F457934

General Info

Members Datasets Scaffolds Average Seq Length
515 230 398 198

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2711768156|2712471856
Length 195
Sequence LFALLLLCLPVAAGLAAPENSDVDSPGTAPYLLPGAPAFDLTISQFREKFNHDSAPLALSEFRAIASGQDQVTITRAATKINENLYASSALQRGTLKVKSMQITWLPIQGPEQKAAKAKALEYMAAVARVFVPLSKAQSQKQIIALLTSAKGKRYYQQTVGAIRYVIADNGEKGLTFAIEPIKLALSEDLEGNNK

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
4 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
5 2547132181 Kosakonia sacchari SP1 Isolate Stem
6 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
7 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
8 2561511199 Enterobacter sp. R4-368 Isolate Nodule
9 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
10 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
11 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
12 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
13 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
14 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
15 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
16 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
17 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
18 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
19 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
20 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
21 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
22 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
23 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
24 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
25 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
26 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
27 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
28 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
29 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
30 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
31 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
32 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
33 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
34 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
35 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
36 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
37 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
38 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
39 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
40 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
41 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
42 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
43 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
44 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
45 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
46 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
47 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
48 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
49 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
50 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
51 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
52 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
53 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
54 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
55 2636415599 Klebsiella variicola DX120E Isolate Unclassified
56 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
57 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
58 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
59 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
60 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
61 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
62 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
63 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
64 2751185917 Enterobacter sp. HK169 Isolate Unclassified
65 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
66 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
67 2775507074 Klebsiella sp. D5A Isolate Unclassified
68 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
69 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
70 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
71 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
72 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
73 2821118458 Enterobacter asburiae 609 Isolate Unclassified
74 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
75 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
76 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
77 2847085930 Erwinia persicina B64 Isolate Bulb
78 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
79 2865014394 Pantoea sp. R-71966 Isolate Unclassified
80 2876601092 Pantoea endophytica 596 Isolate Unclassified
81 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
82 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
83 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
84 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
85 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
86 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
87 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
88 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
89 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
90 2937539931 Pantoea sp. LS15 Isolate Unclassified
91 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
92 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
93 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
94 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
95 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
96 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
97 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
98 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
99 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
100 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
101 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
102 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
103 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
104 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
105 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
106 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
107 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
108 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
109 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
110 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
111 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
112 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
113 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
114 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
115 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
116 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
117 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
118 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
119 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
