F458164

General Info

Members Datasets Scaffolds Average Seq Length
517 165 1034 322

Family's Representative Sequence

Representative Sequence 3300046471|Ga0495650_0014781|Ga0495650_0014781_642_1631
Length 308
Sequence MLSEFDLIKQYFTRAGRGDASGRTVLGVGDDCALLAPSPGMQLAVSSDMLVEGRHFFAGADAIDLGHKCLAVNLSDLAAMGAAPLGFTLALALPAADAAWLDGFSRGLFALADAHGCELVGGDTTKGPLNICITIFGEIKPGQALRRDAAEPGDDIWISGALGDARLALAAYLNEIPAPRVALGRLLAEGRLAHAALDISDGLVGDLGHILAASKVGAVLDVDALPAGPALARQDSALRRRFTAAGGDDYELCFTAPAANRAAILAAGERCGTPVTRVGSIEAAPGLRLVDGSGAPLQLSLRGWDHFA

Samples

Sample ID Description Type Environment
1 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
7 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
8 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
17 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
18 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
19 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
20 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
21 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
22 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
23 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
24 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
25 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
26 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
27 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
28 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
29 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
30 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
31 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
32 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
34 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
44 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
45 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
46 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
47 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
48 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
49 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
50 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
51 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
52 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
53 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
54 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
55 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
56 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
57 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
58 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
59 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
60 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
61 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
62 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
63 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
64 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
65 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
66 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
67 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
68 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
69 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
70 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
71 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
72 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
73 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
74 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
75 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
76 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
77 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
78 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
79 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
80 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
81 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
82 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
83 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
84 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
85 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
86 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
87 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
88 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
89 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
90 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
91 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
92 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
93 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
94 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
95 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
96 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
97 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
98 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
99 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
100 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
101 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
102 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
103 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
104 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
105 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
106 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
107 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
108 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
109 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
110 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
111 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
112 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
113 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
114 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
115 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
116 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
117 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
118 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
119 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
120 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
121 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
122 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
123 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
