100001347 3300005459 Bacteria 16987
56 Ga0068867_100016238 3300005459 Bacteria 5288
57 Ga0070685_10088301 3300005466 Bacteria 1872
58 Ga0070685_10205709 3300005466 Unclassified 1282
59 Ga0070685_10330574 3300005466 Bacteria 1036
60 Ga0070706_100016855 3300005467 Bacteria 6747
61 Ga0070707_100001535 3300005468 Bacteria 22487
62 Ga0070707_100858574 3300005468 Unclassified 872
63 Ga0070699_100022096 3300005518 Bacteria 5481
64 Ga0070699_100027355 3300005518 Bacteria 4920
65 Ga0070684_100001965 3300005535 Bacteria 15101
66 Ga0070697_100012047 3300005536 Bacteria 6768
67 Ga0070697_100326676 3300005536 Bacteria 1322
68 Ga0070672_100043922 3300005543 Bacteria 3450
69 Ga0070672_100452331 3300005543 Bacteria 1106
70 Ga0070672_100605925 3300005543 Bacteria 954
71 Ga0070686_100150412 3300005544 Bacteria 1630
72 Ga0070695_100002551 3300005545 Bacteria 10518
73 Ga0070696_100006990 3300005546 Bacteria 7529
74 Ga0070696_100041820 3300005546 Bacteria 3167
75 Ga0070696_100188025 3300005546 Bacteria 1536
76 Ga0070693_100205455 3300005547 Bacteria 1282
77 Ga0070665_100022116 3300005548 Bacteria 6397
78 Ga0070704_100134988 3300005549 Bacteria 1918
79 Ga0068855_100340491 3300005563 Unclassified 1654
80 Ga0068855_100558922 3300005563 Bacteria 1238
81 Ga0070664_100002291 3300005564 Bacteria 15388
82 Ga0070664_100527983 3300005564 Bacteria 1090
83 Ga0068857_100013772 3300005577 Bacteria 7046
84 Ga0068854_100086321 3300005578 Bacteria 2326
85 Ga0068854_100284144 3300005578 Bacteria 1333
86 Ga0068856_100573394 3300005614 Bacteria 1150
87 Ga0068856_100813313 3300005614 Bacteria 954
88 Ga0068856_100874775 3300005614 Unclassified 918
89 Ga0070702_100570668 3300005615 Bacteria 843
90 Ga0068859_100133241 3300005617 Bacteria 2557
91 Ga0068859_100310864 3300005617 Bacteria 1669
92 Ga0068859_100419245 3300005617 Bacteria 1435
93 Ga0068864_100202735 3300005618 Bacteria 1823
94 Ga0068861_100021059 3300005719 Bacteria 4684
95 Ga0068861_100039266 3300005719 Bacteria 3531
96 Ga0068861_100065605 3300005719 Bacteria 2797
97 Ga0068863_100160833 3300005841 Bacteria 2151
98 Ga0068863_100282022 3300005841 Bacteria 1610
99 Ga0068863_100735447 3300005841 Unclassified 982
100 Ga0068858_100035206 3300005842 Bacteria 4644
101 Ga0068858_100411725 3300005842 Bacteria 1299
102 Ga0068860_100534054 3300005843 Bacteria 1174
103 Ga0068862_100058173 3300005844 Bacteria 3316
104 Ga0081538_10012792 3300005981 Bacteria 6702
105 Ga0070717_10472080 3300006028 Unclassified 1132
106 Ga0075365_10010439 3300006038 Bacteria 5411
107 Ga0075368_10026422 3300006042 Bacteria 2233
108 Ga0075364_10002130 3300006051 Bacteria 11077
109 Ga0070712_100002432 3300006175 Bacteria 11476
110 Ga0075367_10017938 3300006178 Bacteria 3895
111 Ga0075367_10150631 3300006178 Bacteria 1443
112 Ga0075366_10117113 3300006195 Bacteria 1604
113 Ga0097621_100136058 3300006237 Bacteria 2096
114 Ga0075428_100000339 3300006844 Bacteria 46286
115 Ga0075428_100007297 3300006844 Bacteria 12244
116 Ga0075428_100026189 3300006844 Bacteria 6458
117 Ga0075428_100080895 3300006844 Bacteria 3546
118 Ga0075428_100083026 3300006844 Bacteria 3496
119 Ga0075428_100212337 3300006844 Bacteria 2091
120 Ga0075430_100001386 3300006846 Bacteria 19674
121 Ga0075430_100014140 3300006846 Bacteria 6804
122 Ga0075430_100023064 3300006846 Bacteria 5293
123 Ga0075430_100040907 3300006846 Unclassified 3922
124 Ga0075430_100047481 3300006846 Bacteria 3626
125 Ga0075430_100331992 3300006846 Unclassified 1256
126 Ga0075431_100002162 3300006847 Bacteria 18799
127 Ga0075431_100018464 3300006847 Bacteria 7103
128 Ga0075431_100022938 3300006847 Bacteria 6380
129 Ga0075431_100064597 3300006847 Bacteria 3779
130 Ga0075431_100209012 3300006847 Bacteria 1994
131 Ga0075431_100231874 3300006847 Bacteria 1881
132 Ga0075433_10004176 3300006852 Bacteria 11213
133 Ga0075434_100093097 3300006871 Bacteria 3017
134 Ga0075434_100093602 3300006871 Bacteria 3009
135 Ga0075434_100163146 3300006871 Bacteria 2248
136 Ga0075434_100282262 3300006871 Bacteria 1680
137 Ga0075434_100407770 3300006871 Bacteria 1380
138 Ga0075429_100003547 3300006880 Bacteria 13292
139 Ga0075429_100053206 3300006880 Bacteria 3523
140 Ga0075429_100091997 3300006880 Bacteria 2646
141 Ga0075429_100196506 3300006880 Bacteria 1767
142 Ga0068865_100036378 3300006881 Bacteria 3319
143 Ga0075436_100209795 3300006914 Bacteria 1380
144 Ga0097620_100133241 3300006931 Bacteria 2557
145 Ga0097620_100310867 3300006931 Bacteria 1669
146 Ga0097620_100419257 3300006931 Bacteria 1435
147 Ga0075435_100009083 3300007076 Bacteria 7173
148 Ga0075435_100014120 3300007076 Bacteria 5960