120 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
121 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
122 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
123 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
124 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
125 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
126 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
127 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
128 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
129 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
130 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
131 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
132 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
133 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
134 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
135 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
136 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
137 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
138 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
139 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
140 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
141 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
142 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
143 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
144 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
145 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
146 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
147 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
159 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
162 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
163 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
164 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
165 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
166 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
167 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
168 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
169 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
170 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
171 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
172 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
173 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
174 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
175 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
176 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
177 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
178 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
179 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
180 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
181 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
182 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
183 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
184 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
185 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
186 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
187 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
188 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
189 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
190 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
191 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
192 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
193 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
194 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
195 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
196 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
197 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
205 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
206 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
207 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
208 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
209 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
210 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
211 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
212 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
213 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
214 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
215 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
216 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
217 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
218 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
219 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
220 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
221 8018221730 Enterobacter sp. CM29 Isolate Unclassified
222 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
223 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
224 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
225 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
226 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
227 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
228 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
229 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
230 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.28
Metatranscriptomes 0
Isolates 22.72

Biome Distribution

Category Percentage (%)
Aerial Root 0.78
Bulb 0.19
Endosphere 3.3
Nodule 3.5
Rhizoplane 12.23
Rhizosphere 54.17
Stem 0.19
Stem Tuber 0
Unclassified 25.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C2281 2010549000 Bacteria 3402
2 RicEn_FSXC66974_b1 2010549000 Bacteria 800
3 SwRhRL2b_contig_1471168 2162886007 Bacteria 923
4 SwRhRL2b_contig_212761 2162886007 Bacteria 4466
5 SwRhRL2b_contig_928522 2162886007 Bacteria 1455
6 SwRhRL2b_contig_995426 2162886007 Bacteria 2514
7 JGI24739J22299_10000025 3300001989 Bacteria 42836
8 JGI25152J39213_1000244 3300002773 Bacteria 36300
9 rootH2_10031586 3300003320 Bacteria 28772
10 Ga0058692_1000131 3300003856 Bacteria 47329
11 Ga0058692_1004287 3300003856 Bacteria 4247
12 Ga0058692_1005556 3300003856 Bacteria 3579
13 Ga0058692_1010025 3300003856 Bacteria 2358
14 Ga0058692_1013477 3300003856 Bacteria 1900
15 Ga0058692_1013787 3300003856 Bacteria 1870
16 Ga0058692_1039467 3300003856 Bacteria 836
17 Ga0058692_1039526 3300003856 Bacteria 836
18 Ga0058692_1045376 3300003856 Bacteria 750
19 Ga0058692_1046331 3300003856 Bacteria 738
20 Ga0058692_1053643 3300003856 Bacteria 659
21 Ga0065704_10000573 3300005289 Bacteria 16809
22 Ga0065704_10001056 3300005289 Bacteria 9871
23 Ga0065704_10004833 3300005289 Bacteria 3161
24 Ga0065704_10141990 3300005289 Bacteria 1509
25 Ga0070660_100232764 3300005339 Bacteria 1499
26 Ga0070668_100114816 3300005347 Bacteria 2146
27 Ga0070659_100017223 3300005366 Bacteria 5433
28 Ga0070667_100188704 3300005367 Bacteria 1825
29 Ga0070662_100022418 3300005457 Bacteria 4324
30 Ga0070665_100000842 3300005548 Bacteria 40035
31 Ga0070665_100011225 3300005548 Bacteria 9057