124 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
125 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
126 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
127 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
128 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
129 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
130 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
131 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
132 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
133 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
134 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
135 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
136 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
137 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
138 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
139 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
144 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
145 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
146 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
147 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
148 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
149 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
150 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
151 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
152 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
155 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
156 2643221556 Massilia sp. Root1485 Isolate Unclassified
157 2643221611 Acidovorax sp. Root219 Isolate Unclassified
158 2643221684 Massilia sp. Root133 Isolate Unclassified
159 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
160 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
161 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
162 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
163 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
164 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
165 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.87
Metatranscriptomes 0
Isolates 2.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.71
Nodule 0.58
Rhizoplane 3.87
Rhizosphere 85.49
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495650_0014781 3300046471 Bacteria 4037
2 JGI25155J39150_1000396 3300002704 Bacteria 12200
3 JGI25155J39150_1000991 3300002704 Bacteria 3256
4 JGI25156J39149_1001044 3300002705 Bacteria 12868
5 JGI25154J39366_1000878 3300002738 Bacteria 12876
6 JGI25154J39366_1000945 3300002738 Bacteria 12054
7 JGI25157J39369_1000094 3300002741 Bacteria 76378
8 Ga0055532_1000017 3300003758 Bacteria 306880
9 Ga0055537_1004733 3300003773 Bacteria 3820
10 Ga0055524_1000027 3300003775 Bacteria 213655
11 Ga0055530_10001504 3300003791 Bacteria 16895
12 Ga0065165_1000606 3300005262 Bacteria 52303
13 Ga0070660_100210223 3300005339 Bacteria 1579
14 Ga0070659_100050085 3300005366 Bacteria 3285
15 Ga0070659_100102466 3300005366 Bacteria 2304
16 Ga0068855_100020283 3300005563 Bacteria 7977
17 Ga0068855_100243493 3300005563 Bacteria 2008
18 Ga0068855_100350073 3300005563 Bacteria 1627
19 Ga0070664_100081937 3300005564 Bacteria 2781
20 Ga0068852_100219743 3300005616 Bacteria 1806
21 Ga0099826_10000003 3300006948 Bacteria 1067817
22 Ga0105241_10003135 3300009174 Bacteria 12296
23 Ga0105242_10365298 3300009176 Bacteria 1337
24 Ga0105238_10044375 3300009551 Bacteria 4495
25 Ga0182008_10017668 3300014497 Bacteria 3698
26 Ga0209435_100015 3300025206 Bacteria 321177
27 Ga0209435_100112 3300025206 Bacteria 31239
28 Ga0209147_100004 3300025229 Bacteria 1371850
29 Ga0209563_100015 3300025230 Bacteria 879901
30 Ga0209437_100045 3300025233 Bacteria 429809
31 Ga0209258_100304 3300025242 Bacteria 79331
32 Ga0209646_1000020 3300025246 Bacteria 462204
33 Ga0209646_1000040 3300025246 Bacteria 347867
34 Ga0209026_1000034 3300025250 Bacteria 306953
35 Ga0209026_1002489 3300025250 Bacteria 6851
36 Ga0209677_101807 3300025253 Bacteria 8761
37 Ga0209148_1002752 3300025254 Bacteria 5553
38 Ga0209759_1000049 3300025256 Bacteria 221692
39 Ga0209759_1000073 3300025256 Bacteria 178048
40 Ga0209565_1002756 3300025263 Bacteria 6094
41 Ga0209050_1000219 3300025298 Bacteria 128416
42 Ga0209256_1000013 3300025299 Bacteria 689442
43 Ga0207705_10006255 3300025909 Bacteria 8844
44 Ga0207654_10007063 3300025911 Bacteria 5657
45 Ga0207695_10009565 3300025913 Bacteria 11978
46 Ga0207657_10008778 3300025919 Bacteria 10230
47 Ga0207690_10010090 3300025932 Bacteria 5611
48 Ga0207690_10171527 3300025932 Bacteria 1626
49 Ga0207706_10001423 3300025933 Bacteria 23955
50 Ga0207706_10196844 3300025933 Bacteria 1768
51 Ga0207686_10006121 3300025934 Bacteria 6462
52 Ga0207667_10013369 3300025949 Bacteria 9393
53 Ga0207667_10031100 3300025949 Bacteria 5765
54 Ga0207667_10266205 3300025949 Bacteria 1752
55 Ga0207667_10422980 3300025949 Bacteria 1355
56 Ga0207698_10216438 3300026142 Bacteria 1728
57 Ga0209282_1000002 3300027666 Bacteria 1067825
58 Ga0307518_10018408 3300031838 Bacteria 5008
59 Ga0307414_10036000 3300032004 Bacteria 3299
60 Ga0395899_0029888 3300037312 Bacteria 4100
61 Ga0395899_0051351 3300037312 Bacteria 3060
62 Ga0395899_0063304 3300037312 Bacteria 2721
63 Ga0395899_0173203 3300037312 Bacteria 1518
64 Ga0395899_0231861 3300037312 Bacteria 1274
65 Ga0395899_0276536 3300037312 Bacteria 1144
66 Ga0395900_0000267 3300037418 Bacteria 80920
67 Ga0395900_0000983 3300037418 Bacteria 37068
68 Ga0395900_0011484 3300037418 Bacteria 9066
69 Ga0395900_0051407 3300037418 Bacteria 4245
70 Ga0395900_0078219 3300037418 Bacteria 3398
71 Ga0395900_0102289 3300037418 Bacteria 2943
72 Ga0395900_0111534 3300037418 Bacteria 2809
73 Ga0395900_0268820 3300037418 Bacteria 1700
74 Ga0395900_0464736 3300037418 Bacteria 1219
75 Ga0395898_0035286 3300037466 Bacteria 4975
76 Ga0395898_0210564 3300037466 Bacteria 1854
77 Ga0395905_0042496 3300037471 Bacteria 4266
78 Ga0395905_0051637 3300037471 Bacteria 3851
79 Ga0395905_0228658 3300037471 Bacteria 1739
80 Ga0395905_0303122 3300037471 Bacteria 1485
81 Ga0395901_0028109 3300038443 Bacteria 5784
82 Ga0395901_0032910 3300038443 Bacteria 5348
83 Ga0395901_0115020 3300038443 Bacteria 2825
84 Ga0395901_0188279 3300038443 Bacteria 2164
85 Ga0395901_0381070 3300038443 Bacteria 1451
86 Ga0450911_000293 3300042115 Bacteria 18294