149 Ga0075435_100024652 3300007076 Bacteria 4671
150 Ga0075435_100126680 3300007076 Bacteria 2135
151 Ga0105250_10134058 3300009092 Unclassified 1023
152 Ga0105240_10080890 3300009093 Bacteria 3994
153 Ga0111539_10000009 3300009094 Bacteria 375223
154 Ga0111539_10000996 3300009094 Bacteria 37109
155 Ga0111539_10019368 3300009094 Bacteria 8401
156 Ga0111539_10050897 3300009094 Bacteria 4935
157 Ga0111539_10305402 3300009094 Bacteria 1852
158 Ga0111539_10511023 3300009094 Bacteria 1399
159 Ga0105245_10029439 3300009098 Bacteria 4852
160 Ga0105245_10317455 3300009098 Bacteria 1534
161 Ga0105247_10024518 3300009101 Bacteria 3635
162 Ga0105247_10048732 3300009101 Bacteria 2602
163 Ga0114129_10000695 3300009147 Bacteria 42405
164 Ga0114129_10006087 3300009147 Bacteria 17103
165 Ga0114129_10009865 3300009147 Bacteria 13615
166 Ga0114129_10015148 3300009147 Bacteria 10976
167 Ga0114129_10060839 3300009147 Bacteria 5279
168 Ga0114129_10239801 3300009147 Bacteria 2437
169 Ga0105243_10015486 3300009148 Bacteria 5764
170 Ga0105243_10072096 3300009148 Bacteria 2795
171 Ga0105243_10804696 3300009148 Bacteria 927
172 Ga0105241_10140813 3300009174 Bacteria 1963
173 Ga0105242_10050612 3300009176 Bacteria 3383
174 Ga0105242_10140621 3300009176 Bacteria 2094
175 Ga0105248_10045155 3300009177 Bacteria 4941
176 Ga0105248_10555899 3300009177 Bacteria 1295
177 Ga0105249_10354664 3300009553 Bacteria 1487
178 Ga0105249_10484942 3300009553 Bacteria 1279
179 Ga0105249_10497628 3300009553 Bacteria 1264
180 Ga0157378_10160162 3300013297 Bacteria 2104
181 Ga0157378_10687417 3300013297 Bacteria 1042
182 Ga0163162_10160777 3300013306 Bacteria 2368
183 Ga0157372_10010311 3300013307 Bacteria 9928
184 Ga0157375_10215283 3300013308 Bacteria 2079
185 Ga0163163_10030740 3300014325 Bacteria 5178
186 Ga0163163_10033268 3300014325 Bacteria 4986
187 Ga0157380_10036757 3300014326 Bacteria 3791
188 Ga0157376_10070055 3300014969 Bacteria 2975
189 Ga0157376_10322879 3300014969 Unclassified 1468
190 Ga0206356_11431463 3300020070 Unclassified 879
191 Ga0207697_10000774 3300025315 Bacteria 18118
192 Ga0207697_10115487 3300025315 Unclassified 1152
193 Ga0207682_10047474 3300025893 Bacteria 1768
194 Ga0207642_10290747 3300025899 Unclassified 944
195 Ga0207688_10006424 3300025901 Bacteria 6402
196 Ga0207688_10064598 3300025901 Bacteria 2067
197 Ga0207680_10164739 3300025903 Bacteria 1489
198 Ga0207699_10080810 3300025906 Bacteria 2015
199 Ga0207699_10187478 3300025906 Unclassified 1394
200 Ga0207645_10010811 3300025907 Bacteria 6254
201 Ga0207645_10014428 3300025907 Bacteria 5287
202 Ga0207684_10015319 3300025910 Bacteria 6600
203 Ga0207654_10178829 3300025911 Bacteria 1383
204 Ga0207707_10188841 3300025912 Unclassified 1798
205 Ga0207707_10310400 3300025912 Unclassified 1363
206 Ga0207695_10312191 3300025913 Unclassified 1462
207 Ga0207663_10093730 3300025916 Bacteria 1999
208 Ga0207663_10433402 3300025916 Bacteria 1011
209 Ga0207662_10007722 3300025918 Bacteria 5861
210 Ga0207649_10036400 3300025920 Unclassified 2964
211 Ga0207649_10111129 3300025920 Bacteria 1831
212 Ga0207646_10017570 3300025922 Bacteria 6687
213 Ga0207681_10025459 3300025923 Bacteria 3806
214 Ga0207650_10050652 3300025925 Bacteria 3072
215 Ga0207659_10150848 3300025926 Bacteria 1815
216 Ga0207687_10025193 3300025927 Bacteria 3980
217 Ga0207700_10010285 3300025928 Bacteria 5892
218 Ga0207644_10055443 3300025931 Bacteria 2857
219 Ga0207644_10088568 3300025931 Bacteria 2302
220 Ga0207706_10153653 3300025933 Bacteria 2024
221 Ga0207706_10276178 3300025933 Bacteria 1466
222 Ga0207706_10303331 3300025933 Bacteria 1391
223 Ga0207686_10084111 3300025934 Bacteria 2084
224 Ga0207670_10360300 3300025936 Unclassified 1154
225 Ga0207669_10007845 3300025937 Bacteria 4971
226 Ga0207669_10222837 3300025937 Bacteria 1385
227 Ga0207704_10034227 3300025938 Bacteria 2897
228 Ga0207704_10041472 3300025938 Unclassified 2700
229 Ga0207704_10166720 3300025938 Unclassified 1574
230 Ga0207691_10061413 3300025940 Bacteria 3414
231 Ga0207691_10538098 3300025940 Bacteria 991
232 Ga0207711_10030540 3300025941 Bacteria 4545
233 Ga0207711_10109771 3300025941 Bacteria 2452
234 Ga0207711_10111603 3300025941 Unclassified 2432
235 Ga0207711_10157945 3300025941 Bacteria 2051
236 Ga0207711_10546877 3300025941 Bacteria 1080
237 Ga0207689_10199456 3300025942 Bacteria 1652
238 Ga0207689_10257537 3300025942 Bacteria 1443
239 Ga0207661_10006787 3300025944 Bacteria 8109
240 Ga0207679_10007076 3300025945 Bacteria 7113
241 Ga0207679_10257768 3300025945 Bacteria 1486
242 Ga0207679_10431604 3300025945 Unclassified 1165