32 Ga0070665_100166046 3300005548 Bacteria 2210
33 Ga0070664_100561499 3300005564 Bacteria 1056
34 Ga0068857_100000014 3300005577 Bacteria 101897
35 Ga0068851_10004912 3300005834 Bacteria 6060
36 Ga0075364_10004088 3300006051 Bacteria 8372
37 Ga0075364_10012070 3300006051 Bacteria 5271
38 Ga0075364_10026395 3300006051 Bacteria 3705
39 Ga0075364_10245921 3300006051 Bacteria 1215
40 Ga0075364_10654212 3300006051 Bacteria 717
41 Ga0079104_1000088 3300006946 Bacteria 134442
42 Ga0079104_1000191 3300006946 Bacteria 85701
43 Ga0079104_1000217 3300006946 Bacteria 80619
44 Ga0079104_1001419 3300006946 Bacteria 16170
45 Ga0079104_1002152 3300006946 Bacteria 11167
46 Ga0079104_1004354 3300006946 Bacteria 6106
47 Ga0079104_1032608 3300006946 Bacteria 1282
48 Ga0079104_1052309 3300006946 Bacteria 905
49 Ga0105251_10000908 3300009011 Bacteria 26543
50 Ga0105251_10001152 3300009011 Bacteria 22997
51 Ga0105251_10003510 3300009011 Bacteria 11330
52 Ga0105251_10006274 3300009011 Bacteria 7612
53 Ga0105251_10014250 3300009011 Bacteria 4409
54 Ga0105251_10201548 3300009011 Bacteria 897
55 Ga0105251_10210173 3300009011 Bacteria 876
56 Ga0105251_10239559 3300009011 Bacteria 817
57 Ga0105251_10266509 3300009011 Bacteria 773
58 Ga0105251_10316432 3300009011 Bacteria 709
59 Ga0105244_10000036 3300009036 Bacteria 166889
60 Ga0105244_10000168 3300009036 Bacteria 67056
61 Ga0105244_10001461 3300009036 Bacteria 19073
62 Ga0105244_10004631 3300009036 Bacteria 9406
63 Ga0105244_10009200 3300009036 Bacteria 6096
64 Ga0105244_10014868 3300009036 Bacteria 4482
65 Ga0105244_10026309 3300009036 Bacteria 3150
66 Ga0105244_10052529 3300009036 Bacteria 2074
67 Ga0105244_10064194 3300009036 Bacteria 1843
68 Ga0105244_10213880 3300009036 Bacteria 906
69 Ga0105244_10256540 3300009036 Bacteria 814
70 Ga0105244_10267631 3300009036 Bacteria 794
71 Ga0105250_10000579 3300009092 Bacteria 24245
72 Ga0105250_10002495 3300009092 Bacteria 9224
73 Ga0105250_10017177 3300009092 Bacteria 2941
74 Ga0105250_10032876 3300009092 Bacteria 2082
75 Ga0105250_10097813 3300009092 Bacteria 1197
76 Ga0105250_10155161 3300009092 Bacteria 954
77 Ga0105243_10077354 3300009148 Bacteria 2706
78 Ga0105243_10447188 3300009148 Bacteria 1211
79 Ga0105243_10531823 3300009148 Bacteria 1120
80 Ga0105243_10843009 3300009148 Bacteria 907
81 Ga0105237_10516280 3300009545 Bacteria 1201
82 Ga0105246_10045773 3300011119 Bacteria 2981
83 Ga0105246_10824812 3300011119 Bacteria 825
84 Ga0105246_10825270 3300011119 Bacteria 825
85 Ga0105246_11232875 3300011119 Bacteria 690
86 Ga0157373_10000241 3300013100 Bacteria 44926
87 Ga0157373_10002966 3300013100 Bacteria 12853
88 Ga0157371_10000489 3300013102 Bacteria 48208
89 Ga0157371_10004466 3300013102 Bacteria 12200
90 Ga0157371_10034358 3300013102 Bacteria 3637
91 Ga0157371_10053031 3300013102 Bacteria 2880
92 Ga0157371_10435628 3300013102 Bacteria 962
93 Ga0157371_10630718 3300013102 Bacteria 799
94 Ga0157370_10015464 3300013104 Bacteria 7757
95 Ga0157370_10219200 3300013104 Bacteria 1762
96 Ga0157369_10000367 3300013105 Bacteria 60066
97 Ga0163162_10646081 3300013306 Bacteria 1182
98 Ga0163162_10775159 3300013306 Bacteria 1077
99 Ga0157372_10000088 3300013307 Bacteria 95033
100 Ga0157372_10016488 3300013307 Bacteria 7928
101 Ga0157372_10031012 3300013307 Bacteria 5851
102 Ga0157372_10104339 3300013307 Bacteria 3240
103 Ga0157372_10240469 3300013307 Bacteria 2101
104 Ga0157372_10275274 3300013307 Bacteria 1957
105 Ga0182008_10022917 3300014497 Bacteria 3195
106 Ga0182006_1000071 3300015261 Bacteria 135189
107 Ga0182006_1001057 3300015261 Bacteria 17773
108 Ga0183366_1008 3300015679 Bacteria 90953
109 Ga0183370_1008 3300015680 Bacteria 90953
110 Ga0183369_1023 3300015685 Bacteria 90953
111 Ga0183368_1011 3300015687 Bacteria 90953
112 Ga0163161_10003290 3300017792 Bacteria 11353
113 Ga0163161_10085728 3300017792 Bacteria 2323
114 Ga0213876_10000088 3300021384 Bacteria 105076
115 Ga0209437_100188 3300025233 Bacteria 125530
116 Ga0209129_1000173 3300025258 Bacteria 95055
117 Ga0207656_10052047 3300025321 Bacteria 1772
118 Ga0207696_1000237 3300025711 Bacteria 76707
119 Ga0207696_1000252 3300025711 Bacteria 70208
120 Ga0207696_1000364 3300025711 Bacteria 45010
121 Ga0207696_1001522 3300025711 Bacteria 12443
122 Ga0207696_1001936 3300025711 Bacteria 10529
123 Ga0207696_1010062 3300025711 Bacteria 3490
124 Ga0207696_1011244 3300025711 Bacteria 3237
125 Ga0207696_1082502 3300025711 Bacteria 887
126 Ga0207655_1000043 3300025728 Bacteria 332919
127 Ga0207655_1000099 3300025728 Bacteria 188494
128 Ga0207655_1000152 3300025728 Bacteria 127480
129 Ga0207655_1000178 3300025728 Bacteria 113749
130 Ga0207655_1000189 3300025728 Bacteria 109026
131 Ga0207655_1001695 3300025728 Bacteria 19390
132 Ga0207655_1001776 3300025728 Bacteria 18799
133 Ga0207655_1002886 3300025728 Bacteria 13271
134 Ga0207655_1004693 3300025728 Bacteria 9571
135 Ga0207655_1006531 3300025728 Bacteria 7705
136 Ga0207655_1008727 3300025728 Bacteria 6387
137 Ga0207655_1020594 3300025728 Bacteria 3383
138 Ga0207655_1026804 3300025728 Bacteria 2759
139 Ga0207713_1000091 3300025735 Bacteria 148429
140 Ga0207713_1000141 3300025735 Bacteria 107399
141 Ga0207713_1000214 3300025735 Bacteria 78447
142 Ga0207713_1001666 3300025735 Bacteria 17219
143 Ga0207713_1001763 3300025735 Bacteria 16601
144 Ga0207713_1007134 3300025735 Bacteria 6676
145 Ga0207713_1013761 3300025735 Bacteria 4243
146 Ga0207713_1023739 3300025735 Bacteria 2878
147 Ga0207713_1033204 3300025735 Bacteria 2257
148 Ga0207713_1040457 3300025735 Bacteria 1956
149 Ga0207713_1049233 3300025735 Bacteria 1691
150 Ga0207713_1059554 3300025735 Bacteria 1465
151 Ga0207713_1087998 3300025735 Bacteria 1099
152 Ga0207713_1123307 3300025735 Bacteria 866
153 Ga0207671_10482501 3300025914 Bacteria 988
154 Ga0207690_10019251 3300025932 Bacteria 4200
155 Ga0207706_10036471 3300025933 Bacteria 4367
156 Ga0207709_10269438 3300025935 Bacteria 1252
157 Ga0207679_10455781 3300025945 Bacteria 1135
158 Ga0207658_10202094 3300025986 Bacteria 1660
159 Ga0207674_10000080 3300026116 Bacteria 101768
160 Ga0209281_1000176 3300027111 Bacteria 151377
161 Ga0209281_1000217 3300027111 Bacteria 125471
162 Ga0209281_1000224 3300027111 Bacteria 120450
163 Ga0209281_1000278 3300027111 Bacteria 97268
164 Ga0209281_1000436 3300027111 Bacteria 61541
165 Ga0209281_1000460 3300027111 Bacteria 57232
166 Ga0209281_1000466 3300027111 Bacteria 56992
167 Ga0209281_1000943 3300027111 Bacteria 23776
168 Ga0209281_1001266 3300027111 Bacteria 16374
169 Ga0209371_1000071 3300027312 Bacteria 200748
170 Ga0209371_1000143 3300027312 Bacteria 117814
171 Ga0209371_1000154 3300027312 Bacteria 108161
172 Ga0209371_1000162 3300027312 Bacteria 100949
173 Ga0209371_1000233 3300027312 Bacteria 70364
174 Ga0209371_1000238 3300027312 Bacteria 69012
175 Ga0209371_1000362 3300027312 Bacteria 49166
176 Ga0209371_1001647 3300027312 Bacteria 14382
177 Ga0209371_1001898 3300027312 Bacteria 12800
178 Ga0209371_1002255 3300027312 Bacteria 11076
179 Ga0209371_1002305 3300027312 Bacteria 10879
180 Ga0209371_1002903 3300027312 Bacteria 8974