87 Ga0450904_000059 3300042139 Bacteria 24697
88 Ga0439458_0033223 3300042157 Bacteria 1235
89 Ga0466969_0002789 3300044656 Bacteria 9333
90 Ga0466969_0029652 3300044656 Bacteria 2793
91 Ga0466969_0157668 3300044656 Bacteria 1044
92 Ga0466972_0002560 3300044658 Bacteria 9000
93 Ga0466965_0019173 3300044683 Bacteria 3285
94 Ga0466966_0010214 3300044684 Bacteria 6227
95 Ga0466966_0030824 3300044684 Bacteria 3478
96 Ga0466966_0159770 3300044684 Bacteria 1372
97 Ga0466961_0083336 3300044693 Bacteria 2022
98 Ga0466961_0240311 3300044693 Bacteria 1113
99 Ga0466963_0124710 3300044694 Bacteria 1775
100 Ga0466964_0004267 3300044706 Bacteria 5264
101 Ga0466964_0126658 3300044706 Bacteria 1158
102 Ga0466957_0000122 3300044842 Bacteria 32730
103 Ga0466957_0026219 3300044842 Bacteria 3457
104 Ga0466959_0031892 3300045049 Bacteria 3900
105 Ga0466959_0243462 3300045049 Bacteria 1241
106 Ga0466967_0004163 3300045976 Bacteria 9680
107 Ga0466967_0267372 3300045976 Bacteria 1637
108 Ga0495617_000002 3300046452 Bacteria 710121
109 Ga0495627_000839 3300046453 Bacteria 22148
110 Ga0495627_011926 3300046453 Bacteria 3099
111 Ga0495627_013324 3300046453 Bacteria 2894
112 Ga0495603_0086613 3300046455 Bacteria 1833
113 Ga0495590_0000061 3300046457 Bacteria 88102
114 Ga0495590_0017029 3300046457 Bacteria 2621
115 Ga0495590_0033944 3300046457 Bacteria 1783
116 Ga0495590_0037772 3300046457 Bacteria 1683
117 Ga0495591_000401 3300046458 Bacteria 36268
118 Ga0495591_006901 3300046458 Bacteria 4924
119 Ga0495638_0005909 3300046460 Bacteria 8991
120 Ga0495653_0194291 3300046463 Bacteria 1382
121 Ga0495653_0210724 3300046463 Bacteria 1312
122 Ga0495650_0000056 3300046471 Bacteria 307565
123 Ga0495650_0002634 3300046471 Bacteria 14043
124 Ga0495580_0013839 3300046472 Bacteria 6142
125 Ga0495580_0064899 3300046472 Bacteria 2558
126 Ga0495582_0010830 3300046473 Bacteria 5019
127 Ga0495582_0068595 3300046473 Bacteria 1960
128 Ga0495582_0122723 3300046473 Bacteria 1464
129 Ga0495605_0000463 3300046474 Bacteria 36335
130 Ga0495605_0000481 3300046474 Bacteria 34712
131 Ga0495605_0005351 3300046474 Bacteria 7480
132 Ga0495605_0006438 3300046474 Bacteria 6749
133 Ga0495605_0013716 3300046474 Bacteria 4453
134 Ga0495605_0028104 3300046474 Bacteria 2906
135 Ga0495605_0044128 3300046474 Bacteria 2206
136 Ga0495605_0056877 3300046474 Bacteria 1885
137 Ga0495605_0074756 3300046474 Bacteria 1594
138 Ga0495605_0086800 3300046474 Bacteria 1455
139 Ga0495584_0000011 3300046491 Bacteria 208322
140 Ga0495584_0000283 3300046491 Bacteria 35778
141 Ga0495584_0003137 3300046491 Bacteria 9183
142 Ga0495584_0005900 3300046491 Bacteria 6455
143 Ga0495584_0015211 3300046491 Bacteria 3919
144 Ga0495584_0025092 3300046491 Bacteria 3021
145 Ga0495584_0025239 3300046491 Bacteria 3013
146 Ga0495584_0041550 3300046491 Bacteria 2321
147 Ga0495584_0061898 3300046491 Bacteria 1881
148 Ga0495584_0070005 3300046491 Bacteria 1763
149 Ga0495585_0000140 3300046492 Bacteria 79324
150 Ga0495585_0000337 3300046492 Bacteria 45680
151 Ga0495585_0002897 3300046492 Bacteria 11891
152 Ga0495585_0003179 3300046492 Bacteria 11242
153 Ga0495585_0004648 3300046492 Bacteria 8858
154 Ga0495585_0004830 3300046492 Bacteria 8651
155 Ga0495585_0012888 3300046492 Bacteria 4913
156 Ga0495585_0017097 3300046492 Bacteria 4197
157 Ga0495585_0018185 3300046492 Bacteria 4054
158 Ga0495585_0024366 3300046492 Bacteria 3469
159 Ga0495585_0055178 3300046492 Bacteria 2196
160 Ga0495585_0058823 3300046492 Bacteria 2120
161 Ga0495585_0067244 3300046492 Bacteria 1960
162 Ga0495585_0089654 3300046492 Bacteria 1657
163 Ga0495585_0094229 3300046492 Bacteria 1609
164 Ga0495585_0150746 3300046492 Bacteria 1212
165 Ga0495585_0206640 3300046492 Bacteria 997
166 Ga0495594_0004531 3300046499 Bacteria 7147
167 Ga0495594_0005409 3300046499 Bacteria 6561
168 Ga0495594_0013042 3300046499 Bacteria 4333
169 Ga0495594_0040225 3300046499 Bacteria 2557
170 Ga0495594_0040816 3300046499 Bacteria 2540
171 Ga0495594_0042926 3300046499 Bacteria 2477
172 Ga0495594_0076983 3300046499 Bacteria 1860
173 Ga0495596_0000198 3300046500 Bacteria 41305
174 Ga0495596_0002279 3300046500 Bacteria 10437
175 Ga0495596_0002721 3300046500 Bacteria 9287
176 Ga0495596_0007499 3300046500 Bacteria 4918
177 Ga0495596_0011799 3300046500 Bacteria 3752
178 Ga0495596_0012705 3300046500 Bacteria 3594
179 Ga0495596_0027418 3300046500 Bacteria 2290
180 Ga0495596_0053167 3300046500 Bacteria 1584
181 Ga0495596_0061791 3300046500 Bacteria 1458
182 Ga0495607_0000592 3300046501 Bacteria 35309
183 Ga0495607_0001716 3300046501 Bacteria 18787
184 Ga0495607_0002808 3300046501 Bacteria 13851
185 Ga0495607_0014505 3300046501 Bacteria 5123
186 Ga0495607_0014865 3300046501 Bacteria 5058
187 Ga0495607_0018113 3300046501 Bacteria 4498
188 Ga0495607_0059214 3300046501 Bacteria 2185
189 Ga0495607_0156367 3300046501 Bacteria 1162
190 Ga0495583_0000204 3300046506 Bacteria 99749
191 Ga0495583_0000882 3300046506 Bacteria 36164
192 Ga0495583_0000971 3300046506 Bacteria 33029
193 Ga0495583_0002391 3300046506 Bacteria 16158
194 Ga0495583_0005525 3300046506 Bacteria 8559
195 Ga0495583_0012869 3300046506 Bacteria 4704
196 Ga0495583_0015903 3300046506 Bacteria 4070
197 Ga0495583_0019428 3300046506 Bacteria 3547
198 Ga0495583_0045496 3300046506 Bacteria 2029
199 Ga0495583_0091408 3300046506 Bacteria 1309
200 Ga0495583_0117959 3300046506 Bacteria 1119
201 Ga0495606_0006397 3300046507 Bacteria 10871
202 Ga0495606_0007566 3300046507 Bacteria 9678
203 Ga0495606_0012745 3300046507 Bacteria 6703
204 Ga0495606_0029621 3300046507 Bacteria 3839
205 Ga0495606_0048909 3300046507 Bacteria 2777
206 Ga0495606_0049851 3300046507 Bacteria 2743
207 Ga0495606_0128461 3300046507 Bacteria 1509
208 Ga0495606_0235350 3300046507 Bacteria 1024
209 Ga0495610_0002516 3300046512 Bacteria 15305
210 Ga0495610_0075104 3300046512 Bacteria 1566
211 Ga0495616_0002549 3300046513 Bacteria 12021
212 Ga0495616_0006758 3300046513 Bacteria 6915
213 Ga0495616_0007773 3300046513 Bacteria 6401
214 Ga0495616_0009816 3300046513 Bacteria 5574
215 Ga0495616_0023082 3300046513 Bacteria 3351
216 Ga0495616_0041456 3300046513 Bacteria 2348
217 Ga0495616_0060942 3300046513 Bacteria 1851
218 Ga0495616_0132098 3300046513 Bacteria 1143
219 Ga0495620_0008759 3300046515 Bacteria 5415
220 Ga0495630_0152727 3300046517 Bacteria 1757
221 Ga0495631_0000399 3300046518 Bacteria 30049
