F457953

General Info

Members Datasets Scaffolds Average Seq Length
516 224 516 126

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10021675|Ga0070658_100216753
Length 129
Sequence MAARISGVTIPAEKQIWVALTYVYGIGPKTADTVLEAAKVERTMRTKDLTDAEIARIQDHINEHLTVEGELQRIVSGNIKRLKDIKAYRGLRHAQNLPSRGQRTKTNARTRRGRKVTVGGTAKKVASKT

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
75 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
76 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
77 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
138 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
139 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
140 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
141 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
142 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
143 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
144 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
145 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
146 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
147 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
148 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
149 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
150 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
151 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
152 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
153 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
154 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
155 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
156 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
157 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
158 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
159 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
160 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
166 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
167 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
168 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
169 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
170 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
171 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
172 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
173 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
174 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
175 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
176 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
177 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
178 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
179 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
180 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
185 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
190 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
191 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
192 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
193 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
194 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
195 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
196 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
197 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
198 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
199 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
200 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
201 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
202 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
203 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
204 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
205 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
206 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
207 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
208 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
209 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
210 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
211 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
212 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
213 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
214 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
215 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
216 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
217 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
218 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
219 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
220 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
221 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
222 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
223 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
224 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0.78
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.87
Nodule 0
Rhizoplane 1.36
Rhizosphere 74.81
Stem 0
Stem Tuber 0
Unclassified 0.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1002353 3300001915 Bacteria 4949
2 JGI24740J21852_10012465 3300001979 Bacteria 3202
3 JGI24737J22298_10000627 3300001990 Bacteria 12437
4 JGI24735J21928_10000234 3300002067 Bacteria 19508
5 JGI24742J22300_10000015 3300002244 Bacteria 27133
6 rootH2_10100464 3300003320 Bacteria 1291
7 rootH2_10157402 3300003320 Bacteria 1148
8 rootL2_10187944 3300003322 Bacteria 2180
9 rootH1_10147399 3300003323 Bacteria 1740
10 Ga0058862_12276830 3300004803 Bacteria 1165
11 Ga0065704_10087643 3300005289 Bacteria 3007
12 Ga0070658_10001050 3300005327 Bacteria 23600
13 Ga0070658_10001547 3300005327 Bacteria 19493
14 Ga0070658_10013124 3300005327 Bacteria 6648
15 Ga0070658_10021675 3300005327 Bacteria 5150
16 Ga0070658_10778379 3300005327 Bacteria 831
17 Ga0070658_11869082 3300005327 Bacteria 519
18 Ga0070676_10000822 3300005328 Bacteria 15354
19 Ga0070683_100005670 3300005329 Bacteria 10424
20 Ga0070683_100211574 3300005329 Bacteria 1842
21 Ga0070683_100315298 3300005329 Bacteria 1488
22 Ga0070683_100446411 3300005329 Bacteria 1234
23 Ga0070683_100795870 3300005329 Bacteria 906
24 Ga0070690_100046651 3300005330 Bacteria 2755
25 Ga0070670_100369487 3300005331 Bacteria 1262
26 Ga0070680_100000672 3300005336 Bacteria 23772
27 Ga0070680_100007297 3300005336 Bacteria 8427
28 Ga0070680_100042346 3300005336 Bacteria 3695
29 Ga0070682_100003469 3300005337 Bacteria 8728
30 Ga0070682_100179854 3300005337 Bacteria 1476
31 Ga0070682_100313836 3300005337 Bacteria 1155
32 Ga0070660_100000176 3300005339 Bacteria 42222
33 Ga0070660_100008505 3300005339 Bacteria 7181
34 Ga0070691_10086061 3300005341 Bacteria 1544
35 Ga0070692_10031113 3300005345 Bacteria 2673
36 Ga0070671_100025375 3300005355 Bacteria 4863
37 Ga0070671_100338477 3300005355 Bacteria 1283
38 Ga0070674_100004553 3300005356 Bacteria 7911
39 Ga0070674_100958444 3300005356 Bacteria 748
40 Ga0070673_101048561 3300005364 Unclassified 760
41 Ga0070688_100044629 3300005365 Bacteria 2736
42 Ga0070688_100450331 3300005365 Bacteria 962
43 Ga0070659_100000215 3300005366 Bacteria 44375
44 Ga0070659_101415363 3300005366 Bacteria 618
45 Ga0070659_102049334 3300005366 Bacteria 514
46 Ga0070667_100000001 3300005367 Bacteria 1108638
47 Ga0070667_100006776 3300005367 Bacteria 9512
48 Ga0070714_100000778 3300005435 Bacteria 22615
49 Ga0070708_100106299 3300005445 Unclassified 2576
50 Ga0070663_100094317 3300005455 Bacteria 2222
51 Ga0070678_100067625 3300005456 Bacteria 2660
52 Ga0070662_101259111 3300005457 Unclassified 636
53 Ga0070681_10004770 3300005458 Bacteria 12991
54 Ga0070681_10161591 3300005458 Bacteria 2164
55 Ga0070681_11208342 3300005458 Bacteria 678
56 Ga0070681_11886671 3300005458 Unclassified 525
57 Ga0068867_100004725 3300005459 Bacteria 9584
58 Ga0068867_100424268 3300005459 Bacteria 1127
59 Ga0070685_10010420 3300005466 Bacteria 4830
60 Ga0070679_100003967 3300005530 Bacteria 13627