181 Ga0209371_1003254 3300027312 Bacteria 8089
182 Ga0209371_1003903 3300027312 Bacteria 6860
183 Ga0209371_1005508 3300027312 Bacteria 5002
184 Ga0209371_1007159 3300027312 Bacteria 3950
185 Ga0209371_1012147 3300027312 Bacteria 2513
186 Ga0209371_1021911 3300027312 Bacteria 1539
187 Ga0268266_10000199 3300028379 Bacteria 104808
188 Ga0268266_10123539 3300028379 Bacteria 2306
189 Ga0268266_10202440 3300028379 Bacteria 1817
190 Ga0268256_1000070 3300030500 Bacteria 189040
191 Ga0268256_1000113 3300030500 Bacteria 117659
192 Ga0268256_1000138 3300030500 Bacteria 100800
193 Ga0268256_1000198 3300030500 Bacteria 68968
194 Ga0268256_1000252 3300030500 Bacteria 56701
195 Ga0268256_1000413 3300030500 Bacteria 38609
196 Ga0268256_1000467 3300030500 Bacteria 35131
197 Ga0268256_1000828 3300030500 Bacteria 22035
198 Ga0268256_1001194 3300030500 Bacteria 16604
199 Ga0268256_1002047 3300030500 Bacteria 10879
200 Ga0268256_1002190 3300030500 Bacteria 10334
201 Ga0268256_1002439 3300030500 Bacteria 9495
202 Ga0268256_1005431 3300030500 Bacteria 5002
203 Ga0268256_1005628 3300030500 Bacteria 4866
204 Ga0268256_1007530 3300030500 Bacteria 3862
205 Ga0268256_1012255 3300030500 Bacteria 2661
206 Ga0268256_1013586 3300030500 Bacteria 2456
207 Ga0268256_1013968 3300030500 Bacteria 2406
208 Ga0268256_1044122 3300030500 Bacteria 979
209 Ga0436365_0402421 3300039437 Bacteria 121475
210 Ga0439438_000019 3300041405 Bacteria 117626
211 Ga0439438_005091 3300041405 Bacteria 4899
212 Ga0439438_012963 3300041405 Bacteria 2534
213 Ga0439438_020347 3300041405 Bacteria 1863
214 Ga0439438_033755 3300041405 Bacteria 1350
215 Ga0439447_001025 3300041407 Bacteria 10169
216 Ga0439447_002750 3300041407 Bacteria 6360
217 Ga0439466_0000015 3300041411 Bacteria 114576
218 Ga0451853_0071507 3300041512 Bacteria 7565
219 Ga0439432_149482 3300042006 Bacteria 685
220 Ga0439452_000042 3300042010 Bacteria 138073
221 Ga0439452_000063 3300042010 Bacteria 95039
222 Ga0439452_000176 3300042010 Bacteria 47891
223 Ga0439452_000491 3300042010 Bacteria 21861
224 Ga0439452_000601 3300042010 Bacteria 18510
225 Ga0439452_009840 3300042010 Bacteria 2805
226 Ga0439463_001854 3300042016 Bacteria 5487
227 Ga0450907_000033 3300042146 Bacteria 63179
228 Ga0439464_0003301 3300042439 Bacteria 4059
229 Ga0439464_0008866 3300042439 Bacteria 2636
230 Ga0439464_0027777 3300042439 Bacteria 1574
231 Ga0466981_0000018 3300044669 Bacteria 92998
232 Ga0495591_000067 3300046458 Bacteria 117988
233 Ga0495591_000170 3300046458 Bacteria 67905
234 Ga0495591_001076 3300046458 Bacteria 18246
235 Ga0495591_013284 3300046458 Bacteria 3023
236 Ga0495638_0007451 3300046460 Bacteria 7843
237 Ga0495650_0000313 3300046471 Bacteria 87461
238 Ga0495650_0000380 3300046471 Bacteria 76955
239 Ga0495605_0092488 3300046474 Bacteria 1400
240 Ga0495605_0211866 3300046474 Bacteria 840
241 Ga0495596_0002193 3300046500 Bacteria 10643
242 Ga0495607_0028731 3300046501 Bacteria 3427
243 Ga0495606_0002690 3300046507 Bacteria 20099
244 Ga0495616_0021634 3300046513 Bacteria 3479
245 Ga0495616_0058925 3300046513 Bacteria 1890
246 Ga0495620_0055821 3300046515 Bacteria 1663
247 Ga0495631_0028135 3300046518 Bacteria 2566
248 Ga0495643_0061051 3300046522 Bacteria 2000
249 Ga0495644_0010903 3300046523 Bacteria 3502
250 Ga0495648_0002570 3300046524 Bacteria 16638
251 Ga0495648_0029906 3300046524 Bacteria 3609
252 Ga0495654_0000064 3300046530 Bacteria 127799
253 Ga0495654_0000183 3300046530 Bacteria 61398
254 Ga0495654_0029769 3300046530 Bacteria 2783
255 Ga0495654_0126784 3300046530 Bacteria 1149
256 Ga0495597_0000344 3300046542 Bacteria 41594
257 Ga0495597_0003612 3300046542 Bacteria 8896
258 Ga0495625_0008852 3300046660 Bacteria 8520
259 Ga0495588_0014421 3300046674 Bacteria 3783
260 Ga0495671_0004169 3300046692 Bacteria 8709
261 Ga0495649_0005525 3300046694 Bacteria 8008
262 Ga0495649_0007113 3300046694 Bacteria 6878
263 Ga0495649_0007911 3300046694 Bacteria 6433
264 Ga0495589_0001903 3300046794 Bacteria 11811
265 Ga0495660_0000058 3300046810 Bacteria 133170
266 Ga0495660_0040791 3300046810 Bacteria 2571
267 Ga0495672_0000106 3300047320 Bacteria 132815
268 Ga0495672_0000128 3300047320 Bacteria 116418
269 Ga0495672_0000229 3300047320 Bacteria 80054
270 Ga0495679_000170 3300047446 Bacteria 59106
271 Ga0495679_000919 3300047446 Bacteria 18422
272 Ga0495679_002773 3300047446 Bacteria 8712
273 Ga0495673_0000299 3300047469 Bacteria 66227
274 Ga0495673_0000371 3300047469 Bacteria 53983
275 Ga0495681_0028999 3300047470 Bacteria 2838
276 Ga0496100_0050537 3300048903 Bacteria 2694
277 Ga0496101_0000081 3300048904 Bacteria 105727
278 Ga0496101_0047231 3300048904 Bacteria 3090
279 Ga0496102_0001090 3300048905 Bacteria 25118
280 Ga0496103_0227239 3300048906 Bacteria 1200
281 Ga0496103_0243649 3300048906 Bacteria 1157
282 Ga0496104_0000089 3300048907 Bacteria 88812
283 Ga0496104_0549901 3300048907 Bacteria 1065
284 Ga0496105_0005374 3300048908 Bacteria 9713
285 Ga0496105_0030896 3300048908 Bacteria 4391
286 Ga0496116_0000177 3300048919 Bacteria 128402
287 Ga0496116_0003465 3300048919 Bacteria 15555
288 Ga0496116_0006699 3300048919 Bacteria 10382
289 Ga0496116_0011268 3300048919 Bacteria 7420
290 Ga0496116_0019838 3300048919 Bacteria 5132
291 Ga0496116_0045900 3300048919 Bacteria 2953
292 Ga0496116_0091242 3300048919 Bacteria 1851
293 Ga0496116_0332758 3300048919 Bacteria 704
294 Ga0496117_0000435 3300048920 Bacteria 69463
295 Ga0496117_0000836 3300048920 Bacteria 47596
296 Ga0496117_0005802 3300048920 Bacteria 12802
297 Ga0496117_0008929 3300048920 Bacteria 9437
298 Ga0496117_0026370 3300048920 Bacteria 4548
299 Ga0496117_0027216 3300048920 Bacteria 4459
300 Ga0496117_0034893 3300048920 Bacteria 3783
301 Ga0496117_0041266 3300048920 Bacteria 3383
302 Ga0496117_0078442 3300048920 Bacteria 2180
303 Ga0496117_0285450 3300048920 Bacteria 881
304 Ga0496117_0430317 3300048920 Bacteria 657
305 Ga0496118_0000512 3300048921 Bacteria 63837
306 Ga0496118_0002377 3300048921 Bacteria 25429
307 Ga0496118_0006841 3300048921 Bacteria 12373
308 Ga0496118_0021483 3300048921 Bacteria 5678
309 Ga0496118_0034565 3300048921 Bacteria 4120
310 Ga0496118_0089502 3300048921 Bacteria 2124
311 Ga0496118_0220410 3300048921 Bacteria 1104
312 Ga0496118_0254132 3300048921 Bacteria 996
313 Ga0496118_0400165 3300048921 Bacteria 713
314 Ga0496119_0000085 3300048922 Bacteria 137406
315 Ga0496119_0000154 3300048922 Bacteria 95502
316 Ga0496119_0000259 3300048922 Bacteria 75018
317 Ga0496119_0000294 3300048922 Bacteria 69996
318 Ga0496119_0002037 3300048922 Bacteria 22873
319 Ga0496119_0021426 3300048922 Bacteria 4673
320 Ga0496119_0026067 3300048922 Bacteria 4063
321 Ga0496119_0029418 3300048922 Bacteria 3725
322 Ga0496119_0032620 3300048922 Bacteria 3467
323 Ga0496119_0150157 3300048922 Bacteria 1249
324 Ga0496119_0323939 3300048922 Bacteria 753
325 Ga0496120_0000111 3300048923 Bacteria 137405
326 Ga0496120_0000136 3300048923 Bacteria 124418
327 Ga0496120_0000314 3300048923 Bacteria 80307
328 Ga0496120_0000482 3300048923 Bacteria 62533