222 Ga0495631_0003088 3300046518 Bacteria 9179
223 Ga0495631_0008555 3300046518 Bacteria 5152
224 Ga0495631_0012875 3300046518 Bacteria 4073
225 Ga0495631_0014163 3300046518 Bacteria 3853
226 Ga0495631_0015236 3300046518 Bacteria 3689
227 Ga0495631_0016976 3300046518 Bacteria 3453
228 Ga0495631_0021869 3300046518 Bacteria 2976
229 Ga0495631_0043888 3300046518 Bacteria 1972
230 Ga0495631_0043975 3300046518 Bacteria 1969
231 Ga0495631_0063135 3300046518 Bacteria 1604
232 Ga0495632_0000134 3300046519 Bacteria 75132
233 Ga0495632_0000559 3300046519 Bacteria 34765
234 Ga0495632_0013845 3300046519 Bacteria 4584
235 Ga0495632_0021645 3300046519 Bacteria 3462
236 Ga0495632_0041167 3300046519 Bacteria 2322
237 Ga0495632_0089237 3300046519 Bacteria 1463
238 Ga0495637_0000006 3300046520 Bacteria 435763
239 Ga0495637_0051724 3300046520 Bacteria 1717
240 Ga0495643_0001932 3300046522 Bacteria 17446
241 Ga0495643_0006044 3300046522 Bacteria 8071
242 Ga0495643_0008896 3300046522 Bacteria 6311
243 Ga0495643_0009333 3300046522 Bacteria 6104
244 Ga0495643_0011779 3300046522 Bacteria 5305
245 Ga0495643_0025111 3300046522 Bacteria 3375
246 Ga0495643_0109515 3300046522 Bacteria 1405
247 Ga0495644_0001386 3300046523 Bacteria 9910
248 Ga0495644_0021162 3300046523 Bacteria 2480
249 Ga0495644_0022443 3300046523 Bacteria 2405
250 Ga0495644_0029213 3300046523 Bacteria 2084
251 Ga0495644_0053655 3300046523 Bacteria 1514
252 Ga0495648_0000966 3300046524 Bacteria 29673
253 Ga0495648_0008073 3300046524 Bacteria 8326
254 Ga0495648_0012497 3300046524 Bacteria 6329
255 Ga0495648_0015291 3300046524 Bacteria 5580
256 Ga0495648_0056848 3300046524 Bacteria 2350
257 Ga0495648_0077682 3300046524 Bacteria 1902
258 Ga0495648_0093894 3300046524 Bacteria 1672
259 Ga0495648_0127874 3300046524 Bacteria 1355
260 Ga0495666_0001150 3300046526 Bacteria 12686
261 Ga0495666_0029546 3300046526 Bacteria 2696
262 Ga0495666_0043894 3300046526 Bacteria 2159
263 Ga0495642_0001744 3300046528 Bacteria 9374
264 Ga0495642_0002432 3300046528 Bacteria 7582
265 Ga0495642_0003443 3300046528 Bacteria 6231
266 Ga0495642_0003670 3300046528 Bacteria 6023
267 Ga0495642_0004939 3300046528 Bacteria 5141
268 Ga0495642_0006445 3300046528 Bacteria 4502
269 Ga0495642_0015015 3300046528 Bacteria 3006
270 Ga0495642_0017579 3300046528 Bacteria 2795
271 Ga0495642_0017633 3300046528 Bacteria 2790
272 Ga0495642_0026167 3300046528 Bacteria 2316
273 Ga0495654_0013789 3300046530 Bacteria 4316
274 Ga0495654_0046397 3300046530 Bacteria 2140
275 Ga0495665_0047323 3300046531 Bacteria 2281
276 Ga0495665_0099415 3300046531 Bacteria 1527
277 Ga0495665_0113228 3300046531 Bacteria 1422
278 Ga0495640_0014474 3300046533 Bacteria 5968
279 Ga0495586_0005486 3300046535 Bacteria 6781
280 Ga0495586_0006155 3300046535 Bacteria 6415
281 Ga0495586_0143378 3300046535 Bacteria 1341
282 Ga0495609_0000234 3300046538 Bacteria 52809
283 Ga0495609_0001034 3300046538 Bacteria 19542
284 Ga0495609_0008786 3300046538 Bacteria 4918
285 Ga0495609_0032038 3300046538 Bacteria 2389
286 Ga0495609_0087226 3300046538 Bacteria 1360
287 Ga0495597_0003382 3300046542 Bacteria 9350
288 Ga0495597_0010268 3300046542 Bacteria 4583
289 Ga0495597_0019129 3300046542 Bacteria 3207
290 Ga0495597_0054199 3300046542 Bacteria 1761
291 Ga0495597_0058852 3300046542 Bacteria 1678
292 Ga0495622_0007199 3300046557 Bacteria 5168
293 Ga0495622_0064682 3300046557 Bacteria 1691
294 Ga0495633_0001739 3300046558 Bacteria 16241
295 Ga0495633_0003543 3300046558 Bacteria 10336
296 Ga0495633_0015477 3300046558 Bacteria 3957
297 Ga0495633_0019729 3300046558 Bacteria 3404
298 Ga0495633_0023389 3300046558 Bacteria 3063
299 Ga0495633_0035399 3300046558 Bacteria 2397
300 Ga0495633_0085653 3300046558 Bacteria 1465
301 Ga0495656_0031943 3300046615 Bacteria 2139
302 Ga0495668_0000707 3300046616 Bacteria 40246
303 Ga0495668_0000927 3300046616 Bacteria 32722
304 Ga0495668_0001304 3300046616 Bacteria 24567
305 Ga0495668_0025567 3300046616 Bacteria 3354
306 Ga0495668_0031401 3300046616 Bacteria 2994
307 Ga0495668_0033476 3300046616 Bacteria 2887
308 Ga0495668_0043190 3300046616 Bacteria 2508
309 Ga0495668_0059921 3300046616 Bacteria 2100
310 Ga0495668_0083385 3300046616 Bacteria 1753
311 Ga0495611_0000123 3300046648 Bacteria 54632
312 Ga0495611_0002117 3300046648 Bacteria 9307
313 Ga0495611_0006212 3300046648 Bacteria 5097
314 Ga0495611_0007159 3300046648 Bacteria 4739
315 Ga0495611_0010321 3300046648 Bacteria 3950
316 Ga0495611_0011325 3300046648 Bacteria 3781
317 Ga0495611_0030994 3300046648 Bacteria 2352
318 Ga0495625_0005650 3300046660 Bacteria 11333
319 Ga0495625_0021699 3300046660 Bacteria 4938
320 Ga0495625_0101301 3300046660 Bacteria 1978
321 Ga0495635_0133281 3300046663 Bacteria 1694
322 Ga0495661_0000252 3300046665 Bacteria 61493
323 Ga0495661_0000421 3300046665 Bacteria 44752
324 Ga0495661_0003325 3300046665 Bacteria 11919
325 Ga0495661_0007569 3300046665 Bacteria 7568
326 Ga0495661_0008421 3300046665 Bacteria 7131
327 Ga0495661_0018070 3300046665 Bacteria 4643
328 Ga0495661_0021596 3300046665 Bacteria 4195
329 Ga0495661_0023986 3300046665 Bacteria 3952
330 Ga0495661_0026875 3300046665 Bacteria 3701
331 Ga0495661_0046911 3300046665 Bacteria 2634
332 Ga0495661_0089205 3300046665 Bacteria 1758
333 Ga0495661_0140085 3300046665 Bacteria 1316
334 Ga0495661_0151078 3300046665 Bacteria 1254
335 Ga0495588_0000070 3300046674 Bacteria 227611
336 Ga0495588_0013656 3300046674 Bacteria 3871
337 Ga0495588_0015276 3300046674 Bacteria 3691
338 Ga0495588_0020832 3300046674 Bacteria 3226
339 Ga0495588_0038748 3300046674 Bacteria 2425
340 Ga0495588_0046888 3300046674 Bacteria 2217
341 Ga0495588_0081046 3300046674 Bacteria 1694
342 Ga0495588_0166429 3300046674 Bacteria 1166
343 Ga0495623_0006482 3300046679 Bacteria 7617
344 Ga0495623_0083064 3300046679 Bacteria 1979
345 Ga0495623_0200190 3300046679 Bacteria 1148
346 Ga0495669_0000117 3300046684 Bacteria 51712
347 Ga0495669_0001714 3300046684 Bacteria 8978
348 Ga0495669_0014082 3300046684 Bacteria 3417
349 Ga0495669_0028473 3300046684 Bacteria 2447
350 Ga0495669_0056547 3300046684 Bacteria 1768
351 Ga0495613_0069696 3300046689 Bacteria 2563
352 Ga0495613_0088903 3300046689 Bacteria 2238
353 Ga0495624_0000774 3300046690 Bacteria 25209
354 Ga0495624_0281863 3300046690 Bacteria 1003
355 Ga0495670_0001221 3300046691 Bacteria 12504