61 Ga0070679_100049541 3300005530 Bacteria 4183
62 Ga0070679_100388161 3300005530 Bacteria 1343
63 Ga0070679_101011803 3300005530 Bacteria 775
64 Ga0070679_101077671 3300005530 Unclassified 748
65 Ga0070684_100001742 3300005535 Bacteria 15835
66 Ga0070684_100039598 3300005535 Bacteria 4055
67 Ga0068853_100062288 3300005539 Bacteria 3227
68 Ga0070686_100006928 3300005544 Bacteria 6316
69 Ga0070693_100332418 3300005547 Bacteria 1034
70 Ga0070665_100091766 3300005548 Bacteria 3042
71 Ga0070665_102360209 3300005548 Bacteria 534
72 Ga0068855_100000003 3300005563 Bacteria 589862
73 Ga0068855_100000168 3300005563 Bacteria 83242
74 Ga0068855_100006349 3300005563 Bacteria 14406
75 Ga0068855_100011906 3300005563 Bacteria 10518
76 Ga0068855_100126789 3300005563 Bacteria 2918
77 Ga0068855_100316803 3300005563 Bacteria 1725
78 Ga0068855_100868053 3300005563 Bacteria 955
79 Ga0068855_102044186 3300005563 Unclassified 578
80 Ga0068855_102457802 3300005563 Bacteria 519
81 Ga0068857_100000124 3300005577 Bacteria 46368
82 Ga0068857_100335639 3300005577 Bacteria 1398
83 Ga0068856_100000001 3300005614 Bacteria 565602
84 Ga0068856_100001797 3300005614 Bacteria 22390
85 Ga0068856_100049528 3300005614 Bacteria 4140
86 Ga0068856_100204704 3300005614 Bacteria 1988
87 Ga0068856_101068097 3300005614 Bacteria 825
88 Ga0068856_102189895 3300005614 Bacteria 562
89 Ga0068852_100344599 3300005616 Bacteria 1453
90 Ga0068864_100852475 3300005618 Unclassified 898
91 Ga0068861_100019408 3300005719 Bacteria 4856
92 Ga0068861_102107827 3300005719 Bacteria 564
93 Ga0068863_100088426 3300005841 Bacteria 2936
94 Ga0068863_100089668 3300005841 Unclassified 2916
95 Ga0068860_100272842 3300005843 Bacteria 1651
96 Ga0068860_100964465 3300005843 Bacteria 870
97 Ga0081455_10000003 3300005937 Bacteria 367763
98 Ga0081539_10051502 3300005985 Bacteria 2319
99 Ga0070717_10111437 3300006028 Bacteria 2335
100 Ga0075365_10001090 3300006038 Bacteria 11799
101 Ga0075365_10008718 3300006038 Bacteria 5779
102 Ga0075365_10057534 3300006038 Bacteria 2587
103 Ga0075365_10499071 3300006038 Bacteria 860
104 Ga0075365_10502988 3300006038 Bacteria 856
105 Ga0075365_10678512 3300006038 Bacteria 728
106 Ga0075368_10000084 3300006042 Bacteria 23187
107 Ga0075368_10013594 3300006042 Bacteria 2992
108 Ga0075363_100000006 3300006048 Bacteria 47292
109 Ga0075364_10001750 3300006051 Bacteria 11981
110 Ga0075364_10007125 3300006051 Bacteria 6614
111 Ga0075364_10010881 3300006051 Bacteria 5512
112 Ga0075364_10042358 3300006051 Bacteria 2958
113 Ga0075364_10058510 3300006051 Unclassified 2526
114 Ga0075364_10298727 3300006051 Bacteria 1096
115 Ga0075364_10364163 3300006051 Bacteria 986
116 Ga0075362_10000049 3300006177 Bacteria 39227
117 Ga0075362_10047684 3300006177 Bacteria 1909
118 Ga0075362_10196881 3300006177 Bacteria 980
119 Ga0075367_10000014 3300006178 Bacteria 37444
120 Ga0075367_10000021 3300006178 Bacteria 33969
121 Ga0075367_10437889 3300006178 Bacteria 828
122 Ga0075369_10000003 3300006186 Bacteria 205269
123 Ga0075369_10000057 3300006186 Bacteria 28832
124 Ga0075366_10000001 3300006195 Bacteria 569172
125 Ga0075366_10000065 3300006195 Bacteria 39633
126 Ga0075366_10000317 3300006195 Bacteria 21934
127 Ga0075366_10001099 3300006195 Bacteria 13281
128 Ga0075366_10016676 3300006195 Bacteria 4223
129 Ga0075366_10027882 3300006195 Bacteria 3314
130 Ga0075366_10068475 3300006195 Bacteria 2112
131 Ga0075366_10484917 3300006195 Bacteria 764
132 Ga0075366_10716012 3300006195 Bacteria 622
133 Ga0097621_100000003 3300006237 Bacteria 164830
134 Ga0075370_10002783 3300006353 Bacteria 8197
135 Ga0075370_10004609 3300006353 Bacteria 6725
136 Ga0075370_10053738 3300006353 Bacteria 2286
137 Ga0075370_10746373 3300006353 Bacteria 596
138 Ga0068871_100000013 3300006358 Bacteria 102533
139 Ga0068871_100000039 3300006358 Bacteria 69204
140 Ga0068871_100325559 3300006358 Bacteria 1354
141 Ga0068871_100616006 3300006358 Bacteria 988
142 Ga0068871_100908341 3300006358 Unclassified 816
143 Ga0068865_100104472 3300006881 Bacteria 2079
144 Ga0105240_10000003 3300009093 Bacteria 1183681
145 Ga0105240_10036292 3300009093 Bacteria 6342
146 Ga0105240_10217589 3300009093 Unclassified 2227
147 Ga0105240_10923636 3300009093 Bacteria 937
148 Ga0105245_10000001 3300009098 Bacteria 939270
149 Ga0105245_10000002 3300009098 Bacteria 634374
150 Ga0105245_10004395 3300009098 Bacteria 12469
151 Ga0105245_10161988 3300009098 Bacteria 2123
152 Ga0105245_10219574 3300009098 Bacteria 1834
153 Ga0105245_10425808 3300009098 Bacteria 1331
154 Ga0105245_10953160 3300009098 Bacteria 901
155 Ga0105247_10030446 3300009101 Bacteria 3272
156 Ga0105247_10040492 3300009101 Bacteria 2848
157 Ga0105243_10000001 3300009148 Bacteria 1156578
158 Ga0105243_10314874 3300009148 Bacteria 1424
159 Ga0105241_10000003 3300009174 Bacteria 839043
160 Ga0105241_10001993 3300009174 Bacteria 15454
161 Ga0105241_10159247 3300009174 Bacteria 1854
162 Ga0105241_10341799 3300009174 Bacteria 1297
163 Ga0105241_10684727 3300009174 Bacteria 934
164 Ga0105241_12011380 3300009174 Unclassified 569
165 Ga0105242_10000011 3300009176 Bacteria 149791
166 Ga0105242_10011274 3300009176 Bacteria 6869
167 Ga0105242_10229079 3300009176 Bacteria 1664
168 Ga0105248_10920771 3300009177 Bacteria 987
169 Ga0105237_10028841 3300009545 Bacteria 5647
170 Ga0105238_10323196 3300009551 Bacteria 1529
171 Ga0105249_10002379 3300009553 Bacteria 16319
172 Ga0105249_10790720 3300009553 Bacteria 1012
173 Ga0105032_109956 3300009979 Bacteria 772
174 Ga0105147_112828 3300009982 Bacteria 712
175 Ga0105033_109395 3300009986 Bacteria 856
176 Ga0105028_100489 3300009993 Bacteria 4227
177 Ga0105239_10051192 3300010375 Bacteria 4527
178 Ga0105239_10052752 3300010375 Bacteria 4460
179 Ga0105239_10161986 3300010375 Bacteria 2500
180 Ga0157373_10000351 3300013100 Bacteria 37083
181 Ga0157373_10202126 3300013100 Bacteria 1401
182 Ga0157373_10300217 3300013100 Bacteria 1140
183 Ga0157371_10000176 3300013102 Bacteria 93047
184 Ga0157370_10090586 3300013104 Bacteria 2872
185 Ga0157370_10956137 3300013104 Bacteria 776
186 Ga0157369_10003258 3300013105 Bacteria 19325
187 Ga0157369_10021294 3300013105 Bacteria 7250
188 Ga0157369_10165158 3300013105 Bacteria 2335
189 Ga0157369_10231942 3300013105 Bacteria 1930
190 Ga0157369_10726731 3300013105 Bacteria 1022
191 Ga0157369_11818530 3300013105 Bacteria 619
192 Ga0157374_10000031 3300013296 Bacteria 204840
193 Ga0157374_10009614 3300013296 Bacteria 8307
194 Ga0157374_10012419 3300013296 Bacteria 7410
195 Ga0157374_10040598 3300013296 Bacteria 4286
196 Ga0157374_10236244 3300013296 Bacteria 1796
197 Ga0157374_11256129 3300013296 Bacteria 762
198 Ga0157374_12084506 3300013296 Bacteria 594
199 Ga0157378_11640568 3300013297 Bacteria 689
200 Ga0157378_13092377 3300013297 Unclassified 517
201 Ga0163162_10407652 3300013306 Bacteria 1492
202 Ga0163162_11560439 3300013306 Bacteria 753
203 Ga0157372_10000670 3300013307 Bacteria 37704
204 Ga0157372_10002726 3300013307 Bacteria 19106
205 Ga0157372_11853840 3300013307 Bacteria 693
206 Ga0157372_12912766 3300013307 Bacteria 548
207 Ga0157375_10670502 3300013308 Bacteria 1192
208 Ga0163163_10747213 3300014325 Bacteria 1042
209 Ga0163163_12003993 3300014325 Bacteria 639
210 Ga0157377_10118595 3300014745 Bacteria 1601
211 Ga0157377_10362374 3300014745 Bacteria 976
212 Ga0157377_10510889 3300014745 Bacteria 842
213 Ga0157379_10048356 3300014968 Bacteria 3796
214 Ga0157376_10000001 3300014969 Bacteria 842910
215 Ga0197907_11443729 3300020069 Bacteria 1378
216 Ga0206351_10698135 3300020077 Unclassified 638
217 Ga0154015_1226069 3300020610 Bacteria 1522
218 Ga0207710_10083044 3300025900 Bacteria 1489
219 Ga0207647_10009820 3300025904 Bacteria 6783
220 Ga0207645_10016534 3300025907 Bacteria 4881
221 Ga0207705_10007444 3300025909 Bacteria 8051
222 Ga0207705_10010485 3300025909 Bacteria 6739
223 Ga0207705_10017713 3300025909 Bacteria 5095