329 Ga0496120_0000883 3300048923 Bacteria 42250
330 Ga0496120_0001469 3300048923 Bacteria 28083
331 Ga0496120_0005810 3300048923 Bacteria 9670
332 Ga0496120_0020461 3300048923 Bacteria 4204
333 Ga0496120_0047956 3300048923 Bacteria 2460
334 Ga0496121_0000244 3300048924 Bacteria 116655
335 Ga0496121_0002703 3300048924 Bacteria 26517
336 Ga0496121_0008805 3300048924 Bacteria 11757
337 Ga0496121_0025199 3300048924 Bacteria 5654
338 Ga0496121_0029522 3300048924 Bacteria 5068
339 Ga0496121_0052189 3300048924 Bacteria 3436
340 Ga0496121_0100869 3300048924 Bacteria 2227
341 Ga0496121_0364551 3300048924 Bacteria 958
342 Ga0496121_0575869 3300048924 Bacteria 699
343 Ga0496122_0000863 3300048925 Bacteria 57032
344 Ga0496122_0000902 3300048925 Bacteria 54945
345 Ga0496122_0001570 3300048925 Bacteria 36018
346 Ga0496122_0004194 3300048925 Bacteria 18131
347 Ga0496122_0010347 3300048925 Bacteria 9641
348 Ga0496122_0013173 3300048925 Bacteria 8123
349 Ga0496122_0033787 3300048925 Bacteria 4200
350 Ga0496122_0061690 3300048925 Bacteria 2750
351 Ga0496122_0074424 3300048925 Bacteria 2403
352 Ga0496122_0135689 3300048925 Bacteria 1551
353 Ga0496122_0270429 3300048925 Bacteria 936
354 Ga0496123_0000660 3300048926 Bacteria 57032
355 Ga0496123_0002246 3300048926 Bacteria 24431
356 Ga0496123_0002682 3300048926 Bacteria 21424
357 Ga0496123_0008106 3300048926 Bacteria 9713
358 Ga0496123_0008358 3300048926 Bacteria 9519
359 Ga0496123_0010933 3300048926 Bacteria 7940
360 Ga0496123_0049184 3300048926 Bacteria 2829
361 Ga0496123_0076515 3300048926 Bacteria 2059
362 Ga0496123_0207974 3300048926 Bacteria 997
363 Ga0496124_0000295 3300048927 Bacteria 92650
364 Ga0496124_0000594 3300048927 Bacteria 60866
365 Ga0496124_0001177 3300048927 Bacteria 40891
366 Ga0496124_0010574 3300048927 Bacteria 9331
367 Ga0496124_0013826 3300048927 Bacteria 7850
368 Ga0496124_0014594 3300048927 Bacteria 7588
369 Ga0496124_0015545 3300048927 Bacteria 7287
370 Ga0496124_0032118 3300048927 Bacteria 4641
371 Ga0496124_0080051 3300048927 Bacteria 2689
372 Ga0496124_0088094 3300048927 Bacteria 2538
373 Ga0496124_0275876 3300048927 Bacteria 1228
374 Ga0496124_0622676 3300048927 Bacteria 698
375 Ga0496125_0000175 3300048928 Bacteria 142672
376 Ga0496125_0001070 3300048928 Bacteria 42218
377 Ga0496125_0010742 3300048928 Bacteria 9223
378 Ga0496125_0028409 3300048928 Bacteria 5052
379 Ga0496125_0073700 3300048928 Bacteria 2652
380 Ga0496125_0108454 3300048928 Bacteria 2019
381 Ga0496125_0154467 3300048928 Bacteria 1570
382 Ga0496126_0022222 3300048929 Bacteria 6175
383 Ga0496126_0070357 3300048929 Bacteria 3117
384 Ga0496126_0072965 3300048929 Bacteria 3052
385 Ga0496126_0143438 3300048929 Bacteria 2053
386 Ga0496126_0150448 3300048929 Bacteria 1995
387 Ga0496126_0157559 3300048929 Bacteria 1942
388 Ga0496126_0646197 3300048929 Bacteria 828
389 Ga0495678_000088 3300049459 Bacteria 115071
390 Ga0495678_033899 3300049459 Bacteria 2105
391 Ga0495682_0000033 3300049460 Bacteria 132733
392 nmdc:mga00v17_11012_c1 3300050491 Bacteria 4957
393 nmdc:mga00v17_37620_c1 3300050491 Bacteria 2891
394 nmdc:mga00v17_474593_c1 3300050491 Bacteria 812
395 nmdc:mga00v17_5939_c2 3300050491 Bacteria 5646
396 nmdc:mga00v17_66019_c1 3300050491 Bacteria 2233
397 nmdc:mga0k408_40054_c1 3300050493 Bacteria 2694
398 Ga0500621_000013 3300053126 Bacteria 132878

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 2010549000 RicEn_FSXC66974_b1 RicEn_521620 185
2 3300009092 Ga0105250_10002495 Ga0105250_100024958 185
3 3300042006 Ga0439432_149482 Ga0439432_149482_17_574 185
4 3300048920 Ga0496117_0034893 Ga0496117_0034893_103_660 185
5 3300048920 Ga0496117_0285450 Ga0496117_0285450_170_727 185
6 3300048924 Ga0496121_0029522 Ga0496121_0029522_4175_4732 185
7 3300048925 Ga0496122_0061690 Ga0496122_0061690_182_739 185
8 3300048926 Ga0496123_0049184 Ga0496123_0049184_196_753 185
9 3300048929 Ga0496126_0646197 Ga0496126_0646197_157_753 186
10 iso_pu_bacteria 2511231025 2511382475 189
11 iso_pu_bacteria 2511231035 2511433000 189
12 iso_pu_bacteria 2599185299 2599929546 189
13 iso_pu_bacteria 2608642108 2608672124 189
14 iso_pu_bacteria 2648501693 2650899962 189
15 iso_pu_bacteria 2684622997 2686356667 189
16 iso_pu_bacteria 2808606414 2809127782 189
17 iso_pu_bacteria 2844528606 2844532855 189
18 iso_pu_bacteria 2847085930 2847089699 189
19 iso_pu_bacteria 2847797336 2847797513 189
20 iso_pu_bacteria 2865014394 2865017896 189
21 iso_pu_bacteria 2876601092 2876601125 189
22 iso_pu_bacteria 2881609920 2881612905 189
23 iso_pu_bacteria 2939602548 2939604997 189
24 iso_pu_bacteria 2945951305 2945955084 189
25 iso_pu_bacteria 2978975091 2978977561 189
26 iso_pu_bacteria 2984494565 2984498939 189
27 iso_pu_bacteria 2990261002 2990264805 189
28 iso_pu_bacteria 8016733728 8016733884 189
29 iso_pu_bacteria 8019499862 8019504395 189
30 iso_pu_bacteria 2908669403 2908674327 190
31 3300009036 Ga0105244_10004631 Ga0105244_100046315 191
32 3300013100 Ga0157373_10002966 Ga0157373_100029667 191
33 3300013102 Ga0157371_10004466 Ga0157371_1000446613 191
34 3300013307 Ga0157372_10031012 Ga0157372_100310126 191
35 3300013307 Ga0157372_10104339 Ga0157372_101043395 191
36 3300013307 Ga0157372_10240469 Ga0157372_102404691 191
37 3300025728 Ga0207655_1000178 Ga0207655_100017831 191
38 3300041405 Ga0439438_000019 Ga0439438_000019_79150_79803 191
39 3300041407 Ga0439447_001025 Ga0439447_001025_7955_8608 191
40 3300046458 Ga0495591_001076 Ga0495591_001076_17006_17662 191
41 3300046471 Ga0495650_0000380 Ga0495650_0000380_41056_41649 191
42 3300046474 Ga0495605_0211866 Ga0495605_0211866_144_737 191
43 3300046501 Ga0495607_0028731 Ga0495607_0028731_1255_1848 191
44 3300046507 Ga0495606_0002690 Ga0495606_0002690_12615_13208 191
45 3300046513 Ga0495616_0021634 Ga0495616_0021634_1046_1702 191
46 3300046518 Ga0495631_0028135 Ga0495631_0028135_822_1415 191
47 3300046522 Ga0495643_0061051 Ga0495643_0061051_250_906 191
48 3300046523 Ga0495644_0010903 Ga0495644_0010903_1383_2039 191
49 3300046524 Ga0495648_0029906 Ga0495648_0029906_1146_1802 191
50 3300046530 Ga0495654_0000183 Ga0495654_0000183_21145_21738 191
51 3300046692 Ga0495671_0004169 Ga0495671_0004169_4355_5011 191
52 3300046694 Ga0495649_0007911 Ga0495649_0007911_3558_4214 191
53 3300046794 Ga0495589_0001903 Ga0495589_0001903_9337_9993 191
54 3300046810 Ga0495660_0000058 Ga0495660_0000058_40991_41647 191
55 3300047320 Ga0495672_0000106 Ga0495672_0000106_91189_91845 191
56 3300047469 Ga0495673_0000371 Ga0495673_0000371_21605_22261 191
57 3300048919 Ga0496116_0003465 Ga0496116_0003465_11470_12057 191
58 3300048923 Ga0496120_0000314 Ga0496120_0000314_69919_70506 191
59 3300048927 Ga0496124_0010574 Ga0496124_0010574_584_1171 191
60 3300049459 Ga0495678_000088 Ga0495678_000088_91182_91775 191
61 3300049460 Ga0495682_0000033 Ga0495682_0000033_91088_91681 191
62 3300053126 Ga0500621_000013 Ga0500621_000013_91189_91845 191
63 iso_pu_bacteria 2609459761 2609914032 191
64 iso_pu_bacteria 2945874760 2945875113 191
65 3300001989 JGI24739J22299_10000025 JGI24739J22299_100000255 192