243 Ga0207651_10004777 3300025960 Bacteria 6889
244 Ga0207651_10347951 3300025960 Unclassified 1247
245 Ga0207712_10439022 3300025961 Archaea 1105
246 Ga0207640_10018070 3300025981 Bacteria 4137
247 Ga0207640_10045126 3300025981 Bacteria 2828
248 Ga0207677_10011569 3300026023 Bacteria 5038
249 Ga0207677_10050699 3300026023 Bacteria 2809
250 Ga0207677_10567732 3300026023 Unclassified 991
251 Ga0207703_10181398 3300026035 Bacteria 1858
252 Ga0207703_10302797 3300026035 Bacteria 1458
253 Ga0207708_10033901 3300026075 Bacteria 3882
254 Ga0207708_10070695 3300026075 Bacteria 2672
255 Ga0207708_10088884 3300026075 Unclassified 2380
256 Ga0207702_10583325 3300026078 Bacteria 1096
257 Ga0207641_10157180 3300026088 Bacteria 2064
258 Ga0207641_10197927 3300026088 Bacteria 1851
259 Ga0207641_10492032 3300026088 Bacteria 1190
260 Ga0207648_10001525 3300026089 Bacteria 25514
261 Ga0207648_10166510 3300026089 Bacteria 1948
262 Ga0207648_10285641 3300026089 Bacteria 1476
263 Ga0207676_10071784 3300026095 Bacteria 2781
264 Ga0207674_10018570 3300026116 Bacteria 7553
265 Ga0207674_10018883 3300026116 Bacteria 7478
266 Ga0207675_100001868 3300026118 Bacteria 21066
267 Ga0207675_100043323 3300026118 Bacteria 4203
268 Ga0207675_100057360 3300026118 Bacteria 3633
269 Ga0207675_100075181 3300026118 Bacteria 3162
270 Ga0207675_100160018 3300026118 Bacteria 2147
271 Ga0207675_100374156 3300026118 Bacteria 1400
272 Ga0207683_10079258 3300026121 Bacteria 2912
273 Ga0207683_10150975 3300026121 Bacteria 2096
274 Ga0207683_10251943 3300026121 Bacteria 1611
275 Ga0207698_10179682 3300026142 Bacteria 1873
276 Ga0209967_1008910 3300027364 Bacteria 1387
277 Ga0209984_1019993 3300027424 Bacteria 913
278 Ga0210000_1005313 3300027462 Bacteria 1867
279 Ga0209995_1019457 3300027471 Bacteria 1121
280 Ga0209982_1003541 3300027552 Bacteria 2220
281 Ga0209983_1003116 3300027665 Bacteria 3563
282 Ga0209971_1000137 3300027682 Bacteria 21896
283 Ga0209971_1054151 3300027682 Bacteria 970
284 Ga0209966_1000354 3300027695 Bacteria 14029
285 Ga0209998_10000278 3300027717 Bacteria 16052
286 Ga0209813_10022804 3300027866 Unclassified 1774
287 Ga0207428_10002779 3300027907 Bacteria 17386
288 Ga0207428_10028750 3300027907 Bacteria 4615
289 Ga0207428_10055550 3300027907 Bacteria 3148
290 Ga0207428_10177154 3300027907 Unclassified 1612
291 Ga0268266_10040804 3300028379 Bacteria 3957
292 Ga0268265_10045990 3300028380 Bacteria 3260
293 Ga0268265_10321319 3300028380 Bacteria 1402
294 Ga0268265_10335329 3300028380 Bacteria 1375
295 Ga0268265_10450584 3300028380 Bacteria 1202
296 Ga0268264_10139327 3300028381 Bacteria 2161
297 Ga0268264_10364954 3300028381 Unclassified 1379
298 Ga0307408_100014820 3300031548 Bacteria 5184
299 Ga0307408_100071983 3300031548 Unclassified 2558
300 Ga0307408_100171477 3300031548 Unclassified 1733
301 Ga0307408_100181237 3300031548 Bacteria 1689
302 Ga0307408_100319053 3300031548 Bacteria 1308
303 Ga0307405_10317785 3300031731 Bacteria 1188
304 Ga0307405_10619227 3300031731 Unclassified 886
305 Ga0307410_10324104 3300031852 Unclassified 1223
306 Ga0307410_10417799 3300031852 Bacteria 1087
307 Ga0307406_10029043 3300031901 Bacteria 3345
308 Ga0307406_10110861 3300031901 Unclassified 1889
309 Ga0307412_10029123 3300031911 Bacteria 3463
310 Ga0307412_10108878 3300031911 Unclassified 1974
311 Ga0307416_100004678 3300032002 Bacteria 8285
312 Ga0307416_100012105 3300032002 Bacteria 5793
313 Ga0307416_100104813 3300032002 Unclassified 2473
314 Ga0307416_100406766 3300032002 Bacteria 1400
315 Ga0307415_100148458 3300032126 Bacteria 1801
316 Ga0307415_100182137 3300032126 Unclassified 1649
317 Ga0307415_100193266 3300032126 Bacteria 1608
318 Ga0373929_0101596 3300035085 Unclassified 725
319 Ga0373953_0126283 3300035117 Bacteria 1089
320 Ga0373956_0123098 3300035119 Bacteria 1212
321 Ga0373960_0142077 3300035121 Bacteria 814
322 Ga0373962_0135131 3300035242 Bacteria 797
323 Ga0373931_0192122 3300035691 Bacteria 1215
324 Ga0373925_0003373 3300037068 Bacteria 12391
325 Ga0439439_0012426 3300041406 Bacteria 2060
326 Ga0451807_1479754 3300041486 Bacteria 1226
327 Ga0439433_0020246 3300041999 Unclassified 1485
328 Ga0439448_0081484 3300042005 Unclassified 1087
329 Ga0439450_000489 3300042008 Bacteria 5189
330 Ga0439462_0026625 3300042015 Bacteria 1524
331 Ga0439463_036450 3300042016 Bacteria 1246
332 Ga0450923_028372 3300042125 Bacteria 1130
333 Ga0450889_002397 3300042144 Bacteria 1867
334 Ga0439446_0033090 3300042156 Unclassified 1501
335 Ga0439435_0093916 3300042436 Bacteria 914
336 Ga0439444_0045601 3300042437 Unclassified 875