224 Ga0207705_10033204 3300025909 Bacteria 3687
225 Ga0207705_10757104 3300025909 Bacteria 754
226 Ga0207654_10000002 3300025911 Bacteria 1460142
227 Ga0207654_10006639 3300025911 Bacteria 5820
228 Ga0207654_10089175 3300025911 Bacteria 1875
229 Ga0207654_10639264 3300025911 Bacteria 761
230 Ga0207654_11145291 3300025911 Unclassified 567
231 Ga0207707_10004217 3300025912 Bacteria 12723
232 Ga0207707_10202860 3300025912 Bacteria 1729
233 Ga0207707_11088232 3300025912 Bacteria 652
234 Ga0207707_11488094 3300025912 Unclassified 537
235 Ga0207695_10000005 3300025913 Bacteria 1196715
236 Ga0207695_10106873 3300025913 Bacteria 2784
237 Ga0207695_10174254 3300025913 Unclassified 2074
238 Ga0207695_10979802 3300025913 Bacteria 725
239 Ga0207695_11357354 3300025913 Unclassified 591
240 Ga0207671_10024736 3300025914 Bacteria 4510
241 Ga0207660_10000748 3300025917 Bacteria 21610
242 Ga0207660_10050330 3300025917 Bacteria 2957
243 Ga0207662_10150140 3300025918 Bacteria 1481
244 Ga0207657_10000804 3300025919 Bacteria 33189
245 Ga0207657_10016230 3300025919 Bacteria 7187
246 Ga0207652_10002682 3300025921 Bacteria 14930
247 Ga0207652_10008070 3300025921 Bacteria 8450
248 Ga0207652_10034163 3300025921 Bacteria 4284
249 Ga0207652_10107223 3300025921 Bacteria 2474
250 Ga0207652_10536872 3300025921 Unclassified 1052
251 Ga0207650_10726267 3300025925 Bacteria 840
252 Ga0207687_10000001 3300025927 Bacteria 1130810
253 Ga0207687_10000030 3300025927 Bacteria 155548
254 Ga0207687_10000318 3300025927 Bacteria 32809
255 Ga0207687_10142186 3300025927 Bacteria 1821
256 Ga0207687_10533918 3300025927 Bacteria 982
257 Ga0207700_11307220 3300025928 Bacteria 646
258 Ga0207664_10010802 3300025929 Bacteria 6461
259 Ga0207644_10016889 3300025931 Bacteria 4917
260 Ga0207644_10293846 3300025931 Bacteria 1307
261 Ga0207690_10000521 3300025932 Bacteria 24993
262 Ga0207690_11875129 3300025932 Bacteria 500
263 Ga0207706_10774540 3300025933 Bacteria 816
264 Ga0207686_10000001 3300025934 Bacteria 1169580
265 Ga0207686_10007276 3300025934 Bacteria 5956
266 Ga0207686_11450364 3300025934 Bacteria 565
267 Ga0207709_10000002 3300025935 Bacteria 1171536
268 Ga0207709_10525568 3300025935 Bacteria 927
269 Ga0207669_10003257 3300025937 Bacteria 7020
270 Ga0207704_10178515 3300025938 Bacteria 1532
271 Ga0207711_10445069 3300025941 Bacteria 1206
272 Ga0207661_10002824 3300025944 Bacteria 11992
273 Ga0207661_10665080 3300025944 Bacteria 957
274 Ga0207661_10933840 3300025944 Bacteria 799
275 Ga0207679_10035696 3300025945 Bacteria 3520
276 Ga0207667_10000008 3300025949 Bacteria 625138
277 Ga0207667_10000339 3300025949 Bacteria 64087
278 Ga0207667_10078889 3300025949 Bacteria 3412
279 Ga0207667_10124762 3300025949 Bacteria 2652
280 Ga0207667_10146112 3300025949 Bacteria 2434
281 Ga0207667_10272258 3300025949 Bacteria 1731
282 Ga0207667_10783578 3300025949 Bacteria 951
283 Ga0207667_11131145 3300025949 Unclassified 765
284 Ga0207667_11499309 3300025949 Unclassified 645
285 Ga0207712_10001459 3300025961 Bacteria 16136
286 Ga0207712_11765800 3300025961 Bacteria 554
287 Ga0207658_10000003 3300025986 Bacteria 1151934
288 Ga0207658_10032403 3300025986 Bacteria 3719
289 Ga0207639_12166119 3300026041 Unclassified 517
290 Ga0207678_10375096 3300026067 Bacteria 1229
291 Ga0207702_10000001 3300026078 Bacteria 895738
292 Ga0207702_10003219 3300026078 Bacteria 15080
293 Ga0207702_10059333 3300026078 Bacteria 3259
294 Ga0207702_10085287 3300026078 Bacteria 2752
295 Ga0207702_11113519 3300026078 Bacteria 784
296 Ga0207702_11556046 3300026078 Bacteria 655
297 Ga0207641_10078817 3300026088 Bacteria 2854
298 Ga0207648_10064628 3300026089 Unclassified 3189
299 Ga0207676_10595673 3300026095 Bacteria 1061
300 Ga0207674_10000001 3300026116 Bacteria 616581
301 Ga0207674_10279586 3300026116 Bacteria 1617
302 Ga0207675_100033313 3300026118 Bacteria 4801
303 Ga0207675_101818214 3300026118 Bacteria 628
304 Ga0207683_10093069 3300026121 Bacteria 2686
305 Ga0207698_10319277 3300026142 Bacteria 1454
306 Ga0209813_10000009 3300027866 Bacteria 102315
307 Ga0209813_10000657 3300027866 Bacteria 7930
308 Ga0268266_10003734 3300028379 Bacteria 14969
309 Ga0268264_10243752 3300028381 Bacteria 1666
310 Ga0265337_1000001 3300028556 Bacteria 140973
311 Ga0265337_1000227 3300028556 Bacteria 30136
312 Ga0265337_1000244 3300028556 Bacteria 29586
313 Ga0265337_1002833 3300028556 Bacteria 7759
314 Ga0265337_1019178 3300028556 Bacteria 2161
315 Ga0265337_1045387 3300028556 Bacteria 1250
316 Ga0265337_1068465 3300028556 Bacteria 977
317 Ga0265326_10006027 3300028558 Bacteria 3790
318 Ga0265326_10020745 3300028558 Unclassified 1883
319 Ga0265326_10037257 3300028558 Unclassified 1382
320 Ga0265326_10057481 3300028558 Bacteria 1100
321 Ga0265319_1006728 3300028563 Bacteria 5276
322 Ga0265319_1018550 3300028563 Bacteria 2617
323 Ga0265334_10000049 3300028573 Bacteria 89091
324 Ga0265334_10000114 3300028573 Bacteria 52821
325 Ga0265334_10012726 3300028573 Unclassified 3533
326 Ga0265334_10014268 3300028573 Bacteria 3312
327 Ga0265334_10125031 3300028573 Bacteria 917
328 Ga0265334_10171634 3300028573 Unclassified 759
329 Ga0265318_10084397 3300028577 Unclassified 1171
330 Ga0265323_10005524 3300028653 Bacteria 5370
331 Ga0265322_10001067 3300028654 Bacteria 9503
332 Ga0265322_10043941 3300028654 Bacteria 1272
333 Ga0265322_10124402 3300028654 Bacteria 735
334 Ga0265336_10001619 3300028666 Bacteria 10032
335 Ga0265336_10022737 3300028666 Unclassified 1994
336 Ga0265336_10030477 3300028666 Unclassified 1679
337 Ga0265336_10100994 3300028666 Unclassified 859
338 Ga0265336_10129915 3300028666 Bacteria 750
339 Ga0265338_10000003 3300028800 Bacteria 733923
340 Ga0265338_10000052 3300028800 Bacteria 209239
341 Ga0265338_10000054 3300028800 Bacteria 207383
342 Ga0265338_10000130 3300028800 Bacteria 137739
343 Ga0265338_10000178 3300028800 Bacteria 118345
344 Ga0265338_10000217 3300028800 Bacteria 106453
345 Ga0265338_10000366 3300028800 Bacteria 81024
346 Ga0265338_10000543 3300028800 Bacteria 66162
347 Ga0265338_10001885 3300028800 Bacteria 32838
348 Ga0265338_10002761 3300028800 Bacteria 25703
349 Ga0265338_10018679 3300028800 Bacteria 7408
350 Ga0265338_10022667 3300028800 Bacteria 6489
351 Ga0265338_10030478 3300028800 Bacteria 5313
352 Ga0265338_10043400 3300028800 Bacteria 4171
353 Ga0265338_10065231 3300028800 Bacteria 3161
354 Ga0265338_10070185 3300028800 Bacteria 3005
355 Ga0265338_10216983 3300028800 Bacteria 1431
356 Ga0265338_10413048 3300028800 Bacteria 960
357 Ga0265338_10790453 3300028800 Bacteria 651
358 Ga0265324_10037105 3300029957 Unclassified 1694
359 Ga0265324_10040577 3300029957 Bacteria 1612
360 Ga0265324_10072266 3300029957 Bacteria 1175
361 Ga0265324_10127903 3300029957 Bacteria 862
362 Ga0265324_10152483 3300029957 Unclassified 784
363 Ga0314311_1231626 3300030733 Bacteria 874
364 Ga0316179_1039642 3300030734 Bacteria 3124
365 Ga0265332_10008580 3300031238 Bacteria 4591
366 Ga0265320_10082566 3300031240 Bacteria 1498
367 Ga0265320_10138627 3300031240 Bacteria 1102
368 Ga0265325_10032449 3300031241 Bacteria 2788
369 Ga0265325_10052947 3300031241 Bacteria 2082
370 Ga0265329_10023327 3300031242 Unclassified 2062
371 Ga0265340_10000533 3300031247 Bacteria 21017
372 Ga0265339_10021858 3300031249 Bacteria 3713
373 Ga0265339_10089311 3300031249 Unclassified 1617
374 Ga0265339_10331536 3300031249 Unclassified 720
375 Ga0265327_10003601 3300031251 Bacteria 14609
376 Ga0265327_10010704 3300031251 Bacteria 6409
377 Ga0265327_10011075 3300031251 Bacteria 6259
378 Ga0265327_10339976 3300031251 Unclassified 656
379 Ga0265316_10049775 3300031344 Bacteria 3299
380 Ga0265316_10053557 3300031344 Bacteria 3161
381 Ga0265316_10132722 3300031344 Bacteria 1875
382 Ga0265313_10034154 3300031595 Unclassified 2575
383 Ga0265313_10066397 3300031595 Bacteria 1672
384 Ga0265313_10136635 3300031595 Unclassified 1057
385 Ga0265314_10012823 3300031711 Bacteria 6810