66 3300003856 Ga0058692_1000131 Ga0058692_100013114 192
67 3300003856 Ga0058692_1004287 Ga0058692_10042873 192
68 3300003856 Ga0058692_1005556 Ga0058692_10055563 192
69 3300003856 Ga0058692_1045376 Ga0058692_10453761 192
70 3300005367 Ga0070667_100188704 Ga0070667_1001887042 192
71 3300005457 Ga0070662_100022418 Ga0070662_1000224184 192
72 3300005548 Ga0070665_100011225 Ga0070665_10001122510 192
73 3300006051 Ga0075364_10026395 Ga0075364_100263952 192
74 3300006051 Ga0075364_10245921 Ga0075364_102459212 192
75 3300006051 Ga0075364_10654212 Ga0075364_106542122 192
76 3300009011 Ga0105251_10000908 Ga0105251_100009082 192
77 3300009011 Ga0105251_10239559 Ga0105251_102395591 192
78 3300009036 Ga0105244_10014868 Ga0105244_100148682 192
79 3300009036 Ga0105244_10256540 Ga0105244_102565401 192
80 3300009036 Ga0105244_10267631 Ga0105244_102676311 192
81 3300009092 Ga0105250_10017177 Ga0105250_100171772 192
82 3300011119 Ga0105246_10824812 Ga0105246_108248121 192
83 3300011119 Ga0105246_10825270 Ga0105246_108252701 192
84 3300011119 Ga0105246_11232875 Ga0105246_112328751 192
85 3300013100 Ga0157373_10000241 Ga0157373_1000024131 192
86 3300013102 Ga0157371_10000489 Ga0157371_100004893 192
87 3300013104 Ga0157370_10219200 Ga0157370_102192002 192
88 3300013306 Ga0163162_10646081 Ga0163162_106460812 192
89 3300013307 Ga0157372_10275274 Ga0157372_102752742 192
90 3300014497 Ga0182008_10022917 Ga0182008_100229173 192
91 3300015261 Ga0182006_1001057 Ga0182006_100105720 192
92 3300017792 Ga0163161_10003290 Ga0163161_100032907 192
93 3300025233 Ga0209437_100188 Ga0209437_10018891 192
94 3300025711 Ga0207696_1000237 Ga0207696_100023745 192
95 3300025711 Ga0207696_1000364 Ga0207696_100036434 192
96 3300025711 Ga0207696_1010062 Ga0207696_10100624 192
97 3300025728 Ga0207655_1001695 Ga0207655_100169511 192
98 3300025728 Ga0207655_1001776 Ga0207655_10017765 192
99 3300025728 Ga0207655_1006531 Ga0207655_10065311 192
100 3300025728 Ga0207655_1026804 Ga0207655_10268043 192
101 3300025735 Ga0207713_1000214 Ga0207713_100021433 192
102 3300025735 Ga0207713_1001763 Ga0207713_10017635 192
103 3300025735 Ga0207713_1007134 Ga0207713_10071345 192
104 3300025735 Ga0207713_1059554 Ga0207713_10595542 192
105 3300025933 Ga0207706_10036471 Ga0207706_100364714 192
106 3300025986 Ga0207658_10202094 Ga0207658_102020942 192
107 3300027312 Ga0209371_1000233 Ga0209371_100023335 192
108 3300027312 Ga0209371_1000238 Ga0209371_100023830 192
109 3300027312 Ga0209371_1001647 Ga0209371_10016478 192
110 3300027312 Ga0209371_1001898 Ga0209371_10018988 192
111 3300027312 Ga0209371_1007159 Ga0209371_10071595 192
112 3300027312 Ga0209371_1012147 Ga0209371_10121473 192
113 3300028379 Ga0268266_10202440 Ga0268266_102024402 192
114 3300030500 Ga0268256_1000198 Ga0268256_100019836 192
115 3300030500 Ga0268256_1000252 Ga0268256_100025234 192
116 3300030500 Ga0268256_1000467 Ga0268256_10004678 192
117 3300030500 Ga0268256_1002439 Ga0268256_10024394 192
118 3300030500 Ga0268256_1013586 Ga0268256_10135863 192
119 3300030500 Ga0268256_1013968 Ga0268256_10139682 192
120 3300041405 Ga0439438_012963 Ga0439438_012963_991_1584 192
121 3300041405 Ga0439438_020347 Ga0439438_020347_48_638 192
122 3300041407 Ga0439447_002750 Ga0439447_002750_5267_5860 192
123 3300041411 Ga0439466_0000015 Ga0439466_0000015_76175_76765 192
124 3300042010 Ga0439452_009840 Ga0439452_009840_680_1270 192
125 3300042016 Ga0439463_001854 Ga0439463_001854_2610_3200 192
126 3300042146 Ga0450907_000033 Ga0450907_000033_54376_54966 192
127 3300042439 Ga0439464_0008866 Ga0439464_0008866_1630_2220 192
128 3300046458 Ga0495591_000067 Ga0495591_000067_37321_37911 192
129 3300046474 Ga0495605_0092488 Ga0495605_0092488_672_1343 192
130 3300046500 Ga0495596_0002193 Ga0495596_0002193_2668_3258 192
131 3300046524 Ga0495648_0002570 Ga0495648_0002570_4252_4842 192
132 3300046530 Ga0495654_0000064 Ga0495654_0000064_37323_37913 192
133 3300046810 Ga0495660_0040791 Ga0495660_0040791_667_1257 192
134 3300047320 Ga0495672_0000128 Ga0495672_0000128_37809_38399 192
135 3300047446 Ga0495679_002773 Ga0495679_002773_4038_4628 192
136 3300048903 Ga0496100_0050537 Ga0496100_0050537_335_925 192
137 3300048904 Ga0496101_0000081 Ga0496101_0000081_36585_37175 192
138 3300048905 Ga0496102_0001090 Ga0496102_0001090_6265_6855 192
139 3300048906 Ga0496103_0227239 Ga0496103_0227239_47_637 192
140 3300048908 Ga0496105_0005374 Ga0496105_0005374_4285_4875 192
141 3300048919 Ga0496116_0000177 Ga0496116_0000177_39302_39958 192
142 3300048919 Ga0496116_0045900 Ga0496116_0045900_495_1085 192
143 3300048919 Ga0496116_0091242 Ga0496116_0091242_800_1390 192
144 3300048920 Ga0496117_0000435 Ga0496117_0000435_31659_32249 192
145 3300048920 Ga0496117_0000836 Ga0496117_0000836_9293_9883 192
146 3300048920 Ga0496117_0078442 Ga0496117_0078442_1054_1644 192
147 3300048921 Ga0496118_0000512 Ga0496118_0000512_31659_32249 192
148 3300048921 Ga0496118_0006841 Ga0496118_0006841_6153_6743 192
149 3300048921 Ga0496118_0021483 Ga0496118_0021483_1668_2258 192
150 3300048922 Ga0496119_0000085 Ga0496119_0000085_96941_97534 192
151 3300048922 Ga0496119_0000259 Ga0496119_0000259_42671_43261 192
152 3300048922 Ga0496119_0000294 Ga0496119_0000294_31755_32345 192
153 3300048922 Ga0496119_0002037 Ga0496119_0002037_18034_18690 192
154 3300048923 Ga0496120_0000111 Ga0496120_0000111_96940_97533 192
155 3300048923 Ga0496120_0000136 Ga0496120_0000136_85901_86557 192
156 3300048923 Ga0496120_0000482 Ga0496120_0000482_42671_43261 192
157 3300048923 Ga0496120_0000883 Ga0496120_0000883_4007_4597 192
158 3300048923 Ga0496120_0001469 Ga0496120_0001469_24495_25085 192
159 3300048924 Ga0496121_0000244 Ga0496121_0000244_37809_38399 192
160 3300048924 Ga0496121_0364551 Ga0496121_0364551_19_609 192
161 3300048925 Ga0496122_0004194 Ga0496122_0004194_5032_5622 192
162 3300048925 Ga0496122_0010347 Ga0496122_0010347_2787_3377 192
163 3300048925 Ga0496122_0135689 Ga0496122_0135689_923_1513 192
164 3300048926 Ga0496123_0008106 Ga0496123_0008106_2859_3449 192
165 3300048926 Ga0496123_0076515 Ga0496123_0076515_1008_1598 192
166 3300048927 Ga0496124_0000295 Ga0496124_0000295_37842_38432 192
167 3300048927 Ga0496124_0013826 Ga0496124_0013826_5499_6089 192
168 3300048927 Ga0496124_0032118 Ga0496124_0032118_51_641 192
169 3300048927 Ga0496124_0080051 Ga0496124_0080051_143_733 192
170 3300048928 Ga0496125_0001070 Ga0496125_0001070_15277_15867 192
171 3300048928 Ga0496125_0154467 Ga0496125_0154467_133_723 192
172 3300048929 Ga0496126_0070357 Ga0496126_0070357_1204_1794 192
173 3300048929 Ga0496126_0072965 Ga0496126_0072965_1462_2052 192
174 3300049459 Ga0495678_033899 Ga0495678_033899_64_654 192
175 3300050491 nmdc:mga00v17_37620_c1 nmdc:mga00v17_37620_c1_705_1295 192
176 3300050491 nmdc:mga00v17_66019_c1 nmdc:mga00v17_66019_c1_747_1337 192
177 iso_pu_bacteria 2939568625 2939572828 192
178 iso_pu_bacteria 2939642701 2939646823 192
179 iso_pu_bacteria 3000376612 3000376744 193
180 3300009011 Ga0105251_10266509 Ga0105251_102665091 194
181 iso_pu_bacteria 2547132416 2548647669 194