356 Ga0495670_0005733 3300046691 Bacteria 6092
357 Ga0495670_0012234 3300046691 Bacteria 4218
358 Ga0495670_0108614 3300046691 Bacteria 1434
359 Ga0495670_0109937 3300046691 Bacteria 1425
360 Ga0495670_0123437 3300046691 Bacteria 1346
361 Ga0495671_0002822 3300046692 Bacteria 10871
362 Ga0495671_0021387 3300046692 Bacteria 3399
363 Ga0495671_0027827 3300046692 Bacteria 2915
364 Ga0495671_0040448 3300046692 Bacteria 2351
365 Ga0495671_0050817 3300046692 Bacteria 2063
366 Ga0495671_0064673 3300046692 Bacteria 1800
367 Ga0495671_0067829 3300046692 Bacteria 1754
368 Ga0495649_0000150 3300046694 Bacteria 60827
369 Ga0495649_0004569 3300046694 Bacteria 9021
370 Ga0495649_0053896 3300046694 Bacteria 2176
371 Ga0495649_0102316 3300046694 Bacteria 1522
372 Ga0495589_0000036 3300046794 Bacteria 153299
373 Ga0495589_0000175 3300046794 Bacteria 57368
374 Ga0495589_0000791 3300046794 Bacteria 20069
375 Ga0495589_0003414 3300046794 Bacteria 8598
376 Ga0495589_0034067 3300046794 Bacteria 2557
377 Ga0495589_0082466 3300046794 Bacteria 1563
378 Ga0495589_0124220 3300046794 Bacteria 1241
379 Ga0495660_0000113 3300046810 Bacteria 86593
380 Ga0495660_0010356 3300046810 Bacteria 5422
381 Ga0495660_0036116 3300046810 Bacteria 2757
382 Ga0495660_0049385 3300046810 Bacteria 2297
383 Ga0495660_0054522 3300046810 Bacteria 2165
384 Ga0495660_0135586 3300046810 Bacteria 1230
385 Ga0495604_0005089 3300047317 Bacteria 10409
386 Ga0495604_0080726 3300047317 Bacteria 2436
387 Ga0495604_0130248 3300047317 Bacteria 1809
388 Ga0495636_0000660 3300047318 Bacteria 12650
389 Ga0495672_0000389 3300047320 Bacteria 54063
390 Ga0495672_0000510 3300047320 Bacteria 44816
391 Ga0495672_0000533 3300047320 Bacteria 43150
392 Ga0495672_0004505 3300047320 Bacteria 11383
393 Ga0495672_0019468 3300047320 Bacteria 4474
394 Ga0495672_0061469 3300047320 Bacteria 2165
395 Ga0495676_0000349 3300047321 Bacteria 37663
396 Ga0495676_0014009 3300047321 Bacteria 7182
397 Ga0495676_0020306 3300047321 Bacteria 5832
398 Ga0495676_0052042 3300047321 Bacteria 3272
399 Ga0495676_0098255 3300047321 Bacteria 2173
400 Ga0495680_0133421 3300047322 Bacteria 1822
401 Ga0495683_0000415 3300047323 Bacteria 34114
402 Ga0495683_0001884 3300047323 Bacteria 13131
403 Ga0495683_0021893 3300047323 Bacteria 3291
404 Ga0495683_0034306 3300047323 Bacteria 2580
405 Ga0495683_0063667 3300047323 Bacteria 1822
406 Ga0495687_000074 3300047443 Bacteria 153464
407 Ga0495687_001207 3300047443 Bacteria 24759
408 Ga0495687_001607 3300047443 Bacteria 20374
409 Ga0495687_002463 3300047443 Bacteria 14800
410 Ga0495687_019587 3300047443 Bacteria 3315
411 Ga0495687_059856 3300047443 Bacteria 1573
412 Ga0495675_0001414 3300047444 Bacteria 14538
413 Ga0495675_0028953 3300047444 Bacteria 3531
414 Ga0495677_0000042 3300047445 Bacteria 75189
415 Ga0495677_0000828 3300047445 Bacteria 12482
416 Ga0495677_0001650 3300047445 Bacteria 8964
417 Ga0495677_0002572 3300047445 Bacteria 7103
418 Ga0495677_0009465 3300047445 Bacteria 3598
419 Ga0495677_0019208 3300047445 Bacteria 2479
420 Ga0495677_0022918 3300047445 Bacteria 2266
421 Ga0495677_0033604 3300047445 Bacteria 1869
422 Ga0495677_0055197 3300047445 Bacteria 1466
423 Ga0495677_0069868 3300047445 Bacteria 1308
424 Ga0495679_007816 3300047446 Bacteria 4410
425 Ga0495679_010640 3300047446 Bacteria 3601
426 Ga0495679_022868 3300047446 Bacteria 2132
427 Ga0495679_025596 3300047446 Bacteria 1970
428 Ga0495679_047981 3300047446 Bacteria 1293
429 Ga0495685_003242 3300047447 Bacteria 5178
430 Ga0495685_048539 3300047447 Bacteria 1443
431 Ga0495673_0006405 3300047469 Bacteria 6922
432 Ga0495681_0002400 3300047470 Bacteria 13407
433 Ga0495681_0005483 3300047470 Bacteria 8482
434 Ga0495681_0005669 3300047470 Bacteria 8315
435 Ga0495681_0014450 3300047470 Bacteria 4523
436 Ga0495681_0023976 3300047470 Bacteria 3226
437 Ga0495681_0084952 3300047470 Bacteria 1406
438 Ga0495686_0001294 3300047472 Bacteria 28201
439 Ga0495686_0037808 3300047472 Bacteria 3091
440 Ga0495686_0124524 3300047472 Bacteria 1533
441 Ga0495593_0061767 3300047673 Bacteria 1959
442 Ga0495602_0013649 3300048088 Bacteria 8289
443 Ga0495614_0001389 3300048089 Bacteria 10450
444 Ga0495614_0140684 3300048089 Bacteria 1072
445 Ga0495626_0000006 3300048091 Bacteria 284977
446 Ga0495626_0000855 3300048091 Bacteria 27104
447 Ga0495626_0002374 3300048091 Bacteria 13153
448 Ga0495626_0002968 3300048091 Bacteria 11254
449 Ga0495626_0003771 3300048091 Bacteria 9533
450 Ga0495626_0008465 3300048091 Bacteria 5637
451 Ga0495626_0009201 3300048091 Bacteria 5347
452 Ga0495626_0011508 3300048091 Bacteria 4679
453 Ga0495626_0017825 3300048091 Bacteria 3580
454 Ga0495626_0023814 3300048091 Bacteria 3009
455 Ga0495626_0034060 3300048091 Bacteria 2438
456 Ga0495626_0036336 3300048091 Bacteria 2347
457 Ga0495626_0042175 3300048091 Bacteria 2144
458 Ga0495626_0065764 3300048091 Bacteria 1640
459 Ga0495626_0081958 3300048091 Bacteria 1431
460 Ga0496101_0103038 3300048904 Bacteria 2138
461 Ga0496101_0445301 3300048904 Bacteria 1022
462 Ga0496103_0009263 3300048906 Bacteria 5834
463 Ga0496103_0009308 3300048906 Bacteria 5821
464 Ga0496103_0009322 3300048906 Bacteria 5815
465 Ga0496103_0159874 3300048906 Bacteria 1445
466 Ga0496103_0189000 3300048906 Bacteria 1324
467 Ga0496107_0036846 3300048910 Bacteria 3509
468 Ga0496107_0040480 3300048910 Bacteria 3345
469 Ga0496107_0191856 3300048910 Bacteria 1518
470 Ga0496108_0193260 3300048911 Bacteria 1764
471 Ga0496109_0060951 3300048912 Bacteria 3448
472 Ga0496109_0583808 3300048912 Bacteria 1053
473 Ga0496110_0000073 3300048913 Bacteria 51301
474 Ga0496110_0030185 3300048913 Bacteria 4671
475 Ga0496111_0174702 3300048914 Bacteria 1597
476 Ga0496112_0120114 3300048915 Bacteria 2598
477 Ga0496113_0056133 3300048916 Bacteria 2955
478 Ga0496113_0168222 3300048916 Bacteria 1735
479 Ga0496115_0328680 3300048918 Bacteria 1249
480 Ga0496121_0029875 3300048924 Bacteria 5021
481 Ga0496121_0054323 3300048924 Bacteria 3348
482 Ga0496122_0001022 3300048925 Bacteria 49494
483 Ga0496122_0001512 3300048925 Bacteria 37063
484 Ga0496122_0018051 3300048925 Bacteria 6542
485 Ga0496122_0048992 3300048925 Bacteria 3242
486 Ga0496123_0001219 3300048926 Bacteria 37517
487 Ga0496123_0002689 3300048926 Bacteria 21404
488 Ga0496123_0008639 3300048926 Bacteria 9315
489 Ga0496123_0106042 3300048926 Bacteria 1620