386 Ga0265314_10134200 3300031711 Bacteria 1540
387 Ga0265314_10237775 3300031711 Bacteria 1053
388 Ga0265314_10393916 3300031711 Bacteria 750
389 Ga0265342_10108366 3300031712 Unclassified 1575
390 Ga0265342_10112023 3300031712 Unclassified 1543
391 Ga0395899_0003098 3300037312 Bacteria 13233
392 Ga0395899_0008649 3300037312 Bacteria 7833
393 Ga0395899_0049607 3300037312 Bacteria 3120
394 Ga0395899_0573821 3300037312 Unclassified 722
395 Ga0395900_0001412 3300037418 Bacteria 28734
396 Ga0395900_0003612 3300037418 Bacteria 16623
397 Ga0395900_0035646 3300037418 Bacteria 5125
398 Ga0395900_0042797 3300037418 Bacteria 4666
399 Ga0395900_0077806 3300037418 Bacteria 3408
400 Ga0395900_0082715 3300037418 Bacteria 3298
401 Ga0395900_0139280 3300037418 Bacteria 2485
402 Ga0395900_0246895 3300037418 Bacteria 1788
403 Ga0395898_0002536 3300037466 Bacteria 21416
404 Ga0395898_0022692 3300037466 Bacteria 6353
405 Ga0395905_0000238 3300037471 Bacteria 83164
406 Ga0395905_0021494 3300037471 Bacteria 6101
407 Ga0395905_0208547 3300037471 Bacteria 1831
408 Ga0395905_0602710 3300037471 Bacteria 1000
409 Ga0395901_0014417 3300038443 Bacteria 8045
410 Ga0395901_0045964 3300038443 Bacteria 4533
411 Ga0395901_0102586 3300038443 Bacteria 3002
412 Ga0395901_0155131 3300038443 Bacteria 2405
413 Ga0395901_0547441 3300038443 Bacteria 1173
414 Ga0451802_1444779 3300041460 Bacteria 725
415 Ga0451804_0008465 3300041463 Bacteria 900
416 Ga0451807_1565165 3300041486 Bacteria 2206
417 Ga0466963_0074188 3300044694 Bacteria 2294
418 Ga0495629_0089573 3300046459 Bacteria 2146
419 Ga0495622_0000035 3300046557 Bacteria 122963
420 Ga0495588_0000116 3300046674 Bacteria 135919
421 Ga0495658_0003200 3300046683 Bacteria 8155
422 Ga0495670_0273124 3300046691 Bacteria 903
423 Ga0495649_0000182 3300046694 Bacteria 54760
424 Ga0495600_0006859 3300046809 Bacteria 6945
425 Ga0495672_0000016 3300047320 Bacteria 500601
426 Ga0495676_0074538 3300047321 Bacteria 2598
427 Ga0495593_0098814 3300047673 Bacteria 1498
428 Ga0495602_0115900 3300048088 Bacteria 2166
429 Ga0496100_0152007 3300048903 Bacteria 1652
430 Ga0496101_1075990 3300048904 Bacteria 632
431 Ga0496109_0366883 3300048912 Bacteria 1360
432 Ga0496112_0002149 3300048915 Bacteria 15656
433 Ga0496125_0441945 3300048928 Bacteria 747
434 Ga0501046_0078073 3300049580 Bacteria 2562
435 Ga0501070_1103140 3300049586 Bacteria 612
436 Ga0501080_0001402 3300049742 Bacteria 20194
437 Ga0501035_0629375 3300049822 Bacteria 872
438 nmdc:mga03683_11031_c1 3300050489 Bacteria 1348
439 nmdc:mga03683_369966_c1 3300050489 Bacteria 681
440 nmdc:mga03683_66_c2 3300050489 Bacteria 39227
441 nmdc:mga03n38_19_c1 3300050490 Bacteria 41192
442 nmdc:mga00v17_1384_c1 3300050491 Bacteria 12725
443 nmdc:mga00v17_145_c1 3300050491 Bacteria 23071
444 nmdc:mga00v17_255643_c1 3300050491 Bacteria 1136
445 nmdc:mga00v17_37734_c2 3300050491 Bacteria 2131
446 nmdc:mga00v17_58705_c1 3300050491 Bacteria 2358
447 nmdc:mga00v17_71727_c1 3300050491 Bacteria 2147
448 nmdc:mga00v17_82943_c1 3300050491 Bacteria 2004
449 nmdc:mga00v17_85240_c1 3300050491 Bacteria 1978
450 nmdc:mga0yw44_2_c1 3300050492 Bacteria 586884
451 nmdc:mga0yw44_408662_c1 3300050492 Bacteria 918
452 nmdc:mga0yw44_47441_c1 3300050492 Bacteria 2586
453 nmdc:mga0yw44_559039_c1 3300050492 Unclassified 777
454 nmdc:mga0yw44_615541_c1 3300050492 Bacteria 738
455 nmdc:mga0yw44_98410_c1 3300050492 Bacteria 1860
456 nmdc:mga0k408_144_c1 3300050493 Bacteria 36305
457 nmdc:mga0k408_1480_c1 3300050493 Bacteria 12680
458 nmdc:mga0k408_14_c3 3300050493 Bacteria 36052
459 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
460 nmdc:mga0k408_24856_c1 3300050493 Bacteria 3388
461 nmdc:mga0k408_24_c4 3300050493 Bacteria 20225
462 nmdc:mga0k408_65491_c1 3300050493 Bacteria 766
463 nmdc:mga06z11_14_c1 3300050494 Bacteria 96662
464 nmdc:mga06z11_53_c2 3300050494 Bacteria 47411
465 nmdc:mga06z11_648327_c1 3300050494 Bacteria 643
466 nmdc:mga04h51_10_c1 3300050495 Bacteria 102434
467 nmdc:mga04h51_1425_c1 3300050495 Bacteria 5531
468 nmdc:mga07m45_117690_c1 3300050496 Bacteria 1533
469 nmdc:mga07m45_2913_c1 3300050496 Bacteria 8113
470 nmdc:mga07m45_42211_c1 3300050496 Bacteria 1340
471 nmdc:mga0sz30_172019_c1 3300050516 Bacteria 960
472 nmdc:mga0sz30_1_c1 3300050516 Bacteria 796501
473 nmdc:mga0sz30_8_c1 3300050516 Bacteria 107909
474 Ga0500643_000010 3300053087 Bacteria 408084
475 Ga0500643_000038 3300053087 Bacteria 178974
476 Ga0500644_0000636 3300053088 Bacteria 13080
477 Ga0500644_0036410 3300053088 Bacteria 1601
478 Ga0500646_0000426 3300053090 Bacteria 12557
479 Ga0500583_0000067 3300053092 Bacteria 64775
480 Ga0500583_0003840 3300053092 Bacteria 4806
481 Ga0500583_0068377 3300053092 Bacteria 1694
482 Ga0500651_0000416 3300053093 Bacteria 22899
483 Ga0500651_0062288 3300053093 Bacteria 2329
484 Ga0500566_0000001 3300053094 Bacteria 1101031
485 Ga0500650_0000001 3300053098 Bacteria 818797
486 Ga0500555_000001 3300053103 Bacteria 1353713
487 Ga0500556_0000246 3300053104 Bacteria 43933
488 Ga0500556_0045752 3300053104 Unclassified 1563
489 Ga0500562_000002 3300053108 Bacteria 977234
490 Ga0500562_016573 3300053108 Unclassified 1895
491 Ga0500594_0000001 3300053118 Bacteria 1178472
492 Ga0500594_0000711 3300053118 Bacteria 7094
493 Ga0500614_000001 3300053123 Bacteria 1274484
494 Ga0500614_002962 3300053123 Bacteria 3707
495 Ga0500614_036897 3300053123 Bacteria 1224
496 Ga0500621_046879 3300053126 Bacteria 1748
497 Ga0500628_000006 3300053129 Bacteria 154858
498 Ga0500628_070105 3300053129 Bacteria 876
499 Ga0500628_211642 3300053129 Bacteria 562
500 Ga0500642_0054734 3300053130 Bacteria 1773
501 Ga0500559_0053524 3300053136 Bacteria 1787
502 Ga0500561_0000001 3300053137 Bacteria 957685
503 Ga0500568_0020917 3300053139 Bacteria 2823
504 Ga0500568_0198955 3300053139 Unclassified 734
505 Ga0500577_0000856 3300053142 Bacteria 7873
506 Ga0500577_0003400 3300053142 Bacteria 4132
507 Ga0500577_0224053 3300053142 Bacteria 814
508 Ga0500579_003450 3300053143 Bacteria 9502
509 Ga0500589_000008 3300053147 Bacteria 137145
510 Ga0500589_204289 3300053147 Unclassified 756
511 Ga0500604_0105191 3300053151 Unclassified 933
512 Ga0500622_0026099 3300053156 Bacteria 3086
513 Ga0500649_000014 3300053722 Bacteria 56198
514 Ga0500570_000045 3300053724 Bacteria 31120
515 Ga0500611_000249 3300053727 Bacteria 6060
516 Ga0500599_030755 3300053736 Bacteria 798

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047673 Ga0495593_0098814 Ga0495593_0098814_47_370 107
2 3300006038 Ga0075365_10502988 Ga0075365_105029882 110
3 3300006051 Ga0075364_10007125 Ga0075364_100071256 110
4 3300006177 Ga0075362_10000049 Ga0075362_1000004939 110
5 3300006177 Ga0075362_10196881 Ga0075362_101968813 110
6 3300013297 Ga0157378_13092377 Ga0157378_130923771 110
7 3300050489 nmdc:mga03683_369966_c1 nmdc:mga03683_369966_c1_158_544 110
8 3300050489 nmdc:mga03683_66_c2 nmdc:mga03683_66_c2_6157_6543 110
9 3300050491 nmdc:mga00v17_145_c1 nmdc:mga00v17_145_c1_11156_11542 110
10 3300050492 nmdc:mga0yw44_559039_c1 nmdc:mga0yw44_559039_c1_110_496 110
11 3300050516 nmdc:mga0sz30_172019_c1 nmdc:mga0sz30_172019_c1_443_829 110
12 3300053142 Ga0500577_0224053 Ga0500577_0224053_469_801 110
13 3300014745 Ga0157377_10362374 Ga0157377_103623742 112
14 3300006028 Ga0070717_10111437 Ga0070717_101114372 113
15 3300009174 Ga0105241_10001993 Ga0105241_100019936 113
16 3300013297 Ga0157378_11640568 Ga0157378_116405683 113
17 3300025911 Ga0207654_10006639 Ga0207654_100066395 113
18 3300028558 Ga0265326_10057481 Ga0265326_100574813 113
19 3300028666 Ga0265336_10001619 Ga0265336_100016192 113
20 3300028800 Ga0265338_10000130 Ga0265338_10000130117 113
21 3300028800 Ga0265338_10000543 Ga0265338_1000054329 113
22 3300029957 Ga0265324_10072266 Ga0265324_100722663 113
23 3300031241 Ga0265325_10032449 Ga0265325_100324493 113
24 3300031249 Ga0265339_10331536 Ga0265339_103315362 113
25 3300031712 Ga0265342_10108366 Ga0265342_101083663 113