182 iso_pu_bacteria 2602042047 2603646239 194
183 iso_pu_bacteria 2602042066 2603701919 194
184 iso_pu_bacteria 2602042067 2603706716 194
185 iso_pu_bacteria 2667528172 2671105729 194
186 iso_pu_bacteria 2681812866 2681995129 194
187 iso_pu_bacteria 2681812869 2682009905 194
188 iso_pu_bacteria 2751185917 2753858146 194
189 iso_pu_bacteria 2765235842 2765591309 194
190 iso_pu_bacteria 2775506706 2775538349 194
191 iso_pu_bacteria 2821118458 2821122918 194
192 iso_pu_bacteria 2823373977 2823378396 194
193 iso_pu_bacteria 2844425489 2844429650 194
194 iso_pu_bacteria 2884086401 2884086593 194
195 iso_pu_bacteria 2923634449 2923637174 194
196 iso_pu_bacteria 2927833300 2927836381 194
197 iso_pu_bacteria 2937539931 2937541866 194
198 iso_pu_bacteria 2939573065 2939577467 194
199 iso_pu_bacteria 2939607340 2939611725 194
200 iso_pu_bacteria 2974310843 2974314451 194
201 iso_pu_bacteria 8018221730 8018224932 194
202 iso_pu_bacteria 8018405270 8018405707 194
203 iso_pu_bacteria 8055087960 8055089064 194
204 iso_pu_bacteria 8055092621 8055093345 194
205 iso_pu_bacteria 8055097453 8055097900 194
206 3300003856 Ga0058692_1010025 Ga0058692_10100252 195
207 3300006946 Ga0079104_1000191 Ga0079104_100019126 195
208 3300009036 Ga0105244_10001461 Ga0105244_1000146110 195
209 3300013307 Ga0157372_10016488 Ga0157372_100164884 195
210 3300021384 Ga0213876_10000088 Ga0213876_1000008844 195
211 3300025728 Ga0207655_1004693 Ga0207655_10046933 195
212 3300027111 Ga0209281_1000278 Ga0209281_100027858 195
213 3300027312 Ga0209371_1002903 Ga0209371_10029033 195
214 3300030500 Ga0268256_1002190 Ga0268256_100219010 195
215 3300039437 Ga0436365_0402421 Ga0436365_0402421_49927_50520 195
216 3300048904 Ga0496101_0047231 Ga0496101_0047231_2354_2941 195
217 3300048925 Ga0496122_0000902 Ga0496122_0000902_33255_33848 195
218 3300048925 Ga0496122_0033787 Ga0496122_0033787_51_647 195
219 3300048926 Ga0496123_0002246 Ga0496123_0002246_2734_3327 195
220 3300048926 Ga0496123_0010933 Ga0496123_0010933_3661_4257 195
221 iso_pu_bacteria 2547132181 2547698416 195
222 iso_pu_bacteria 2554235234 2555260670 195
223 iso_pu_bacteria 2561511199 2562465273 195
224 iso_pu_bacteria 2599185169 2599411586 195
225 iso_pu_bacteria 2600255254 2601524741 195
226 iso_pu_bacteria 2600255255 2601529895 195
227 iso_pu_bacteria 2600255256 2601536645 195
228 iso_pu_bacteria 2600255257 2601542017 195
229 iso_pu_bacteria 2600255280 2601616729 195
230 iso_pu_bacteria 2600255281 2601621451 195
231 iso_pu_bacteria 2600255287 2601645297 195
232 iso_pu_bacteria 2600255288 2601649848 195
233 iso_pu_bacteria 2600255289 2601654775 195
234 iso_pu_bacteria 2600255290 2601659951 195
235 iso_pu_bacteria 2600255291 2601664539 195
236 iso_pu_bacteria 2600255298 2601697929 195
237 iso_pu_bacteria 2600255299 2601702297 195
238 iso_pu_bacteria 2600255300 2601707519 195
239 iso_pu_bacteria 2600255301 2601712540 195
240 iso_pu_bacteria 2600255302 2601718036 195
241 iso_pu_bacteria 2600255303 2601722800 195
242 iso_pu_bacteria 2600255304 2601727964 195
243 iso_pu_bacteria 2600255305 2601732981 195
244 iso_pu_bacteria 2600255306 2601737250 195
245 iso_pu_bacteria 2600255307 2601741669 195
246 iso_pu_bacteria 2600255309 2601752568 195
247 iso_pu_bacteria 2600255310 2601760377 195
248 iso_pu_bacteria 2600255311 2601765758 195
249 iso_pu_bacteria 2600255392 2602019860 195
250 iso_pu_bacteria 2602042046 2603641474 195
251 iso_pu_bacteria 2602042052 2603662704 195
252 iso_pu_bacteria 2602042053 2603667600 195
253 iso_pu_bacteria 2602042103 2603840391 195
254 iso_pu_bacteria 2602042104 2603845467 195
255 iso_pu_bacteria 2602042105 2603850541 195
256 iso_pu_bacteria 2602042106 2603855608 195
257 iso_pu_bacteria 2602042109 2603868139 195
258 iso_pu_bacteria 2602042110 2603872943 195
259 iso_pu_bacteria 2602042111 2603878410 195
260 iso_pu_bacteria 2603880178 2606050370 195
261 iso_pu_bacteria 2603880184 2606072027 195
262 iso_pu_bacteria 2603880202 2606148052 195
263 iso_pu_bacteria 2603880211 2606178013 195
264 iso_pu_bacteria 2636415599 2637222721 195
265 iso_pu_bacteria 2671180115 2671588164 195
266 iso_pu_bacteria 2675903046 2676409008 195
267 iso_pu_bacteria 2711768156 2712471856 195
268 iso_pu_bacteria 2775507074 2777021065 195
269 iso_pu_bacteria 2791354903 2791922738 195
270 iso_pu_bacteria 2791355010 2792314509 195
271 iso_pu_bacteria 2791355275 2793407463 195
272 iso_pu_bacteria 2814123068 2814698970 195
273 iso_pu_bacteria 2891670763 2891672017 195
274 iso_pu_bacteria 2904513164 2904516463 195
275 iso_pu_bacteria 2919108558 2919112442 195
276 iso_pu_bacteria 2935625433 2935629973 195
277 iso_pu_bacteria 2939617950 2939622142 195
278 iso_pu_bacteria 2969079654 2969079748 195
279 iso_pu_bacteria 2971820967 2971821076 195
280 iso_pu_bacteria 2974435778 2974436314 195
281 iso_pu_bacteria 2984559226 2984562186 195
282 iso_pu_bacteria 2984595703 2984600249 195
283 iso_pu_bacteria 8019504834 8019509001 195
284 iso_pu_bacteria 8054844752 8054844945 195
285 iso_pu_bacteria 8054849141 8054849905 195
286 iso_pu_bacteria 8057304971 8057307816 195
287 2162886007 SwRhRL2b_contig_995426 SwRhRL2b_0892.00006950 196
288 3300005289 Ga0065704_10001056 Ga0065704_1000105610 196
289 3300005548 Ga0070665_100166046 Ga0070665_1001660464 196
290 3300006051 Ga0075364_10004088 Ga0075364_100040885 196
291 3300006946 Ga0079104_1002152 Ga0079104_10021525 196
292 3300009148 Ga0105243_10531823 Ga0105243_105318231 196
293 3300011119 Ga0105246_10045773 Ga0105246_100457734 196
294 3300025711 Ga0207696_1001936 Ga0207696_100193612 196
295 3300025728 Ga0207655_1000189 Ga0207655_100018959 196
296 3300025735 Ga0207713_1013761 Ga0207713_10137613 196
297 3300025935 Ga0207709_10269438 Ga0207709_102694382 196
298 3300027111 Ga0209281_1000217 Ga0209281_100021743 196
299 3300028379 Ga0268266_10123539 Ga0268266_101235391 196
300 3300046458 Ga0495591_000170 Ga0495591_000170_25541_26137 196
301 3300048907 Ga0496104_0549901 Ga0496104_0549901_274_864 196
302 3300048919 Ga0496116_0011268 Ga0496116_0011268_2770_3366 196
303 3300048919 Ga0496116_0332758 Ga0496116_0332758_94_690 196
304 3300048920 Ga0496117_0027216 Ga0496117_0027216_584_1180 196
305 3300048921 Ga0496118_0034565 Ga0496118_0034565_2602_3198 196
306 3300048922 Ga0496119_0026067 Ga0496119_0026067_85_681 196
307 3300048924 Ga0496121_0002703 Ga0496121_0002703_24949_25545 196
308 3300048925 Ga0496122_0000863 Ga0496122_0000863_49166_49762 196
309 3300048926 Ga0496123_0000660 Ga0496123_0000660_49166_49762 196
310 3300048928 Ga0496125_0010742 Ga0496125_0010742_7921_8517 196
311 3300048929 Ga0496126_0150448 Ga0496126_0150448_409_1005 196
312 3300050491 nmdc:mga00v17_5939_c2 nmdc:mga00v17_5939_c2_3637_4233 196
313 3300009092 Ga0105250_10097813 Ga0105250_100978132 197
314 3300025711 Ga0207696_1001522 Ga0207696_100152211 197
315 3300025728 Ga0207655_1002886 Ga0207655_10028868 197
316 3300046530 Ga0495654_0126784 Ga0495654_0126784_337_933 197
317 3300046542 Ga0495597_0000344 Ga0495597_0000344_321_917 197
318 3300046674 Ga0495588_0014421 Ga0495588_0014421_2429_3025 197