337 Ga0439464_0003106 3300042439 Bacteria 4156
338 Ga0439460_0001555 3300042461 Bacteria 5409
339 Ga0439460_0044599 3300042461 Unclassified 1313
340 Ga0451577_0033452 3300042876 Bacteria 4634
341 Ga0451577_0036044 3300042876 Bacteria 4455
342 Ga0451577_0087060 3300042876 Bacteria 2787
343 Ga0451577_0682646 3300042876 Unclassified 931
344 Ga0453684_0110239 3300044712 Bacteria 3346
345 Ga0453684_0234944 3300044712 Bacteria 2114
346 Ga0451576_0220849 3300045051 Bacteria 1978
347 Ga0451576_0254156 3300045051 Bacteria 1837
348 Ga0451576_0397648 3300045051 Bacteria 1445
349 Ga0451576_0596878 3300045051 Bacteria 1160
350 Ga0451576_0790925 3300045051 Unclassified 996
351 Ga0495592_0073572 3300046454 Bacteria 2485
352 Ga0495592_0201763 3300046454 Bacteria 1342
353 Ga0495629_0152059 3300046459 Bacteria 1608
354 Ga0495651_0222684 3300046462 Bacteria 1305
355 Ga0495582_0045845 3300046473 Bacteria 2408
356 Ga0495582_0106015 3300046473 Bacteria 1576
357 Ga0495594_0059323 3300046499 Unclassified 2116
358 Ga0495618_0357070 3300046514 Bacteria 900
359 Ga0495587_0052272 3300046536 Bacteria 2411
360 Ga0495645_0055349 3300046543 Bacteria 2880
361 Ga0495634_0076869 3300046642 Bacteria 2191
362 Ga0495623_0184179 3300046679 Bacteria 1211
363 Ga0495647_0073891 3300046681 Bacteria 1370
364 Ga0495658_0346098 3300046683 Bacteria 944
365 Ga0495613_0010865 3300046689 Bacteria 6756
366 Ga0495674_0032009 3300047319 Bacteria 4773
367 Ga0495674_0234487 3300047319 Bacteria 1514
368 Ga0495676_0042872 3300047321 Bacteria 3710
369 Ga0495680_0057050 3300047322 Bacteria 3022
370 Ga0495684_0000663 3300047471 Bacteria 27724
371 Ga0496103_0005640 3300048906 Bacteria 7482
372 Ga0496104_0000830 3300048907 Bacteria 26651
373 Ga0496105_0033716 3300048908 Bacteria 4207
374 Ga0496106_0187837 3300048909 Bacteria 1642
375 Ga0496106_0246872 3300048909 Unclassified 1427
376 Ga0496108_0001041 3300048911 Bacteria 21629
377 Ga0496108_0090504 3300048911 Bacteria 2601
378 Ga0496108_0166664 3300048911 Bacteria 1905
379 Ga0496109_0004852 3300048912 Bacteria 11224
380 Ga0496109_0197999 3300048912 Bacteria 1889
381 Ga0496109_0307190 3300048912 Bacteria 1496
382 Ga0496110_0002605 3300048913 Bacteria 13566
383 Ga0496110_0193808 3300048913 Bacteria 1845
384 Ga0496111_0324040 3300048914 Bacteria 1141
385 Ga0496112_0000626 3300048915 Bacteria 24545
386 Ga0496112_0079882 3300048915 Bacteria 3235
387 Ga0496112_0171901 3300048915 Bacteria 2132
388 Ga0496113_0324708 3300048916 Bacteria 1234
389 Ga0496113_0844152 3300048916 Bacteria 726
390 Ga0496114_0580819 3300048917 Bacteria 989
391 Ga0501290_026013 3300049513 Archaea 821
392 Ga0501291_008371 3300049514 Bacteria 1428
393 Ga0501299_000797 3300049522 Unclassified 3838
394 Ga0501300_011690 3300049523 Bacteria 1278
395 Ga0501031_0129098 3300049568 Bacteria 1651
396 Ga0501033_0043722 3300049570 Bacteria 3336
397 Ga0501034_0585431 3300049571 Bacteria 1022
398 Ga0501036_0031649 3300049572 Unclassified 4471
399 Ga0501036_0536175 3300049572 Unclassified 973
400 Ga0501037_0137837 3300049573 Bacteria 1747
401 Ga0501038_0080818 3300049574 Bacteria 2739
402 Ga0501038_0313945 3300049574 Bacteria 1227
403 Ga0501039_0040067 3300049575 Bacteria 3617
404 Ga0501039_0081929 3300049575 Bacteria 2512
405 Ga0501039_0084973 3300049575 Bacteria 2465
406 Ga0501039_0274668 3300049575 Bacteria 1325
407 Ga0501040_0001869 3300049576 Bacteria 13503
408 Ga0501040_0251941 3300049576 Bacteria 1259
409 Ga0501041_0044228 3300049577 Bacteria 2707
410 Ga0501042_0011651 3300049578 Bacteria 5942
411 Ga0501042_0020795 3300049578 Bacteria 4569
412 Ga0501043_0081218 3300049579 Bacteria 2547
413 Ga0501046_0000288 3300049580 Bacteria 51100
414 Ga0501046_0046076 3300049580 Bacteria 3462
415 Ga0501047_0033160 3300049581 Bacteria 4985
416 Ga0501048_0035731 3300049582 Bacteria 3575
417 Ga0501048_0089426 3300049582 Bacteria 2172
418 Ga0501048_0129559 3300049582 Bacteria 1784
419 Ga0501068_0015010 3300049584 Bacteria 4440
420 Ga0501070_0536190 3300049586 Bacteria 938
421 Ga0501071_0049024 3300049587 Bacteria 3039
422 Ga0501072_0030965 3300049588 Bacteria 4186
423 Ga0501072_0273369 3300049588 Bacteria 1344
424 Ga0501074_0013593 3300049590 Bacteria 5918
425 Ga0501075_0025934 3300049591 Bacteria 4309
426 Ga0501075_0078728 3300049591 Bacteria 2495
427 Ga0501076_0007848 3300049592 Bacteria 7778
428 Ga0501076_0024869 3300049592 Bacteria 4632
429 Ga0501076_0038102 3300049592 Bacteria 3774
430 Ga0501076_0040936 3300049592 Bacteria 3643
431 Ga0501076_0418981 3300049592 Unclassified 1102
432 Ga0501077_0022486 3300049593 Bacteria 3994
433 Ga0501077_0168563 3300049593 Bacteria 1391