26 3300006195 Ga0075366_10068475 Ga0075366_100684754 114
27 3300006353 Ga0075370_10053738 Ga0075370_100537385 114
28 3300050493 nmdc:mga0k408_24856_c1 nmdc:mga0k408_24856_c1_897_1283 114
29 3300050496 nmdc:mga07m45_117690_c1 nmdc:mga07m45_117690_c1_24_410 114
30 3300038443 Ga0395901_0155131 Ga0395901_0155131_1980_2366 115
31 3300013105 Ga0157369_10021294 Ga0157369_100212947 116
32 3300013296 Ga0157374_12084506 Ga0157374_120845061 116
33 3300003320 rootH2_10100464 rootH2_101004642 117
34 3300005327 Ga0070658_10001050 Ga0070658_1000105019 117
35 3300005327 Ga0070658_10013124 Ga0070658_100131246 117
36 3300005339 Ga0070660_100000176 Ga0070660_10000017634 117
37 3300005341 Ga0070691_10086061 Ga0070691_100860614 117
38 3300005345 Ga0070692_10031113 Ga0070692_100311133 117
39 3300005366 Ga0070659_100000215 Ga0070659_10000021535 117
40 3300005530 Ga0070679_100049541 Ga0070679_1000495414 117
41 3300005563 Ga0068855_100000168 Ga0068855_10000016871 117
42 3300005577 Ga0068857_100000124 Ga0068857_10000012422 117
43 3300006051 Ga0075364_10042358 Ga0075364_100423585 117
44 3300013100 Ga0157373_10300217 Ga0157373_103002172 117
45 3300025909 Ga0207705_10007444 Ga0207705_1000744410 117
46 3300025909 Ga0207705_10010485 Ga0207705_100104859 117
47 3300025919 Ga0207657_10000804 Ga0207657_1000080424 117
48 3300025921 Ga0207652_10034163 Ga0207652_100341632 117
49 3300025932 Ga0207690_10000521 Ga0207690_1000052133 117
50 3300025949 Ga0207667_10000339 Ga0207667_1000033937 117
51 3300026116 Ga0207674_10000001 Ga0207674_10000001387 117
52 3300050491 nmdc:mga00v17_82943_c1 nmdc:mga00v17_82943_c1_1563_1949 117
53 3300005336 Ga0070680_100042346 Ga0070680_1000423464 119
54 3300005337 Ga0070682_100003469 Ga0070682_10000346911 119
55 3300005458 Ga0070681_11208342 Ga0070681_112083422 119
56 3300009101 Ga0105247_10040492 Ga0105247_100404923 119
57 3300025912 Ga0207707_11088232 Ga0207707_110882322 119
58 3300025917 Ga0207660_10050330 Ga0207660_100503306 119
59 3300025921 Ga0207652_10008070 Ga0207652_1000807010 119
60 3300037312 Ga0395899_0008649 Ga0395899_0008649_3207_3593 119
61 3300037418 Ga0395900_0001412 Ga0395900_0001412_27817_28203 119
62 3300038443 Ga0395901_0102586 Ga0395901_0102586_1035_1421 119
63 3300025900 Ga0207710_10083044 Ga0207710_100830443 120
64 3300053139 Ga0500568_0020917 Ga0500568_0020917_333_719 120
65 3300005331 Ga0070670_100369487 Ga0070670_1003694873 121
66 3300005367 Ga0070667_100000001 Ga0070667_100000001810 121
67 3300005843 Ga0068860_100272842 Ga0068860_1002728422 121
68 3300025925 Ga0207650_10726267 Ga0207650_107262672 121
69 3300025986 Ga0207658_10000003 Ga0207658_10000003569 121
70 3300028381 Ga0268264_10243752 Ga0268264_102437522 121
71 3300003320 rootH2_10157402 rootH2_101574022 122
72 3300005367 Ga0070667_100006776 Ga0070667_1000067765 122
73 3300005456 Ga0070678_100067625 Ga0070678_1000676256 122
74 3300006186 Ga0075369_10000003 Ga0075369_10000003224 122
75 3300025986 Ga0207658_10032403 Ga0207658_100324036 122
76 3300026121 Ga0207683_10093069 Ga0207683_100930696 122
77 3300050516 nmdc:mga0sz30_1_c1 nmdc:mga0sz30_1_c1_323566_323952 122
78 3300053092 Ga0500583_0000067 Ga0500583_0000067_13880_14266 122
79 3300053093 Ga0500651_0062288 Ga0500651_0062288_1106_1492 122
80 3300053126 Ga0500621_046879 Ga0500621_046879_1036_1422 122
81 3300053130 Ga0500642_0054734 Ga0500642_0054734_438_824 122
82 3300053147 Ga0500589_000008 Ga0500589_000008_40123_40509 122
83 3300053104 Ga0500556_0045752 Ga0500556_0045752_1064_1450 123
84 3300001915 JGI24741J21665_1002353 JGI24741J21665_10023532 128
85 3300001979 JGI24740J21852_10012465 JGI24740J21852_100124655 128
86 3300001990 JGI24737J22298_10000627 JGI24737J22298_1000062710 128
87 3300002067 JGI24735J21928_10000234 JGI24735J21928_100002349 128
88 3300002244 JGI24742J22300_10000015 JGI24742J22300_1000001524 128
89 3300003322 rootL2_10187944 rootL2_101879442 128
90 3300003323 rootH1_10147399 rootH1_101473991 128
91 3300004803 Ga0058862_12276830 Ga0058862_122768302 128
92 3300005289 Ga0065704_10087643 Ga0065704_100876433 128
93 3300005327 Ga0070658_10001547 Ga0070658_100015478 128
94 3300005327 Ga0070658_10021675 Ga0070658_100216753 128
95 3300005327 Ga0070658_10778379 Ga0070658_107783791 128
96 3300005327 Ga0070658_11869082 Ga0070658_118690821 128
97 3300005328 Ga0070676_10000822 Ga0070676_100008224 128
98 3300005329 Ga0070683_100005670 Ga0070683_1000056702 128
99 3300005329 Ga0070683_100211574 Ga0070683_1002115743 128
100 3300005329 Ga0070683_100315298 Ga0070683_1003152983 128
101 3300005329 Ga0070683_100446411 Ga0070683_1004464113 128
102 3300005329 Ga0070683_100795870 Ga0070683_1007958702 128
103 3300005330 Ga0070690_100046651 Ga0070690_1000466513 128
104 3300005336 Ga0070680_100000672 Ga0070680_10000067238 128
105 3300005336 Ga0070680_100007297 Ga0070680_1000072973 128
106 3300005337 Ga0070682_100179854 Ga0070682_1001798541 128
107 3300005337 Ga0070682_100313836 Ga0070682_1003138363 128
108 3300005339 Ga0070660_100008505 Ga0070660_1000085052 128
109 3300005355 Ga0070671_100025375 Ga0070671_1000253755 128
110 3300005355 Ga0070671_100338477 Ga0070671_1003384772 128
111 3300005356 Ga0070674_100004553 Ga0070674_1000045534 128
112 3300005356 Ga0070674_100958444 Ga0070674_1009584443 128
113 3300005364 Ga0070673_101048561 Ga0070673_1010485612 128
114 3300005365 Ga0070688_100044629 Ga0070688_1000446292 128
115 3300005365 Ga0070688_100450331 Ga0070688_1004503312 128
116 3300005366 Ga0070659_101415363 Ga0070659_1014153631 128
117 3300005366 Ga0070659_102049334 Ga0070659_1020493341 128
118 3300005435 Ga0070714_100000778 Ga0070714_10000077824 128
119 3300005445 Ga0070708_100106299 Ga0070708_1001062994 128
120 3300005455 Ga0070663_100094317 Ga0070663_1000943174 128
121 3300005457 Ga0070662_101259111 Ga0070662_1012591111 128
122 3300005458 Ga0070681_10004770 Ga0070681_100047704 128
123 3300005458 Ga0070681_10161591 Ga0070681_101615913 128
124 3300005458 Ga0070681_11886671 Ga0070681_118866711 128
125 3300005459 Ga0068867_100004725 Ga0068867_10000472515 128
126 3300005459 Ga0068867_100424268 Ga0068867_1004242681 128
127 3300005466 Ga0070685_10010420 Ga0070685_100104204 128
128 3300005530 Ga0070679_100003967 Ga0070679_10000396721 128
129 3300005530 Ga0070679_100388161 Ga0070679_1003881612 128
130 3300005530 Ga0070679_101011803 Ga0070679_1010118032 128
131 3300005530 Ga0070679_101077671 Ga0070679_1010776712 128
132 3300005535 Ga0070684_100001742 Ga0070684_10000174220 128
133 3300005535 Ga0070684_100039598 Ga0070684_1000395985 128
134 3300005539 Ga0068853_100062288 Ga0068853_1000622883 128
135 3300005544 Ga0070686_100006928 Ga0070686_1000069288 128
136 3300005547 Ga0070693_100332418 Ga0070693_1003324181 128
137 3300005548 Ga0070665_100091766 Ga0070665_1000917662 128
138 3300005548 Ga0070665_102360209 Ga0070665_1023602091 128
139 3300005563 Ga0068855_100000003 Ga0068855_100000003156 128
140 3300005563 Ga0068855_100006349 Ga0068855_10000634920 128
141 3300005563 Ga0068855_100011906 Ga0068855_1000119062 128
142 3300005563 Ga0068855_100126789 Ga0068855_1001267892 128
143 3300005563 Ga0068855_100316803 Ga0068855_1003168034 128
144 3300005563 Ga0068855_100868053 Ga0068855_1008680531 128
145 3300005563 Ga0068855_102044186 Ga0068855_1020441861 128
146 3300005563 Ga0068855_102457802 Ga0068855_1024578021 128
147 3300005577 Ga0068857_100335639 Ga0068857_1003356393 128
148 3300005614 Ga0068856_100000001 Ga0068856_100000001304 128
149 3300005614 Ga0068856_100001797 Ga0068856_10000179719 128
150 3300005614 Ga0068856_100049528 Ga0068856_1000495284 128
151 3300005614 Ga0068856_100204704 Ga0068856_1002047045 128
152 3300005614 Ga0068856_101068097 Ga0068856_1010680972 128
153 3300005614 Ga0068856_102189895 Ga0068856_1021898952 128
154 3300005616 Ga0068852_100344599 Ga0068852_1003445992 128
155 3300005618 Ga0068864_100852475 Ga0068864_1008524751 128
156 3300005719 Ga0068861_100019408 Ga0068861_1000194086 128