490 Ga0496124_0027950 3300048927 Bacteria 5052
491 Ga0496124_0242533 3300048927 Bacteria 1339
492 Ga0496124_0334925 3300048927 Bacteria 1077
493 Ga0496125_0001146 3300048928 Bacteria 40202
494 Ga0496125_0006911 3300048928 Bacteria 12147
495 Ga0496125_0020102 3300048928 Bacteria 6278
496 Ga0495678_000603 3300049459 Bacteria 33820
497 Ga0495678_000616 3300049459 Bacteria 33287
498 Ga0495678_001182 3300049459 Bacteria 21497
499 Ga0495678_002692 3300049459 Bacteria 11727
500 Ga0495678_035959 3300049459 Bacteria 2026
501 Ga0495678_057144 3300049459 Bacteria 1479
502 Ga0495682_0010155 3300049460 Bacteria 3656
503 Ga0495682_0014529 3300049460 Bacteria 2985
504 Ga0501047_0562970 3300049581 Bacteria 963
505 Ga0501035_0013391 3300049822 Bacteria 7571
506 Ga0501044_0276394 3300049823 Bacteria 1614
507 2511250125 2511231003 Bacteria 5606035
508 2643797613 2643221556 Bacteria 7251154
509 2644074981 2643221611 Bacteria 6820941
510 2644470605 2643221684 Bacteria 7145183
511 2809144108 2808606418 Bacteria 6724496
512 2819592103 2818991445 Bacteria 4955017
513 2884815100 2884811622 Bacteria 5552861
514 2884840478 2884836552 Bacteria 5219991
515 2884855735 2884852848 Bacteria 5221161
516 2896157340 2896154374 Bacteria 5221518
517 8047678908 8047673197 Bacteria 7395230
518 Ga0495650_0014781
519 JGI25155J39150_1000396
520 JGI25155J39150_1000991
521 JGI25156J39149_1001044
522 JGI25154J39366_1000878
523 JGI25154J39366_1000945
524 JGI25157J39369_1000094
525 Ga0055532_1000017
526 Ga0055537_1004733
527 Ga0055524_1000027
528 Ga0055530_10001504
529 Ga0065165_1000606
530 Ga0070660_100210223
531 Ga0070659_100050085
532 Ga0070659_100102466
533 Ga0068855_100020283
534 Ga0068855_100243493
535 Ga0068855_100350073
536 Ga0070664_100081937
537 Ga0068852_100219743
538 Ga0099826_10000003
539 Ga0105241_10003135
540 Ga0105242_10365298
541 Ga0105238_10044375
542 Ga0182008_10017668
543 Ga0209435_100015
544 Ga0209435_100112
545 Ga0209147_100004
546 Ga0209563_100015
547 Ga0209437_100045
548 Ga0209258_100304
549 Ga0209646_1000020
550 Ga0209646_1000040
551 Ga0209026_1000034
552 Ga0209026_1002489
553 Ga0209677_101807
554 Ga0209148_1002752
555 Ga0209759_1000049
556 Ga0209759_1000073
557 Ga0209565_1002756
558 Ga0209050_1000219
559 Ga0209256_1000013
560 Ga0207705_10006255
561 Ga0207654_10007063
562 Ga0207695_10009565
563 Ga0207657_10008778
564 Ga0207690_10010090
565 Ga0207690_10171527
566 Ga0207706_10001423
567 Ga0207706_10196844
568 Ga0207686_10006121
569 Ga0207667_10013369
570 Ga0207667_10031100
571 Ga0207667_10266205
572 Ga0207667_10422980
573 Ga0207698_10216438
574 Ga0209282_1000002
575 Ga0307518_10018408
576 Ga0307414_10036000
577 Ga0395899_0029888
578 Ga0395899_0051351
579 Ga0395899_0063304
580 Ga0395899_0173203
581 Ga0395899_0231861
582 Ga0395899_0276536
583 Ga0395900_0000267
584 Ga0395900_0000983
585 Ga0395900_0011484
586 Ga0395900_0051407
587 Ga0395900_0078219
588 Ga0395900_0102289
589 Ga0395900_0111534
590 Ga0395900_0268820
591 Ga0395900_0464736
592 Ga0395898_0035286
593 Ga0395898_0210564
594 Ga0395905_0042496
595 Ga0395905_0051637
596 Ga0395905_0228658
597 Ga0395905_0303122
598 Ga0395901_0028109
599 Ga0395901_0032910
600 Ga0395901_0115020
601 Ga0395901_0188279
602 Ga0395901_0381070
603 Ga0450911_000293
604 Ga0450904_000059
605 Ga0439458_0033223
606 Ga0466969_0002789
607 Ga0466969_0029652
608 Ga0466969_0157668
609 Ga0466972_0002560
610 Ga0466965_0019173
611 Ga0466966_0010214
612 Ga0466966_0030824
613 Ga0466966_0159770
614 Ga0466961_0083336
615 Ga0466961_0240311
616 Ga0466963_0124710
617 Ga0466964_0004267
618 Ga0466964_0126658
619 Ga0466957_0000122
620 Ga0466957_0026219
621 Ga0466959_0031892
622 Ga0466959_0243462
623 Ga0466967_0004163
624 Ga0466967_0267372
625 Ga0495617_000002
626 Ga0495627_000839
627 Ga0495627_011926
628 Ga0495627_013324
629 Ga0495603_0086613
630 Ga0495590_0000061
631 Ga0495590_0017029
632 Ga0495590_0033944
633 Ga0495590_0037772
634 Ga0495591_000401
635 Ga0495591_006901
636 Ga0495638_0005909
637 Ga0495653_0194291
638 Ga0495653_0210724
639 Ga0495650_0000056
640 Ga0495650_0002634
641 Ga0495580_0013839
642 Ga0495580_0064899
643 Ga0495582_0010830
644 Ga0495582_0068595
645 Ga0495582_0122723
646 Ga0495605_0000463
647 Ga0495605_0000481
648 Ga0495605_0005351
649 Ga0495605_0006438
650 Ga0495605_0013716
651 Ga0495605_0028104
652 Ga0495605_0044128
653 Ga0495605_0056877
654 Ga0495605_0074756
655 Ga0495605_0086800
656 Ga0495584_0000011
657 Ga0495584_0000283
658 Ga0495584_0003137
659 Ga0495584_0005900
660 Ga0495584_0015211
661 Ga0495584_0025092
662 Ga0495584_0025239
663 Ga0495584_0041550
664 Ga0495584_0061898
665 Ga0495584_0070005
666 Ga0495585_0000140
667 Ga0495585_0000337
668 Ga0495585_0002897
669 Ga0495585_0003179
670 Ga0495585_0004648
671 Ga0495585_0004830
672 Ga0495585_0012888
673 Ga0495585_0017097
674 Ga0495585_0018185
675 Ga0495585_0024366
676 Ga0495585_0055178
677 Ga0495585_0058823
678 Ga0495585_0067244
679 Ga0495585_0089654
680 Ga0495585_0094229
681 Ga0495585_0150746
682 Ga0495585_0206640
683 Ga0495594_0004531
684 Ga0495594_0005409
685 Ga0495594_0013042
686 Ga0495594_0040225
687 Ga0495594_0040816
688 Ga0495594_0042926
689 Ga0495594_0076983
690 Ga0495596_0000198
691 Ga0495596_0002279
692 Ga0495596_0002721
693 Ga0495596_0007499
694 Ga0495596_0011799
695 Ga0495596_0012705
696 Ga0495596_0027418
697 Ga0495596_0053167
698 Ga0495596_0061791
699 Ga0495607_0000592
700 Ga0495607_0001716
701 Ga0495607_0002808
702 Ga0495607_0014505
703 Ga0495607_0014865
704 Ga0495607_0018113
705 Ga0495607_0059214
706 Ga0495607_0156367
707 Ga0495583_0000204
708 Ga0495583_0000882
709 Ga0495583_0000971
710 Ga0495583_0002391
711 Ga0495583_0005525
712 Ga0495583_0012869
713 Ga0495583_0015903
714 Ga0495583_0019428
715 Ga0495583_0045496
716 Ga0495583_0091408
717 Ga0495583_0117959
718 Ga0495606_0006397
719 Ga0495606_0007566
720 Ga0495606_0012745
721 Ga0495606_0029621
722 Ga0495606_0048909
723 Ga0495606_0049851
724 Ga0495606_0128461
725 Ga0495606_0235350
726 Ga0495610_0002516
727 Ga0495610_0075104
728 Ga0495616_0002549
729 Ga0495616_0006758
730 Ga0495616_0007773
731 Ga0495616_0009816
732 Ga0495616_0023082
733 Ga0495616_0041456
734 Ga0495616_0060942
735 Ga0495616_0132098
736 Ga0495620_0008759
737 Ga0495630_0152727
738 Ga0495631_0000399
739 Ga0495631_0003088
740 Ga0495631_0008555
741 Ga0495631_0012875
742 Ga0495631_0014163
743 Ga0495631_0015236
744 Ga0495631_0016976