434 Ga0501206_014832 3300049653 Unclassified 1074
435 Ga0501216_005068 3300049660 Bacteria 1976
436 Ga0501233_020040 3300049668 Unclassified 1424
437 Ga0501249_065975 3300049679 Unclassified 842
438 Ga0501250_012866 3300049680 Unclassified 996
439 Ga0501079_0007316 3300049741 Bacteria 8341
440 Ga0501079_0031564 3300049741 Bacteria 4072
441 Ga0501079_0047237 3300049741 Bacteria 3321
442 Ga0501079_0069789 3300049741 Bacteria 2713
443 Ga0501080_0088096 3300049742 Bacteria 2884
444 Ga0501080_0444251 3300049742 Bacteria 1163
445 Ga0501081_0006909 3300049743 Bacteria 7374
446 Ga0501081_0069636 3300049743 Bacteria 2451
447 Ga0501081_0126575 3300049743 Bacteria 1823
448 Ga0501081_0186706 3300049743 Bacteria 1500
449 Ga0501083_0010360 3300049744 Bacteria 6563
450 Ga0501273_005703 3300049770 Unclassified 1416
451 Ga0501044_0008783 3300049823 Bacteria 11056
452 Ga0501045_0000340 3300049824 Bacteria 27693
453 Ga0501045_0011753 3300049824 Bacteria 6152
454 Ga0501045_0085436 3300049824 Bacteria 2329
455 Ga0501045_0166798 3300049824 Bacteria 1640
456 Ga0501045_0267999 3300049824 Bacteria 1272
457 nmdc:mga03683_3095_c1 3300050489 Bacteria 5291
458 nmdc:mga00v17_223541_c1 3300050491 Bacteria 1219
459 nmdc:mga00v17_8515_c1 3300050491 Bacteria 5521
460 nmdc:mga0yw44_16108_c1 3300050492 Bacteria 4030
461 nmdc:mga0k408_54528_c1 3300050493 Bacteria 1874
462 nmdc:mga06z11_17073_c1 3300050494 Bacteria 3285
463 nmdc:mga05p37_1037_c1 3300050507 Bacteria 31680
464 nmdc:mga05p37_11581_c1 3300050507 Bacteria 10510
465 nmdc:mga05p37_13877_c1 3300050507 Bacteria 9655
466 nmdc:mga05p37_146529_c1 3300050507 Unclassified 2891
467 nmdc:mga05p37_204729_c1 3300050507 Bacteria 2388
468 nmdc:mga05p37_3083_c1 3300050507 Bacteria 19357
469 nmdc:mga05p37_376052_c1 3300050507 Unclassified 1666
470 nmdc:mga05p37_97903_c1 3300050507 Bacteria 3613
471 nmdc:mga09592_382551_c1 3300050508 Bacteria 1217
472 nmdc:mga09592_4019_c1 3300050508 Bacteria 11866
473 nmdc:mga09592_469859_c1 3300050508 Unclassified 1084
474 nmdc:mga09592_85000_c1 3300050508 Bacteria 2699
475 nmdc:mga0qj67_128473_c1 3300050509 Bacteria 2051
476 nmdc:mga0qj67_1375_c1 3300050509 Bacteria 17028
477 nmdc:mga0qj67_218401_c1 3300050509 Bacteria 1548
478 nmdc:mga0qj67_25836_c1 3300050509 Bacteria 4542
479 nmdc:mga0qj67_306464_c1 3300050509 Unclassified 1286
480 nmdc:mga06r32_11872_c1 3300050510 Bacteria 7848
481 nmdc:mga06r32_46609_c1 3300050510 Bacteria 4137
482 nmdc:mga06r32_693_c1 3300050510 Bacteria 29366
483 nmdc:mga08y16_1024_c1 3300050511 Bacteria 27419
484 nmdc:mga08y16_128021_c1 3300050511 Bacteria 2641
485 nmdc:mga08y16_179870_c1 3300050511 Unclassified 2196
486 nmdc:mga08y16_21_c1 3300050511 Bacteria 254790
487 nmdc:mga08y16_240828_c1 3300050511 Bacteria 1870
488 nmdc:mga08y16_323153_c1 3300050511 Bacteria 1588
489 nmdc:mga08y16_436542_c1 3300050511 Bacteria 1337
490 nmdc:mga08y16_7169_c1 3300050511 Bacteria 11697
491 nmdc:mga0n895_133609_c1 3300050512 Bacteria 2507
492 nmdc:mga0n895_342168_c1 3300050512 Bacteria 1515
493 nmdc:mga0n895_411004_c1 3300050512 Bacteria 1368
494 nmdc:mga0n895_480011_c1 3300050512 Unclassified 1254
495 nmdc:mga0n895_59885_c1 3300050512 Bacteria 3757
496 nmdc:mga0rr50_20442_c1 3300050513 Bacteria 4497
497 nmdc:mga0rr50_344152_c1 3300050513 Bacteria 1253
498 nmdc:mga0a205_128_c1 3300050515 Bacteria 46647
499 nmdc:mga0a205_129729_c1 3300050515 Unclassified 2422
500 nmdc:mga0a205_19183_c1 3300050515 Bacteria 6444
501 nmdc:mga0a205_341452_c1 3300050515 Bacteria 1366
502 Ga0495601_0035814 3300053077 Bacteria 3099
503 Ga0495619_0001621 3300053085 Bacteria 14802
504 Ga0500628_011651 3300053129 Bacteria 1603
505 Ga0501084_0012290 3300054114 Bacteria 7091
506 Ga0501084_0013589 3300054114 Bacteria 6737
507 Ga0501084_0022950 3300054114 Bacteria 5208
508 Ga0501084_0484039 3300054114 Bacteria 1046
509 Ga0590071_001127 3300059421 Bacteria 7232
510 Ga0590075_000078 3300059424 Bacteria 24962
511 Ga0590075_045580 3300059424 Bacteria 1123
512 Ga0590077_012516 3300059426 Bacteria 1760
513 Ga0501082_0002155 3300060353 Bacteria 17252
514 Ga0501082_0038271 3300060353 Bacteria 4138
515 Ga0530510_0038142 3300061734 Bacteria 3468
516 Ga0530510_0067058 3300061734 Bacteria 2603
517 Ga0530510_0173597 3300061734 Unclassified 1597
518 Ga0530510_0305621 3300061734 Bacteria 1191
519 Ga0114129_10010192
520 Ga0065712_10075893
521 Ga0065712_10171630
522 Ga0065715_10139928
523 Ga0065715_10179507
524 Ga0070676_10188994
525 Ga0070676_10499578
526 Ga0070683_100003650
527 Ga0070683_100273396
528 Ga0070690_100049491
529 Ga0070670_100006265
530 Ga0070670_100021473