157 3300005719 Ga0068861_102107827 Ga0068861_1021078272 128
158 3300005841 Ga0068863_100088426 Ga0068863_1000884264 128
159 3300005841 Ga0068863_100089668 Ga0068863_1000896681 128
160 3300005843 Ga0068860_100964465 Ga0068860_1009644652 128
161 3300005937 Ga0081455_10000003 Ga0081455_10000003273 128
162 3300005985 Ga0081539_10051502 Ga0081539_100515023 128
163 3300006038 Ga0075365_10001090 Ga0075365_100010906 128
164 3300006038 Ga0075365_10008718 Ga0075365_100087188 128
165 3300006038 Ga0075365_10057534 Ga0075365_100575342 128
166 3300006038 Ga0075365_10499071 Ga0075365_104990713 128
167 3300006038 Ga0075365_10678512 Ga0075365_106785122 128
168 3300006042 Ga0075368_10000084 Ga0075368_100000848 128
169 3300006042 Ga0075368_10013594 Ga0075368_100135942 128
170 3300006048 Ga0075363_100000006 Ga0075363_10000000635 128
171 3300006051 Ga0075364_10001750 Ga0075364_100017507 128
172 3300006051 Ga0075364_10010881 Ga0075364_100108814 128
173 3300006051 Ga0075364_10058510 Ga0075364_100585103 128
174 3300006051 Ga0075364_10298727 Ga0075364_102987273 128
175 3300006051 Ga0075364_10364163 Ga0075364_103641632 128
176 3300006177 Ga0075362_10047684 Ga0075362_100476841 128
177 3300006178 Ga0075367_10000014 Ga0075367_1000001433 128
178 3300006178 Ga0075367_10000021 Ga0075367_1000002125 128
179 3300006178 Ga0075367_10437889 Ga0075367_104378893 128
180 3300006186 Ga0075369_10000057 Ga0075369_1000005734 128
181 3300006195 Ga0075366_10000001 Ga0075366_10000001360 128
182 3300006195 Ga0075366_10000065 Ga0075366_1000006533 128
183 3300006195 Ga0075366_10000317 Ga0075366_1000031721 128
184 3300006195 Ga0075366_10001099 Ga0075366_1000109914 128
185 3300006195 Ga0075366_10016676 Ga0075366_100166762 128
186 3300006195 Ga0075366_10027882 Ga0075366_100278823 128
187 3300006195 Ga0075366_10484917 Ga0075366_104849172 128
188 3300006195 Ga0075366_10716012 Ga0075366_107160122 128
189 3300006237 Ga0097621_100000003 Ga0097621_100000003115 128
190 3300006353 Ga0075370_10002783 Ga0075370_100027835 128
191 3300006353 Ga0075370_10004609 Ga0075370_1000460910 128
192 3300006353 Ga0075370_10746373 Ga0075370_107463731 128
193 3300006358 Ga0068871_100000013 Ga0068871_100000013113 128
194 3300006358 Ga0068871_100000039 Ga0068871_10000003966 128
195 3300006358 Ga0068871_100325559 Ga0068871_1003255592 128
196 3300006358 Ga0068871_100616006 Ga0068871_1006160061 128
197 3300006358 Ga0068871_100908341 Ga0068871_1009083412 128
198 3300006881 Ga0068865_100104472 Ga0068865_1001044724 128
199 3300009093 Ga0105240_10000003 Ga0105240_10000003859 128
200 3300009093 Ga0105240_10036292 Ga0105240_100362929 128
201 3300009093 Ga0105240_10217589 Ga0105240_102175893 128
202 3300009093 Ga0105240_10923636 Ga0105240_109236363 128
203 3300009098 Ga0105245_10000001 Ga0105245_10000001322 128
204 3300009098 Ga0105245_10000002 Ga0105245_10000002260 128
205 3300009098 Ga0105245_10004395 Ga0105245_100043953 128
206 3300009098 Ga0105245_10161988 Ga0105245_101619884 128
207 3300009098 Ga0105245_10219574 Ga0105245_102195742 128
208 3300009098 Ga0105245_10425808 Ga0105245_104258083 128
209 3300009098 Ga0105245_10953160 Ga0105245_109531602 128
210 3300009101 Ga0105247_10030446 Ga0105247_100304462 128
211 3300009148 Ga0105243_10000001 Ga0105243_10000001432 128
212 3300009148 Ga0105243_10314874 Ga0105243_103148742 128
213 3300009174 Ga0105241_10000003 Ga0105241_10000003147 128
214 3300009174 Ga0105241_10159247 Ga0105241_101592474 128
215 3300009174 Ga0105241_10341799 Ga0105241_103417993 128
216 3300009174 Ga0105241_10684727 Ga0105241_106847272 128
217 3300009174 Ga0105241_12011380 Ga0105241_120113801 128
218 3300009176 Ga0105242_10000011 Ga0105242_1000001119 128
219 3300009176 Ga0105242_10011274 Ga0105242_100112748 128
220 3300009176 Ga0105242_10229079 Ga0105242_102290792 128
221 3300009177 Ga0105248_10920771 Ga0105248_109207712 128
222 3300009545 Ga0105237_10028841 Ga0105237_100288412 128
223 3300009551 Ga0105238_10323196 Ga0105238_103231961 128
224 3300009553 Ga0105249_10002379 Ga0105249_1000237923 128
225 3300009553 Ga0105249_10790720 Ga0105249_107907201 128
226 3300009979 Ga0105032_109956 Ga0105032_1099561 128
227 3300009982 Ga0105147_112828 Ga0105147_1128282 128
228 3300009986 Ga0105033_109395 Ga0105033_1093952 128
229 3300009993 Ga0105028_100489 Ga0105028_1004896 128
230 3300010375 Ga0105239_10051192 Ga0105239_100511925 128
231 3300010375 Ga0105239_10052752 Ga0105239_100527526 128
232 3300010375 Ga0105239_10161986 Ga0105239_101619864 128
233 3300013100 Ga0157373_10000351 Ga0157373_1000035145 128
234 3300013100 Ga0157373_10202126 Ga0157373_102021263 128
235 3300013102 Ga0157371_10000176 Ga0157371_1000017633 128
236 3300013104 Ga0157370_10090586 Ga0157370_100905865 128
237 3300013104 Ga0157370_10956137 Ga0157370_109561373 128
238 3300013105 Ga0157369_10003258 Ga0157369_1000325829 128
239 3300013105 Ga0157369_10165158 Ga0157369_101651582 128
240 3300013105 Ga0157369_10231942 Ga0157369_102319422 128
241 3300013105 Ga0157369_10726731 Ga0157369_107267312 128
242 3300013105 Ga0157369_11818530 Ga0157369_118185302 128
243 3300013296 Ga0157374_10000031 Ga0157374_10000031111 128
244 3300013296 Ga0157374_10009614 Ga0157374_100096147 128
245 3300013296 Ga0157374_10012419 Ga0157374_100124197 128
246 3300013296 Ga0157374_10040598 Ga0157374_100405984 128
247 3300013296 Ga0157374_10236244 Ga0157374_102362444 128
248 3300013296 Ga0157374_11256129 Ga0157374_112561292 128
249 3300013306 Ga0163162_10407652 Ga0163162_104076523 128
250 3300013306 Ga0163162_11560439 Ga0163162_115604392 128
251 3300013307 Ga0157372_10000670 Ga0157372_1000067027 128
252 3300013307 Ga0157372_10002726 Ga0157372_1000272631 128
253 3300013307 Ga0157372_11853840 Ga0157372_118538402 128
254 3300013307 Ga0157372_12912766 Ga0157372_129127661 128
255 3300013308 Ga0157375_10670502 Ga0157375_106705023 128
256 3300014325 Ga0163163_10747213 Ga0163163_107472132 128
257 3300014325 Ga0163163_12003993 Ga0163163_120039932 128
258 3300014745 Ga0157377_10118595 Ga0157377_101185952 128
259 3300014745 Ga0157377_10510889 Ga0157377_105108891 128
260 3300014968 Ga0157379_10048356 Ga0157379_100483562 128
261 3300014969 Ga0157376_10000001 Ga0157376_1000000172 128
262 3300020069 Ga0197907_11443729 Ga0197907_114437293 128
263 3300020077 Ga0206351_10698135 Ga0206351_106981352 128
264 3300020610 Ga0154015_1226069 Ga0154015_12260693 128
265 3300025904 Ga0207647_10009820 Ga0207647_100098203 128
266 3300025907 Ga0207645_10016534 Ga0207645_100165343 128
267 3300025909 Ga0207705_10017713 Ga0207705_1001771310 128
268 3300025909 Ga0207705_10033204 Ga0207705_100332044 128
269 3300025909 Ga0207705_10757104 Ga0207705_107571042 128
270 3300025911 Ga0207654_10000002 Ga0207654_100000021062 128
271 3300025911 Ga0207654_10089175 Ga0207654_100891754 128
272 3300025911 Ga0207654_10639264 Ga0207654_106392641 128
273 3300025911 Ga0207654_11145291 Ga0207654_111452911 128
274 3300025912 Ga0207707_10004217 Ga0207707_1000421719 128
275 3300025912 Ga0207707_10202860 Ga0207707_102028604 128
276 3300025912 Ga0207707_11488094 Ga0207707_114880941 128
277 3300025913 Ga0207695_10000005 Ga0207695_10000005869 128
278 3300025913 Ga0207695_10106873 Ga0207695_101068735 128
279 3300025913 Ga0207695_10174254 Ga0207695_101742544 128
280 3300025913 Ga0207695_10979802 Ga0207695_109798022 128
281 3300025913 Ga0207695_11357354 Ga0207695_113573541 128
282 3300025914 Ga0207671_10024736 Ga0207671_100247362 128
283 3300025917 Ga0207660_10000748 Ga0207660_1000074815 128
284 3300025918 Ga0207662_10150140 Ga0207662_101501401 128
285 3300025919 Ga0207657_10016230 Ga0207657_100162302 128
286 3300025921 Ga0207652_10002682 Ga0207652_100026829 128
287 3300025921 Ga0207652_10107223 Ga0207652_101072232 128
288 3300025921 Ga0207652_10536872 Ga0207652_105368722 128
289 3300025927 Ga0207687_10000001 Ga0207687_10000001951 128
290 3300025927 Ga0207687_10000030 Ga0207687_10000030117 128
291 3300025927 Ga0207687_10000318 Ga0207687_1000031843 128