745 Ga0495631_0021869
746 Ga0495631_0043888
747 Ga0495631_0043975
748 Ga0495631_0063135
749 Ga0495632_0000134
750 Ga0495632_0000559
751 Ga0495632_0013845
752 Ga0495632_0021645
753 Ga0495632_0041167
754 Ga0495632_0089237
755 Ga0495637_0000006
756 Ga0495637_0051724
757 Ga0495643_0001932
758 Ga0495643_0006044
759 Ga0495643_0008896
760 Ga0495643_0009333
761 Ga0495643_0011779
762 Ga0495643_0025111
763 Ga0495643_0109515
764 Ga0495644_0001386
765 Ga0495644_0021162
766 Ga0495644_0022443
767 Ga0495644_0029213
768 Ga0495644_0053655
769 Ga0495648_0000966
770 Ga0495648_0008073
771 Ga0495648_0012497
772 Ga0495648_0015291
773 Ga0495648_0056848
774 Ga0495648_0077682
775 Ga0495648_0093894
776 Ga0495648_0127874
777 Ga0495666_0001150
778 Ga0495666_0029546
779 Ga0495666_0043894
780 Ga0495642_0001744
781 Ga0495642_0002432
782 Ga0495642_0003443
783 Ga0495642_0003670
784 Ga0495642_0004939
785 Ga0495642_0006445
786 Ga0495642_0015015
787 Ga0495642_0017579
788 Ga0495642_0017633
789 Ga0495642_0026167
790 Ga0495654_0013789
791 Ga0495654_0046397
792 Ga0495665_0047323
793 Ga0495665_0099415
794 Ga0495665_0113228
795 Ga0495640_0014474
796 Ga0495586_0005486
797 Ga0495586_0006155
798 Ga0495586_0143378
799 Ga0495609_0000234
800 Ga0495609_0001034
801 Ga0495609_0008786
802 Ga0495609_0032038
803 Ga0495609_0087226
804 Ga0495597_0003382
805 Ga0495597_0010268
806 Ga0495597_0019129
807 Ga0495597_0054199
808 Ga0495597_0058852
809 Ga0495622_0007199
810 Ga0495622_0064682
811 Ga0495633_0001739
812 Ga0495633_0003543
813 Ga0495633_0015477
814 Ga0495633_0019729
815 Ga0495633_0023389
816 Ga0495633_0035399
817 Ga0495633_0085653
818 Ga0495656_0031943
819 Ga0495668_0000707
820 Ga0495668_0000927
821 Ga0495668_0001304
822 Ga0495668_0025567
823 Ga0495668_0031401
824 Ga0495668_0033476
825 Ga0495668_0043190
826 Ga0495668_0059921
827 Ga0495668_0083385
828 Ga0495611_0000123
829 Ga0495611_0002117
830 Ga0495611_0006212
831 Ga0495611_0007159
832 Ga0495611_0010321
833 Ga0495611_0011325
834 Ga0495611_0030994
835 Ga0495625_0005650
836 Ga0495625_0021699
837 Ga0495625_0101301
838 Ga0495635_0133281
839 Ga0495661_0000252
840 Ga0495661_0000421
841 Ga0495661_0003325
842 Ga0495661_0007569
843 Ga0495661_0008421
844 Ga0495661_0018070
845 Ga0495661_0021596
846 Ga0495661_0023986
847 Ga0495661_0026875
848 Ga0495661_0046911
849 Ga0495661_0089205
850 Ga0495661_0140085
851 Ga0495661_0151078
852 Ga0495588_0000070
853 Ga0495588_0013656
854 Ga0495588_0015276
855 Ga0495588_0020832
856 Ga0495588_0038748
857 Ga0495588_0046888
858 Ga0495588_0081046
859 Ga0495588_0166429
860 Ga0495623_0006482
861 Ga0495623_0083064
862 Ga0495623_0200190
863 Ga0495669_0000117
864 Ga0495669_0001714
865 Ga0495669_0014082
866 Ga0495669_0028473
867 Ga0495669_0056547
868 Ga0495613_0069696
869 Ga0495613_0088903
870 Ga0495624_0000774
871 Ga0495624_0281863
872 Ga0495670_0001221
873 Ga0495670_0005733
874 Ga0495670_0012234
875 Ga0495670_0108614
876 Ga0495670_0109937
877 Ga0495670_0123437
878 Ga0495671_0002822
879 Ga0495671_0021387
880 Ga0495671_0027827
881 Ga0495671_0040448
882 Ga0495671_0050817
883 Ga0495671_0064673
884 Ga0495671_0067829
885 Ga0495649_0000150
886 Ga0495649_0004569
887 Ga0495649_0053896
888 Ga0495649_0102316
889 Ga0495589_0000036
890 Ga0495589_0000175
891 Ga0495589_0000791
892 Ga0495589_0003414
893 Ga0495589_0034067
894 Ga0495589_0082466
895 Ga0495589_0124220
896 Ga0495660_0000113
897 Ga0495660_0010356
898 Ga0495660_0036116
899 Ga0495660_0049385
900 Ga0495660_0054522
901 Ga0495660_0135586
902 Ga0495604_0005089
903 Ga0495604_0080726
904 Ga0495604_0130248
905 Ga0495636_0000660
906 Ga0495672_0000389
907 Ga0495672_0000510
908 Ga0495672_0000533
909 Ga0495672_0004505
910 Ga0495672_0019468
911 Ga0495672_0061469
912 Ga0495676_0000349
913 Ga0495676_0014009
914 Ga0495676_0020306
915 Ga0495676_0052042
916 Ga0495676_0098255
917 Ga0495680_0133421
918 Ga0495683_0000415
919 Ga0495683_0001884
920 Ga0495683_0021893
921 Ga0495683_0034306
922 Ga0495683_0063667
923 Ga0495687_000074
924 Ga0495687_001207
925 Ga0495687_001607
926 Ga0495687_002463
927 Ga0495687_019587
928 Ga0495687_059856
929 Ga0495675_0001414
930 Ga0495675_0028953
931 Ga0495677_0000042
932 Ga0495677_0000828
933 Ga0495677_0001650
934 Ga0495677_0002572
935 Ga0495677_0009465
936 Ga0495677_0019208
937 Ga0495677_0022918
938 Ga0495677_0033604
939 Ga0495677_0055197
940 Ga0495677_0069868
941 Ga0495679_007816
942 Ga0495679_010640
943 Ga0495679_022868
944 Ga0495679_025596
945 Ga0495679_047981
946 Ga0495685_003242
947 Ga0495685_048539
948 Ga0495673_0006405
949 Ga0495681_0002400
950 Ga0495681_0005483
951 Ga0495681_0005669
952 Ga0495681_0014450
953 Ga0495681_0023976
954 Ga0495681_0084952
955 Ga0495686_0001294
956 Ga0495686_0037808
957 Ga0495686_0124524
958 Ga0495593_0061767
959 Ga0495602_0013649
960 Ga0495614_0001389
961 Ga0495614_0140684
962 Ga0495626_0000006
963 Ga0495626_0000855
964 Ga0495626_0002374
965 Ga0495626_0002968
966 Ga0495626_0003771
967 Ga0495626_0008465
968 Ga0495626_0009201
969 Ga0495626_0011508
970 Ga0495626_0017825
971 Ga0495626_0023814
972 Ga0495626_0034060
973 Ga0495626_0036336
974 Ga0495626_0042175
975 Ga0495626_0065764
976 Ga0495626_0081958
977 Ga0496101_0103038
978 Ga0496101_0445301
979 Ga0496103_0009263
980 Ga0496103_0009308
981 Ga0496103_0009322
982 Ga0496103_0159874
983 Ga0496103_0189000
984 Ga0496107_0036846
985 Ga0496107_0040480
986 Ga0496107_0191856
987 Ga0496108_0193260
988 Ga0496109_0060951
989 Ga0496109_0583808
990 Ga0496110_0000073
991 Ga0496110_0030185
992 Ga0496111_0174702
993 Ga0496112_0120114
994 Ga0496113_0056133
995 Ga0496113_0168222
996 Ga0496115_0328680
997 Ga0496121_0029875
998 Ga0496121_0054323
999 Ga0496122_0001022
1000 Ga0496122_0001512
1001 Ga0496122_0018051
1002 Ga0496122_0048992
1003 Ga0496123_0001219
1004 Ga0496123_0002689
1005 Ga0496123_0008639
1006 Ga0496123_0106042
1007 Ga0496124_0027950
1008 Ga0496124_0242533
1009 Ga0496124_0334925
1010 Ga0496125_0001146
1011 Ga0496125_0006911
1012 Ga0496125_0020102
1013 Ga0495678_000603
1014 Ga0495678_000616
1015 Ga0495678_001182
1016 Ga0495678_002692
1017 Ga0495678_035959
1018 Ga0495678_057144
1019 Ga0495682_0010155
1020 Ga0495682_0014529
1021 Ga0501047_0562970
1022 Ga0501035_0013391
1023 Ga0501044_0276394
1024 2511250125
1025 2643797613
1026 2644074981
1027 2644470605
1028 2809144108
1029 2819592103
1030 2884815100
1031 2884840478
1032 2884855735
1033 2896157340
1034 8047678908