531 Ga0070670_100039177
532 Ga0070670_100205982
533 Ga0070677_10170094
534 Ga0068869_100049589
535 Ga0070666_10018108
536 Ga0070666_10076526
537 Ga0068868_100070842
538 Ga0070691_10002730
539 Ga0070687_100158978
540 Ga0070687_100166945
541 Ga0070661_100063140
542 Ga0070661_100082376
543 Ga0070668_100014229
544 Ga0070669_100106274
545 Ga0070675_100729945
546 Ga0070671_100018222
547 Ga0070671_100069797
548 Ga0070674_100395985
549 Ga0070674_100813205
550 Ga0070673_100013372
551 Ga0070673_100230399
552 Ga0070673_100264250
553 Ga0070688_100252757
554 Ga0070659_100059758
555 Ga0070659_100125533
556 Ga0070713_100024369
557 Ga0070701_10050052
558 Ga0070701_10056783
559 Ga0070701_10266725
560 Ga0070701_10377495
561 Ga0070711_100034795
562 Ga0070705_100000617
563 Ga0070705_100359406
564 Ga0070700_100098028
565 Ga0070694_100093944
566 Ga0070694_100116046
567 Ga0070694_100824093
568 Ga0070678_100113752
569 Ga0070678_100311067
570 Ga0070662_100039211
571 Ga0070662_100267064
572 Ga0070681_10851135
573 Ga0068867_100001347
574 Ga0068867_100016238
575 Ga0070685_10088301
576 Ga0070685_10205709
577 Ga0070685_10330574
578 Ga0070706_100016855
579 Ga0070707_100001535
580 Ga0070707_100858574
581 Ga0070699_100022096
582 Ga0070699_100027355
583 Ga0070684_100001965
584 Ga0070697_100012047
585 Ga0070697_100326676
586 Ga0070672_100043922
587 Ga0070672_100452331
588 Ga0070672_100605925
589 Ga0070686_100150412
590 Ga0070695_100002551
591 Ga0070696_100006990
592 Ga0070696_100041820
593 Ga0070696_100188025
594 Ga0070693_100205455
595 Ga0070665_100022116
596 Ga0070704_100134988
597 Ga0068855_100340491
598 Ga0068855_100558922
599 Ga0070664_100002291
600 Ga0070664_100527983
601 Ga0068857_100013772
602 Ga0068854_100086321
603 Ga0068854_100284144
604 Ga0068856_100573394
605 Ga0068856_100813313
606 Ga0068856_100874775
607 Ga0070702_100570668
608 Ga0068859_100133241
609 Ga0068859_100310864
610 Ga0068859_100419245
611 Ga0068864_100202735
612 Ga0068861_100021059
613 Ga0068861_100039266
614 Ga0068861_100065605
615 Ga0068863_100160833
616 Ga0068863_100282022
617 Ga0068863_100735447
618 Ga0068858_100035206
619 Ga0068858_100411725
620 Ga0068860_100534054
621 Ga0068862_100058173
622 Ga0081538_10012792
623 Ga0070717_10472080
624 Ga0075365_10010439
625 Ga0075368_10026422
626 Ga0075364_10002130
627 Ga0070712_100002432
628 Ga0075367_10017938
629 Ga0075367_10150631
630 Ga0075366_10117113
631 Ga0097621_100136058
632 Ga0075428_100000339
633 Ga0075428_100007297
634 Ga0075428_100026189
635 Ga0075428_100080895
636 Ga0075428_100083026
637 Ga0075428_100212337
638 Ga0075430_100001386
639 Ga0075430_100014140
640 Ga0075430_100023064
641 Ga0075430_100040907
642 Ga0075430_100047481
643 Ga0075430_100331992
644 Ga0075431_100002162
645 Ga0075431_100018464
646 Ga0075431_100022938
647 Ga0075431_100064597
648 Ga0075431_100209012
649 Ga0075431_100231874
650 Ga0075433_10004176
651 Ga0075434_100093097
652 Ga0075434_100093602
653 Ga0075434_100163146
654 Ga0075434_100282262
655 Ga0075434_100407770
656 Ga0075429_100003547
657 Ga0075429_100053206
658 Ga0075429_100091997
659 Ga0075429_100196506
660 Ga0068865_100036378
661 Ga0075436_100209795
662 Ga0097620_100133241
663 Ga0097620_100310867
664 Ga0097620_100419257
665 Ga0075435_100009083
666 Ga0075435_100014120
667 Ga0075435_100024652
668 Ga0075435_100126680
669 Ga0105250_10134058
670 Ga0105240_10080890
671 Ga0111539_10000009
672 Ga0111539_10000996
673 Ga0111539_10019368
674 Ga0111539_10050897
675 Ga0111539_10305402
676 Ga0111539_10511023
677 Ga0105245_10029439
678 Ga0105245_10317455
679 Ga0105247_10024518
680 Ga0105247_10048732
681 Ga0114129_10000695
682 Ga0114129_10006087
683 Ga0114129_10009865
684 Ga0114129_10015148
685 Ga0114129_10060839
686 Ga0114129_10239801
687 Ga0105243_10015486
688 Ga0105243_10072096
689 Ga0105243_10804696
690 Ga0105241_10140813
691 Ga0105242_10050612
692 Ga0105242_10140621
693 Ga0105248_10045155
694 Ga0105248_10555899
695 Ga0105249_10354664
696 Ga0105249_10484942
697 Ga0105249_10497628
698 Ga0157378_10160162
699 Ga0157378_10687417
700 Ga0163162_10160777
701 Ga0157372_10010311
702 Ga0157375_10215283
703 Ga0163163_10030740
704 Ga0163163_10033268
705 Ga0157380_10036757
706 Ga0157376_10070055
707 Ga0157376_10322879
708 Ga0206356_11431463
709 Ga0207697_10000774
710 Ga0207697_10115487
711 Ga0207682_10047474
712 Ga0207642_10290747
713 Ga0207688_10006424
714 Ga0207688_10064598
715 Ga0207680_10164739
716 Ga0207699_10080810
717 Ga0207699_10187478
718 Ga0207645_10010811
719 Ga0207645_10014428
720 Ga0207684_10015319
721 Ga0207654_10178829
722 Ga0207707_10188841
723 Ga0207707_10310400