292 3300025927 Ga0207687_10142186 Ga0207687_101421862 128
293 3300025927 Ga0207687_10533918 Ga0207687_105339181 128
294 3300025928 Ga0207700_11307220 Ga0207700_113072201 128
295 3300025929 Ga0207664_10010802 Ga0207664_100108028 128
296 3300025931 Ga0207644_10016889 Ga0207644_100168895 128
297 3300025931 Ga0207644_10293846 Ga0207644_102938464 128
298 3300025932 Ga0207690_11875129 Ga0207690_118751291 128
299 3300025933 Ga0207706_10774540 Ga0207706_107745402 128
300 3300025934 Ga0207686_10000001 Ga0207686_10000001710 128
301 3300025934 Ga0207686_10007276 Ga0207686_100072763 128
302 3300025934 Ga0207686_11450364 Ga0207686_114503641 128
303 3300025935 Ga0207709_10000002 Ga0207709_10000002828 128
304 3300025935 Ga0207709_10525568 Ga0207709_105255683 128
305 3300025937 Ga0207669_10003257 Ga0207669_100032577 128
306 3300025938 Ga0207704_10178515 Ga0207704_101785154 128
307 3300025941 Ga0207711_10445069 Ga0207711_104450692 128
308 3300025944 Ga0207661_10002824 Ga0207661_100028242 128
309 3300025944 Ga0207661_10665080 Ga0207661_106650803 128
310 3300025944 Ga0207661_10933840 Ga0207661_109338402 128
311 3300025945 Ga0207679_10035696 Ga0207679_100356964 128
312 3300025949 Ga0207667_10000008 Ga0207667_10000008155 128
313 3300025949 Ga0207667_10078889 Ga0207667_100788892 128
314 3300025949 Ga0207667_10124762 Ga0207667_101247625 128
315 3300025949 Ga0207667_10146112 Ga0207667_101461122 128
316 3300025949 Ga0207667_10272258 Ga0207667_102722582 128
317 3300025949 Ga0207667_10783578 Ga0207667_107835782 128
318 3300025949 Ga0207667_11131145 Ga0207667_111311452 128
319 3300025949 Ga0207667_11499309 Ga0207667_114993091 128
320 3300025961 Ga0207712_10001459 Ga0207712_100014599 128
321 3300025961 Ga0207712_11765800 Ga0207712_117658001 128
322 3300026041 Ga0207639_12166119 Ga0207639_121661191 128
323 3300026067 Ga0207678_10375096 Ga0207678_103750962 128
324 3300026078 Ga0207702_10000001 Ga0207702_10000001853 128
325 3300026078 Ga0207702_10003219 Ga0207702_100032198 128
326 3300026078 Ga0207702_10059333 Ga0207702_100593335 128
327 3300026078 Ga0207702_10085287 Ga0207702_100852874 128
328 3300026078 Ga0207702_11113519 Ga0207702_111135191 128
329 3300026078 Ga0207702_11556046 Ga0207702_115560462 128
330 3300026088 Ga0207641_10078817 Ga0207641_100788174 128
331 3300026089 Ga0207648_10064628 Ga0207648_100646281 128
332 3300026095 Ga0207676_10595673 Ga0207676_105956732 128
333 3300026116 Ga0207674_10279586 Ga0207674_102795863 128
334 3300026118 Ga0207675_100033313 Ga0207675_1000333135 128
335 3300026118 Ga0207675_101818214 Ga0207675_1018182142 128
336 3300026142 Ga0207698_10319277 Ga0207698_103192772 128
337 3300027866 Ga0209813_10000009 Ga0209813_1000000950 128
338 3300027866 Ga0209813_10000657 Ga0209813_100006579 128
339 3300028379 Ga0268266_10003734 Ga0268266_1000373422 128
340 3300028556 Ga0265337_1000001 Ga0265337_100000174 128
341 3300028556 Ga0265337_1000227 Ga0265337_100022713 128
342 3300028556 Ga0265337_1000244 Ga0265337_100024434 128
343 3300028556 Ga0265337_1002833 Ga0265337_100283311 128
344 3300028556 Ga0265337_1019178 Ga0265337_10191784 128
345 3300028556 Ga0265337_1045387 Ga0265337_10453873 128
346 3300028556 Ga0265337_1068465 Ga0265337_10684651 128
347 3300028558 Ga0265326_10006027 Ga0265326_100060273 128
348 3300028558 Ga0265326_10020745 Ga0265326_100207452 128
349 3300028558 Ga0265326_10037257 Ga0265326_100372572 128
350 3300028563 Ga0265319_1006728 Ga0265319_10067282 128
351 3300028563 Ga0265319_1018550 Ga0265319_10185504 128
352 3300028573 Ga0265334_10000049 Ga0265334_1000004910 128
353 3300028573 Ga0265334_10000114 Ga0265334_1000011442 128
354 3300028573 Ga0265334_10012726 Ga0265334_100127267 128
355 3300028573 Ga0265334_10014268 Ga0265334_100142685 128
356 3300028573 Ga0265334_10125031 Ga0265334_101250312 128
357 3300028573 Ga0265334_10171634 Ga0265334_101716342 128
358 3300028577 Ga0265318_10084397 Ga0265318_100843973 128
359 3300028653 Ga0265323_10005524 Ga0265323_100055243 128
360 3300028654 Ga0265322_10001067 Ga0265322_100010673 128
361 3300028654 Ga0265322_10043941 Ga0265322_100439412 128
362 3300028654 Ga0265322_10124402 Ga0265322_101244021 128
363 3300028666 Ga0265336_10022737 Ga0265336_100227372 128
364 3300028666 Ga0265336_10030477 Ga0265336_100304773 128
365 3300028666 Ga0265336_10100994 Ga0265336_101009941 128
366 3300028666 Ga0265336_10129915 Ga0265336_101299152 128
367 3300028800 Ga0265338_10000003 Ga0265338_10000003507 128
368 3300028800 Ga0265338_10000052 Ga0265338_1000005251 128
369 3300028800 Ga0265338_10000054 Ga0265338_10000054127 128
370 3300028800 Ga0265338_10000178 Ga0265338_10000178116 128
371 3300028800 Ga0265338_10000217 Ga0265338_1000021796 128
372 3300028800 Ga0265338_10000366 Ga0265338_1000036645 128
373 3300028800 Ga0265338_10001885 Ga0265338_1000188536 128
374 3300028800 Ga0265338_10002761 Ga0265338_1000276135 128
375 3300028800 Ga0265338_10018679 Ga0265338_100186796 128
376 3300028800 Ga0265338_10022667 Ga0265338_100226672 128
377 3300028800 Ga0265338_10030478 Ga0265338_100304782 128
378 3300028800 Ga0265338_10043400 Ga0265338_100434004 128
379 3300028800 Ga0265338_10065231 Ga0265338_100652312 128
380 3300028800 Ga0265338_10070185 Ga0265338_100701852 128
381 3300028800 Ga0265338_10216983 Ga0265338_102169833 128
382 3300028800 Ga0265338_10413048 Ga0265338_104130481 128
383 3300028800 Ga0265338_10790453 Ga0265338_107904532 128
384 3300029957 Ga0265324_10037105 Ga0265324_100371053 128
385 3300029957 Ga0265324_10040577 Ga0265324_100405774 128
386 3300029957 Ga0265324_10127903 Ga0265324_101279032 128
387 3300029957 Ga0265324_10152483 Ga0265324_101524831 128
388 3300030733 Ga0314311_1231626 Ga0314311_12316262 128
389 3300030734 Ga0316179_1039642 Ga0316179_10396424 128
390 3300031238 Ga0265332_10008580 Ga0265332_100085806 128
391 3300031240 Ga0265320_10082566 Ga0265320_100825662 128
392 3300031240 Ga0265320_10138627 Ga0265320_101386273 128
393 3300031241 Ga0265325_10052947 Ga0265325_100529472 128
394 3300031242 Ga0265329_10023327 Ga0265329_100233272 128
395 3300031247 Ga0265340_10000533 Ga0265340_1000053326 128
396 3300031249 Ga0265339_10021858 Ga0265339_100218582 128
397 3300031249 Ga0265339_10089311 Ga0265339_100893111 128
398 3300031251 Ga0265327_10003601 Ga0265327_100036013 128
399 3300031251 Ga0265327_10010704 Ga0265327_100107044 128
400 3300031251 Ga0265327_10011075 Ga0265327_1001107511 128
401 3300031251 Ga0265327_10339976 Ga0265327_103399761 128
402 3300031344 Ga0265316_10049775 Ga0265316_100497754 128
403 3300031344 Ga0265316_10053557 Ga0265316_100535574 128
404 3300031344 Ga0265316_10132722 Ga0265316_101327222 128
405 3300031595 Ga0265313_10034154 Ga0265313_100341544 128
406 3300031595 Ga0265313_10066397 Ga0265313_100663973 128
407 3300031595 Ga0265313_10136635 Ga0265313_101366352 128
408 3300031711 Ga0265314_10012823 Ga0265314_100128231 128
409 3300031711 Ga0265314_10134200 Ga0265314_101342003 128
410 3300031711 Ga0265314_10237775 Ga0265314_102377752 128
411 3300031711 Ga0265314_10393916 Ga0265314_103939161 128
412 3300031712 Ga0265342_10112023 Ga0265342_101120231 128
413 3300037312 Ga0395899_0003098 Ga0395899_0003098_5645_6034 128
414 3300037312 Ga0395899_0049607 Ga0395899_0049607_2252_2638 128
415 3300037312 Ga0395899_0573821 Ga0395899_0573821_317_703 128
416 3300037418 Ga0395900_0003612 Ga0395900_0003612_7593_7979 128
417 3300037418 Ga0395900_0035646 Ga0395900_0035646_203_589 128
418 3300037418 Ga0395900_0042797 Ga0395900_0042797_3104_3490 128
419 3300037418 Ga0395900_0077806 Ga0395900_0077806_316_702 128
420 3300037418 Ga0395900_0082715 Ga0395900_0082715_1753_2142 128
421 3300037418 Ga0395900_0139280 Ga0395900_0139280_364_750 128
422 3300037418 Ga0395900_0246895 Ga0395900_0246895_976_1365 128
423 3300037466 Ga0395898_0002536 Ga0395898_0002536_16847_17236 128
424 3300037466 Ga0395898_0022692 Ga0395898_0022692_995_1381 128
425 3300037471 Ga0395905_0000238 Ga0395905_0000238_80714_81103 128
426 3300037471 Ga0395905_0021494 Ga0395905_0021494_4014_4403 128