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00586

AIRS

AIR synthase related protein, N-terminal domain

29

139

0.96

PF02769

AIRS_C

AIR synthase related protein, C-terminal domain

174

292

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6mfm-assembly1.cif.gz_A structure of thiamine-monophosphate kinase from acinetobacter baumannii in complex with adenosine diphosphate (adp) and thiamine diphosphate (tpp), orthorhombic crystal form 0.9381 3 320
6mfm-assembly1.cif.gz_A structure of thiamine-monophosphate kinase from acinetobacter baumannii in complex with adenosine diphosphate (adp) and thiamine diphosphate (tpp), orthorhombic crystal form 0.9351 3 320
6xep-assembly1.cif.gz_A-2 crystal structure of thiamine-monophosphate kinase from stenotrophomonas maltophilia k279a 0.9116 18 309
7du3-assembly1.cif.gz_A error: 404 client error: for url: https://data.rcsb.org/rest/v1/core/entry/7du3 0.911 3 309
3mcq-assembly1.cif.gz_A-2 crystal structure of thiamine-monophosphate kinase (mfla_0573) from methylobacillus flagellatus kt at 1.91 a resolution 0.9003 14 309
ID Description Score Start End Superfamily
5d9uB01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.9348 2 143 3.30.1330.10
5d9uB01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.9284 2 143 3.30.1330.10
3mcqA02 Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain 0.9208 145 309 3.90.650.10
3mcqA02 Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain 0.905 145 309 3.90.650.10
5cc8B02 Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain 0.9039 145 311 3.90.650.10
ID Description Score Start End GO Terms
AF-S9RX84-F1-model_v4 deleted 0.9763 48 321
AF-A0A4Y9S1Z2-F1-model_v4 Thiamine-phosphate kinase (EC 2.7.4.16) 0.9752 1 269 GO:0009030
GO:0009228
AF-A3RS23-F1-model_v4 deleted 0.9708 3 321
AF-A0A352KM80-F1-model_v4 Thiamine-phosphate kinase 0.9687 32 318 GO:0009030
GO:0009228
AF-A0A4Y9S1Z2-F1-model_v4 Thiamine-phosphate kinase (EC 2.7.4.16) 0.9681 1 269 GO:0009030
GO:0009228

Map