724 Ga0207695_10312191
725 Ga0207663_10093730
726 Ga0207663_10433402
727 Ga0207662_10007722
728 Ga0207649_10036400
729 Ga0207649_10111129
730 Ga0207646_10017570
731 Ga0207681_10025459
732 Ga0207650_10050652
733 Ga0207659_10150848
734 Ga0207687_10025193
735 Ga0207700_10010285
736 Ga0207644_10055443
737 Ga0207644_10088568
738 Ga0207706_10153653
739 Ga0207706_10276178
740 Ga0207706_10303331
741 Ga0207686_10084111
742 Ga0207670_10360300
743 Ga0207669_10007845
744 Ga0207669_10222837
745 Ga0207704_10034227
746 Ga0207704_10041472
747 Ga0207704_10166720
748 Ga0207691_10061413
749 Ga0207691_10538098
750 Ga0207711_10030540
751 Ga0207711_10109771
752 Ga0207711_10111603
753 Ga0207711_10157945
754 Ga0207711_10546877
755 Ga0207689_10199456
756 Ga0207689_10257537
757 Ga0207661_10006787
758 Ga0207679_10007076
759 Ga0207679_10257768
760 Ga0207679_10431604
761 Ga0207651_10004777
762 Ga0207651_10347951
763 Ga0207712_10439022
764 Ga0207640_10018070
765 Ga0207640_10045126
766 Ga0207677_10011569
767 Ga0207677_10050699
768 Ga0207677_10567732
769 Ga0207703_10181398
770 Ga0207703_10302797
771 Ga0207708_10033901
772 Ga0207708_10070695
773 Ga0207708_10088884
774 Ga0207702_10583325
775 Ga0207641_10157180
776 Ga0207641_10197927
777 Ga0207641_10492032
778 Ga0207648_10001525
779 Ga0207648_10166510
780 Ga0207648_10285641
781 Ga0207676_10071784
782 Ga0207674_10018570
783 Ga0207674_10018883
784 Ga0207675_100001868
785 Ga0207675_100043323
786 Ga0207675_100057360
787 Ga0207675_100075181
788 Ga0207675_100160018
789 Ga0207675_100374156
790 Ga0207683_10079258
791 Ga0207683_10150975
792 Ga0207683_10251943
793 Ga0207698_10179682
794 Ga0209967_1008910
795 Ga0209984_1019993
796 Ga0210000_1005313
797 Ga0209995_1019457
798 Ga0209982_1003541
799 Ga0209983_1003116
800 Ga0209971_1000137
801 Ga0209971_1054151
802 Ga0209966_1000354
803 Ga0209998_10000278
804 Ga0209813_10022804
805 Ga0207428_10002779
806 Ga0207428_10028750
807 Ga0207428_10055550
808 Ga0207428_10177154
809 Ga0268266_10040804
810 Ga0268265_10045990
811 Ga0268265_10321319
812 Ga0268265_10335329
813 Ga0268265_10450584
814 Ga0268264_10139327
815 Ga0268264_10364954
816 Ga0307408_100014820
817 Ga0307408_100071983
818 Ga0307408_100171477
819 Ga0307408_100181237
820 Ga0307408_100319053
821 Ga0307405_10317785
822 Ga0307405_10619227
823 Ga0307410_10324104
824 Ga0307410_10417799
825 Ga0307406_10029043
826 Ga0307406_10110861
827 Ga0307412_10029123
828 Ga0307412_10108878
829 Ga0307416_100004678
830 Ga0307416_100012105
831 Ga0307416_100104813
832 Ga0307416_100406766
833 Ga0307415_100148458
834 Ga0307415_100182137
835 Ga0307415_100193266
836 Ga0373929_0101596
837 Ga0373953_0126283
838 Ga0373956_0123098
839 Ga0373960_0142077
840 Ga0373962_0135131
841 Ga0373931_0192122
842 Ga0373925_0003373
843 Ga0439439_0012426
844 Ga0451807_1479754
845 Ga0439433_0020246
846 Ga0439448_0081484
847 Ga0439450_000489
848 Ga0439462_0026625
849 Ga0439463_036450
850 Ga0450923_028372
851 Ga0450889_002397
852 Ga0439446_0033090
853 Ga0439435_0093916
854 Ga0439444_0045601
855 Ga0439464_0003106
856 Ga0439460_0001555
857 Ga0439460_0044599
858 Ga0451577_0033452
859 Ga0451577_0036044
860 Ga0451577_0087060
861 Ga0451577_0682646
862 Ga0453684_0110239
863 Ga0453684_0234944
864 Ga0451576_0220849
865 Ga0451576_0254156
866 Ga0451576_0397648
867 Ga0451576_0596878
868 Ga0451576_0790925
869 Ga0495592_0073572
870 Ga0495592_0201763
871 Ga0495629_0152059
872 Ga0495651_0222684
873 Ga0495582_0045845
874 Ga0495582_0106015
875 Ga0495594_0059323
876 Ga0495618_0357070
877 Ga0495587_0052272
878 Ga0495645_0055349
879 Ga0495634_0076869
880 Ga0495623_0184179
881 Ga0495647_0073891
882 Ga0495658_0346098
883 Ga0495613_0010865
884 Ga0495674_0032009
885 Ga0495674_0234487
886 Ga0495676_0042872
887 Ga0495680_0057050
888 Ga0495684_0000663
889 Ga0496103_0005640
890 Ga0496104_0000830
891 Ga0496105_0033716
892 Ga0496106_0187837
893 Ga0496106_0246872
894 Ga0496108_0001041
895 Ga0496108_0090504
896 Ga0496108_0166664
897 Ga0496109_0004852
898 Ga0496109_0197999
899 Ga0496109_0307190
900 Ga0496110_0002605
901 Ga0496110_0193808
902 Ga0496111_0324040
903 Ga0496112_0000626
904 Ga0496112_0079882
905 Ga0496112_0171901
906 Ga0496113_0324708
907 Ga0496113_0844152
908 Ga0496114_0580819
909 Ga0501290_026013
910 Ga0501291_008371
911 Ga0501299_000797
912 Ga0501300_011690
913 Ga0501031_0129098
914 Ga0501033_0043722
915 Ga0501034_0585431
916 Ga0501036_0031649
917 Ga0501036_0536175
918 Ga0501037_0137837
919 Ga0501038_0080818
920 Ga0501038_0313945
921 Ga0501039_0040067
922 Ga0501039_0081929
923 Ga0501039_0084973
924 Ga0501039_0274668
925 Ga0501040_0001869
926 Ga0501040_0251941