427 3300037471 Ga0395905_0208547 Ga0395905_0208547_229_615 128
428 3300037471 Ga0395905_0602710 Ga0395905_0602710_549_938 128
429 3300038443 Ga0395901_0014417 Ga0395901_0014417_1780_2166 128
430 3300038443 Ga0395901_0045964 Ga0395901_0045964_2445_2834 128
431 3300038443 Ga0395901_0547441 Ga0395901_0547441_533_919 128
432 3300041460 Ga0451802_1444779 Ga0451802_1444779_140_526 128
433 3300041463 Ga0451804_0008465 Ga0451804_0008465_282_668 128
434 3300041486 Ga0451807_1565165 Ga0451807_1565165_61_447 128
435 3300044694 Ga0466963_0074188 Ga0466963_0074188_1129_1515 128
436 3300046459 Ga0495629_0089573 Ga0495629_0089573_1461_1847 128
437 3300046557 Ga0495622_0000035 Ga0495622_0000035_38122_38508 128
438 3300046674 Ga0495588_0000116 Ga0495588_0000116_17083_17469 128
439 3300046683 Ga0495658_0003200 Ga0495658_0003200_714_1100 128
440 3300046691 Ga0495670_0273124 Ga0495670_0273124_381_767 128
441 3300046694 Ga0495649_0000182 Ga0495649_0000182_18606_18992 128
442 3300046809 Ga0495600_0006859 Ga0495600_0006859_5141_5527 128
443 3300047320 Ga0495672_0000016 Ga0495672_0000016_44742_45128 128
444 3300047321 Ga0495676_0074538 Ga0495676_0074538_1937_2323 128
445 3300048088 Ga0495602_0115900 Ga0495602_0115900_354_740 128
446 3300048903 Ga0496100_0152007 Ga0496100_0152007_935_1321 128
447 3300048904 Ga0496101_1075990 Ga0496101_1075990_192_578 128
448 3300048912 Ga0496109_0366883 Ga0496109_0366883_751_1137 128
449 3300048915 Ga0496112_0002149 Ga0496112_0002149_56_442 128
450 3300048928 Ga0496125_0441945 Ga0496125_0441945_144_530 128
451 3300049580 Ga0501046_0078073 Ga0501046_0078073_1054_1440 128
452 3300049586 Ga0501070_1103140 Ga0501070_1103140_70_456 128
453 3300049742 Ga0501080_0001402 Ga0501080_0001402_11860_12246 128
454 3300049822 Ga0501035_0629375 Ga0501035_0629375_285_671 128
455 3300050489 nmdc:mga03683_11031_c1 nmdc:mga03683_11031_c1_718_1104 128
456 3300050490 nmdc:mga03n38_19_c1 nmdc:mga03n38_19_c1_17860_18246 128
457 3300050491 nmdc:mga00v17_1384_c1 nmdc:mga00v17_1384_c1_5163_5549 128
458 3300050491 nmdc:mga00v17_255643_c1 nmdc:mga00v17_255643_c1_134_520 128
459 3300050491 nmdc:mga00v17_37734_c2 nmdc:mga00v17_37734_c2_242_628 128
460 3300050491 nmdc:mga00v17_58705_c1 nmdc:mga00v17_58705_c1_748_1134 128
461 3300050491 nmdc:mga00v17_71727_c1 nmdc:mga00v17_71727_c1_441_827 128
462 3300050491 nmdc:mga00v17_85240_c1 nmdc:mga00v17_85240_c1_616_1002 128
463 3300050492 nmdc:mga0yw44_2_c1 nmdc:mga0yw44_2_c1_302798_303184 128
464 3300050492 nmdc:mga0yw44_408662_c1 nmdc:mga0yw44_408662_c1_42_428 128
465 3300050492 nmdc:mga0yw44_47441_c1 nmdc:mga0yw44_47441_c1_1826_2212 128
466 3300050492 nmdc:mga0yw44_615541_c1 nmdc:mga0yw44_615541_c1_281_667 128
467 3300050492 nmdc:mga0yw44_98410_c1 nmdc:mga0yw44_98410_c1_1060_1446 128
468 3300050493 nmdc:mga0k408_144_c1 nmdc:mga0k408_144_c1_25361_25747 128
469 3300050493 nmdc:mga0k408_1480_c1 nmdc:mga0k408_1480_c1_406_792 128
470 3300050493 nmdc:mga0k408_14_c3 nmdc:mga0k408_14_c3_28933_29319 128
471 3300050493 nmdc:mga0k408_1_c1 nmdc:mga0k408_1_c1_746592_746978 128
472 3300050493 nmdc:mga0k408_24_c4 nmdc:mga0k408_24_c4_12737_13123 128
473 3300050493 nmdc:mga0k408_65491_c1 nmdc:mga0k408_65491_c1_200_586 128
474 3300050494 nmdc:mga06z11_14_c1 nmdc:mga06z11_14_c1_23037_23423 128
475 3300050494 nmdc:mga06z11_53_c2 nmdc:mga06z11_53_c2_8974_9360 128
476 3300050494 nmdc:mga06z11_648327_c1 nmdc:mga06z11_648327_c1_236_622 128
477 3300050495 nmdc:mga04h51_10_c1 nmdc:mga04h51_10_c1_43875_44261 128
478 3300050495 nmdc:mga04h51_1425_c1 nmdc:mga04h51_1425_c1_4007_4393 128
479 3300050496 nmdc:mga07m45_2913_c1 nmdc:mga07m45_2913_c1_6196_6582 128
480 3300050496 nmdc:mga07m45_42211_c1 nmdc:mga07m45_42211_c1_241_627 128
481 3300050516 nmdc:mga0sz30_8_c1 nmdc:mga0sz30_8_c1_102630_103016 128
482 3300053087 Ga0500643_000010 Ga0500643_000010_327745_328131 128
483 3300053087 Ga0500643_000038 Ga0500643_000038_143023_143409 128
484 3300053088 Ga0500644_0000636 Ga0500644_0000636_8916_9302 128
485 3300053088 Ga0500644_0036410 Ga0500644_0036410_124_510 128
486 3300053090 Ga0500646_0000426 Ga0500646_0000426_314_700 128
487 3300053092 Ga0500583_0003840 Ga0500583_0003840_3070_3456 128
488 3300053092 Ga0500583_0068377 Ga0500583_0068377_760_1146 128
489 3300053093 Ga0500651_0000416 Ga0500651_0000416_12768_13154 128
490 3300053094 Ga0500566_0000001 Ga0500566_0000001_684440_684826 128
491 3300053098 Ga0500650_0000001 Ga0500650_0000001_527263_527649 128
492 3300053103 Ga0500555_000001 Ga0500555_000001_812697_813083 128
493 3300053104 Ga0500556_0000246 Ga0500556_0000246_2431_2817 128
494 3300053108 Ga0500562_000002 Ga0500562_000002_962607_962993 128
495 3300053108 Ga0500562_016573 Ga0500562_016573_123_509 128
496 3300053118 Ga0500594_0000001 Ga0500594_0000001_11380_11766 128
497 3300053118 Ga0500594_0000711 Ga0500594_0000711_6555_6941 128
498 3300053123 Ga0500614_000001 Ga0500614_000001_219559_219945 128
499 3300053123 Ga0500614_002962 Ga0500614_002962_466_852 128
500 3300053123 Ga0500614_036897 Ga0500614_036897_573_959 128
501 3300053129 Ga0500628_000006 Ga0500628_000006_133243_133629 128
502 3300053129 Ga0500628_070105 Ga0500628_070105_388_774 128
503 3300053129 Ga0500628_211642 Ga0500628_211642_15_401 128
504 3300053136 Ga0500559_0053524 Ga0500559_0053524_898_1284 128
505 3300053137 Ga0500561_0000001 Ga0500561_0000001_504103_504489 128
506 3300053139 Ga0500568_0198955 Ga0500568_0198955_138_524 128
507 3300053142 Ga0500577_0000856 Ga0500577_0000856_4546_4932 128
508 3300053142 Ga0500577_0003400 Ga0500577_0003400_2121_2507 128
509 3300053143 Ga0500579_003450 Ga0500579_003450_5519_5905 128
510 3300053147 Ga0500589_204289 Ga0500589_204289_59_445 128
511 3300053151 Ga0500604_0105191 Ga0500604_0105191_174_560 128
512 3300053156 Ga0500622_0026099 Ga0500622_0026099_2394_2780 128
513 3300053722 Ga0500649_000014 Ga0500649_000014_19943_20329 128
514 3300053724 Ga0500570_000045 Ga0500570_000045_10772_11158 128
515 3300053727 Ga0500611_000249 Ga0500611_000249_163_549 128
516 3300053736 Ga0500599_030755 Ga0500599_030755_201_587 128

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00416

Ribosomal_S13

Ribosomal protein S13/S18

4

110

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mx0-assembly1.cif.gz_A structure of topoisomerase subunit 0.9516 12 58
1mx0-assembly1.cif.gz_B structure of topoisomerase subunit 0.9444 12 58
3jr4-assembly1.cif.gz_A mutm interrogating an extrahelical g 0.9425 11 58
3gq4-assembly1.cif.gz_A sequence-matched mutm lesion recognition complex 5 (lrc5) 0.9425 11 58
1r2z-assembly1.cif.gz_A mutm (fpg) bound to 5,6-dihydrouracil (dhu) containing dna 0.9417 11 58
ID Description Score Start End Superfamily
af_P54019_1_77_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9816 3 62 1.10.8.50
af_A0A1D8PQQ5_1_82_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9748 3 61 1.10.8.50
1i94M01 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9745 14 64 1.10.8.50
af_Q2FW30_1_70_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9743 1 70 1.10.8.50
af_P9WH61_1_72_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.97 1 71 1.10.8.50
ID Description Score Start End GO Terms
AF-A0A7L4TJ17-F1-model_v4 30S ribosomal protein S13 1 1 58 GO:0003723
GO:0003735
GO:0005829
GO:0006412
GO:0015935
AF-A0A7W1C4H2-F1-model_v4 30S ribosomal protein S13 0.9997 1 67 GO:0003723
GO:0003735
GO:0005829
GO:0006412
GO:0015935
AF-A0A3C1LP09-F1-model_v4 30S ribosomal protein S13 0.9982 1 62 GO:0000731
GO:0003677
GO:0003723
GO:0003735
GO:0005524
GO:0005840
GO:0006261
GO:0006412
GO:0008047
GO:0016887
GO:0017116
GO:1990904
AF-A0A6B0CFM2-F1-model_v4 30S ribosomal protein S13 0.9978 1 60 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A2H9MEC9-F1-model_v4 30S ribosomal protein S13 0.9927 2 61 GO:0003723
GO:0003735
GO:0005829
GO:0006412
GO:0015935

Feature Viewer

pLDDT pTM Quality
83.29 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map