927 Ga0501041_0044228
928 Ga0501042_0011651
929 Ga0501042_0020795
930 Ga0501043_0081218
931 Ga0501046_0000288
932 Ga0501046_0046076
933 Ga0501047_0033160
934 Ga0501048_0035731
935 Ga0501048_0089426
936 Ga0501048_0129559
937 Ga0501068_0015010
938 Ga0501070_0536190
939 Ga0501071_0049024
940 Ga0501072_0030965
941 Ga0501072_0273369
942 Ga0501074_0013593
943 Ga0501075_0025934
944 Ga0501075_0078728
945 Ga0501076_0007848
946 Ga0501076_0024869
947 Ga0501076_0038102
948 Ga0501076_0040936
949 Ga0501076_0418981
950 Ga0501077_0022486
951 Ga0501077_0168563
952 Ga0501206_014832
953 Ga0501216_005068
954 Ga0501233_020040
955 Ga0501249_065975
956 Ga0501250_012866
957 Ga0501079_0007316
958 Ga0501079_0031564
959 Ga0501079_0047237
960 Ga0501079_0069789
961 Ga0501080_0088096
962 Ga0501080_0444251
963 Ga0501081_0006909
964 Ga0501081_0069636
965 Ga0501081_0126575
966 Ga0501081_0186706
967 Ga0501083_0010360
968 Ga0501273_005703
969 Ga0501044_0008783
970 Ga0501045_0000340
971 Ga0501045_0011753
972 Ga0501045_0085436
973 Ga0501045_0166798
974 Ga0501045_0267999
975 nmdc:mga03683_3095_c1
976 nmdc:mga00v17_223541_c1
977 nmdc:mga00v17_8515_c1
978 nmdc:mga0yw44_16108_c1
979 nmdc:mga0k408_54528_c1
980 nmdc:mga06z11_17073_c1
981 nmdc:mga05p37_1037_c1
982 nmdc:mga05p37_11581_c1
983 nmdc:mga05p37_13877_c1
984 nmdc:mga05p37_146529_c1
985 nmdc:mga05p37_204729_c1
986 nmdc:mga05p37_3083_c1
987 nmdc:mga05p37_376052_c1
988 nmdc:mga05p37_97903_c1
989 nmdc:mga09592_382551_c1
990 nmdc:mga09592_4019_c1
991 nmdc:mga09592_469859_c1
992 nmdc:mga09592_85000_c1
993 nmdc:mga0qj67_128473_c1
994 nmdc:mga0qj67_1375_c1
995 nmdc:mga0qj67_218401_c1
996 nmdc:mga0qj67_25836_c1
997 nmdc:mga0qj67_306464_c1
998 nmdc:mga06r32_11872_c1
999 nmdc:mga06r32_46609_c1
1000 nmdc:mga06r32_693_c1
1001 nmdc:mga08y16_1024_c1
1002 nmdc:mga08y16_128021_c1
1003 nmdc:mga08y16_179870_c1
1004 nmdc:mga08y16_21_c1
1005 nmdc:mga08y16_240828_c1
1006 nmdc:mga08y16_323153_c1
1007 nmdc:mga08y16_436542_c1
1008 nmdc:mga08y16_7169_c1
1009 nmdc:mga0n895_133609_c1
1010 nmdc:mga0n895_342168_c1
1011 nmdc:mga0n895_411004_c1
1012 nmdc:mga0n895_480011_c1
1013 nmdc:mga0n895_59885_c1
1014 nmdc:mga0rr50_20442_c1
1015 nmdc:mga0rr50_344152_c1
1016 nmdc:mga0a205_128_c1
1017 nmdc:mga0a205_129729_c1
1018 nmdc:mga0a205_19183_c1
1019 nmdc:mga0a205_341452_c1
1020 Ga0495601_0035814
1021 Ga0495619_0001621
1022 Ga0500628_011651
1023 Ga0501084_0012290
1024 Ga0501084_0013589
1025 Ga0501084_0022950
1026 Ga0501084_0484039
1027 Ga0590071_001127
1028 Ga0590075_000078
1029 Ga0590075_045580
1030 Ga0590077_012516
1031 Ga0501082_0002155
1032 Ga0501082_0038271
1033 Ga0530510_0038142
1034 Ga0530510_0067058
1035 Ga0530510_0173597
1036 Ga0530510_0305621

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06778

Chlor_dismutase

Chlorite dismutase

146

265

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qpi-assembly2.cif.gz_B crystal structure of dimeric chlorite dismutases from nitrobacter winogradskyi 0.8049 124 229
5loq-assembly1.cif.gz_E structure of coproheme bound hemq from listeria monocytogenes 0.7893 22 229
4wws-assembly1.cif.gz_B structure of chlorite dismutase-like protein from listeria monocytogenes 0.7887 20 229
6fxj-assembly1.cif.gz_E structure of coproheme decarboxylase from listeria monocytogenes in complex with iron coproporphyrin iii 0.7868 22 229
5loq-assembly1.cif.gz_B structure of coproheme bound hemq from listeria monocytogenes 0.785 22 229
ID Description Score Start End Superfamily
af_P9WL45_128_230_3.30.70.1030 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Apc35880; domain 1 0.9321 131 229 3.30.70.1030
5loqB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Apc35880; domain 1 0.9016 130 229 3.30.70.1030
af_P9WL45_12_126_3.30.70.1030 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Apc35880; domain 1 0.8439 129 227 3.30.70.1030
1vdhA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Apc35880; domain 1 0.8406 119 229 3.30.70.1030
af_P9WL45_128_230_3.30.70.1030 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Apc35880; domain 1 0.8381 131 229 3.30.70.1030
ID Description Score Start End GO Terms
AF-A0A317HQU3-F1-model_v4 Chlorite dismutase family protein 0.999 55 229 GO:0016491
GO:0020037
GO:0046872
AF-A0A2V6RTP8-F1-model_v4 Peroxidase 0.9933 134 229 GO:0016491
GO:0020037
GO:0046872
AF-A0A496AE46-F1-model_v4 Chlorite dismutase family protein 0.9925 99 227 GO:0016491
GO:0020037
GO:0046872
AF-A0A382TEB0-F1-model_v4 Chlorite dismutase 0.9896 69 229 GO:0016491
GO:0020037
GO:0046872
AF-A0A3N5G8S3-F1-model_v4 Chlorite dismutase 0.9866 8 229 GO:0016491
GO:0020037
GO:0046872

Map