319 3300047320 Ga0495672_0000229 Ga0495672_0000229_38498_39094 197
320 3300047470 Ga0495681_0028999 Ga0495681_0028999_2130_2726 197
321 3300050491 nmdc:mga00v17_11012_c1 nmdc:mga00v17_11012_c1_2564_3160 197
322 2162886007 SwRhRL2b_contig_1471168 SwRhRL2b_0602.00004160 198
323 2162886007 SwRhRL2b_contig_212761 SwRhRL2b_0097.00001620 198
324 2162886007 SwRhRL2b_contig_928522 SwRhRL2b_0756.00006880 198
325 3300003320 rootH2_10031586 rootH2_1003158628 198
326 3300003856 Ga0058692_1039467 Ga0058692_10394671 198
327 3300003856 Ga0058692_1039526 Ga0058692_10395261 198
328 3300005289 Ga0065704_10000573 Ga0065704_1000057311 198
329 3300005289 Ga0065704_10004833 Ga0065704_100048332 198
330 3300005289 Ga0065704_10141990 Ga0065704_101419901 198
331 3300005339 Ga0070660_100232764 Ga0070660_1002327642 198
332 3300005347 Ga0070668_100114816 Ga0070668_1001148163 198
333 3300005366 Ga0070659_100017223 Ga0070659_1000172234 198
334 3300005548 Ga0070665_100000842 Ga0070665_1000008429 198
335 3300005577 Ga0068857_100000014 Ga0068857_10000001438 198
336 3300005834 Ga0068851_10004912 Ga0068851_100049125 198
337 3300006051 Ga0075364_10012070 Ga0075364_100120703 198
338 3300006946 Ga0079104_1000088 Ga0079104_100008852 198
339 3300006946 Ga0079104_1000217 Ga0079104_100021741 198
340 3300006946 Ga0079104_1004354 Ga0079104_10043546 198
341 3300006946 Ga0079104_1032608 Ga0079104_10326081 198
342 3300006946 Ga0079104_1052309 Ga0079104_10523091 198
343 3300009011 Ga0105251_10001152 Ga0105251_1000115211 198
344 3300009011 Ga0105251_10003510 Ga0105251_100035106 198
345 3300009011 Ga0105251_10014250 Ga0105251_100142505 198
346 3300009011 Ga0105251_10201548 Ga0105251_102015481 198
347 3300009011 Ga0105251_10210173 Ga0105251_102101731 198
348 3300009011 Ga0105251_10316432 Ga0105251_103164321 198
349 3300009036 Ga0105244_10000036 Ga0105244_10000036146 198
350 3300009036 Ga0105244_10009200 Ga0105244_100092001 198
351 3300009036 Ga0105244_10026309 Ga0105244_100263094 198
352 3300009036 Ga0105244_10052529 Ga0105244_100525293 198
353 3300009036 Ga0105244_10064194 Ga0105244_100641941 198
354 3300009036 Ga0105244_10213880 Ga0105244_102138801 198
355 3300009092 Ga0105250_10000579 Ga0105250_1000057914 198
356 3300009092 Ga0105250_10032876 Ga0105250_100328762 198
357 3300009092 Ga0105250_10155161 Ga0105250_101551611 198
358 3300009148 Ga0105243_10077354 Ga0105243_100773543 198
359 3300009148 Ga0105243_10447188 Ga0105243_104471882 198
360 3300009148 Ga0105243_10843009 Ga0105243_108430091 198
361 3300009545 Ga0105237_10516280 Ga0105237_105162801 198
362 3300013102 Ga0157371_10053031 Ga0157371_100530312 198
363 3300013102 Ga0157371_10435628 Ga0157371_104356282 198
364 3300013102 Ga0157371_10630718 Ga0157371_106307181 198
365 3300013104 Ga0157370_10015464 Ga0157370_100154645 198
366 3300013306 Ga0163162_10775159 Ga0163162_107751592 198
367 3300015679 Ga0183366_1008 Ga0183366_100852 198
368 3300015680 Ga0183370_1008 Ga0183370_100852 198
369 3300015685 Ga0183369_1023 Ga0183369_102352 198
370 3300015687 Ga0183368_1011 Ga0183368_101152 198
371 3300017792 Ga0163161_10085728 Ga0163161_100857284 198
372 3300025321 Ga0207656_10052047 Ga0207656_100520472 198
373 3300025711 Ga0207696_1000252 Ga0207696_100025214 198
374 3300025711 Ga0207696_1011244 Ga0207696_10112443 198
375 3300025711 Ga0207696_1082502 Ga0207696_10825021 198
376 3300025728 Ga0207655_1000099 Ga0207655_100009919 198
377 3300025728 Ga0207655_1000152 Ga0207655_100015244 198
378 3300025728 Ga0207655_1008727 Ga0207655_10087277 198
379 3300025728 Ga0207655_1020594 Ga0207655_10205942 198
380 3300025735 Ga0207713_1000141 Ga0207713_100014141 198
381 3300025735 Ga0207713_1001666 Ga0207713_10016667 198
382 3300025735 Ga0207713_1023739 Ga0207713_10237394 198
383 3300025735 Ga0207713_1033204 Ga0207713_10332041 198
384 3300025735 Ga0207713_1049233 Ga0207713_10492331 198
385 3300025735 Ga0207713_1087998 Ga0207713_10879982 198
386 3300025735 Ga0207713_1123307 Ga0207713_11233071 198
387 3300025914 Ga0207671_10482501 Ga0207671_104825012 198
388 3300025932 Ga0207690_10019251 Ga0207690_100192513 198
389 3300026116 Ga0207674_10000080 Ga0207674_1000008059 198
390 3300027111 Ga0209281_1000176 Ga0209281_100017687 198
391 3300027111 Ga0209281_1000224 Ga0209281_100022440 198
392 3300027111 Ga0209281_1000436 Ga0209281_100043643 198
393 3300027111 Ga0209281_1000466 Ga0209281_100046639 198
394 3300027111 Ga0209281_1000943 Ga0209281_10009434 198
395 3300027111 Ga0209281_1001266 Ga0209281_100126617 198
396 3300027312 Ga0209371_1000071 Ga0209371_1000071125 198
397 3300027312 Ga0209371_1000154 Ga0209371_100015462 198
398 3300027312 Ga0209371_1000162 Ga0209371_100016236 198
399 3300027312 Ga0209371_1002305 Ga0209371_10023056 198
400 3300027312 Ga0209371_1021911 Ga0209371_10219111 198
401 3300028379 Ga0268266_10000199 Ga0268266_1000019963 198
402 3300030500 Ga0268256_1000070 Ga0268256_1000070122 198
403 3300030500 Ga0268256_1000138 Ga0268256_100013859 198
404 3300030500 Ga0268256_1000828 Ga0268256_100082816 198
405 3300030500 Ga0268256_1002047 Ga0268256_10020476 198
406 3300030500 Ga0268256_1007530 Ga0268256_10075304 198
407 3300030500 Ga0268256_1012255 Ga0268256_10122551 198
408 3300030500 Ga0268256_1044122 Ga0268256_10441222 198
409 3300041405 Ga0439438_005091 Ga0439438_005091_3736_4332 198
410 3300041512 Ga0451853_0071507 Ga0451853_0071507_3149_3751 198
411 3300042010 Ga0439452_000176 Ga0439452_000176_40171_40773 198
412 3300042010 Ga0439452_000491 Ga0439452_000491_7149_7751 198
413 3300042439 Ga0439464_0003301 Ga0439464_0003301_3115_3717 198
414 3300044669 Ga0466981_0000018 Ga0466981_0000018_40830_41432 198
415 3300046471 Ga0495650_0000313 Ga0495650_0000313_46594_47196 198
416 3300046513 Ga0495616_0058925 Ga0495616_0058925_1271_1870 198
417 3300046530 Ga0495654_0029769 Ga0495654_0029769_1816_2412 198
418 3300046542 Ga0495597_0003612 Ga0495597_0003612_76_675 198
419 3300046660 Ga0495625_0008852 Ga0495625_0008852_7044_7670 198
420 3300047446 Ga0495679_000170 Ga0495679_000170_19255_19881 198
421 3300047469 Ga0495673_0000299 Ga0495673_0000299_17408_18004 198
422 3300048906 Ga0496103_0243649 Ga0496103_0243649_327_929 198
423 3300048907 Ga0496104_0000089 Ga0496104_0000089_51858_52460 198
424 3300048908 Ga0496105_0030896 Ga0496105_0030896_859_1461 198
425 3300048919 Ga0496116_0006699 Ga0496116_0006699_4270_4872 198
426 3300048919 Ga0496116_0019838 Ga0496116_0019838_2097_2699 198
427 3300048920 Ga0496117_0005802 Ga0496117_0005802_4010_4612 198
428 3300048920 Ga0496117_0026370 Ga0496117_0026370_1233_1835 198
429 3300048920 Ga0496117_0041266 Ga0496117_0041266_29_631 198
430 3300048920 Ga0496117_0430317 Ga0496117_0430317_42_644 198
431 3300048921 Ga0496118_0002377 Ga0496118_0002377_10750_11352 198
432 3300048921 Ga0496118_0220410 Ga0496118_0220410_393_995 198
433 3300048921 Ga0496118_0254132 Ga0496118_0254132_29_631 198
434 3300048921 Ga0496118_0400165 Ga0496118_0400165_83_685 198
435 3300048922 Ga0496119_0021426 Ga0496119_0021426_110_712 198
436 3300048922 Ga0496119_0029418 Ga0496119_0029418_545_1147 198
437 3300048922 Ga0496119_0032620 Ga0496119_0032620_2837_3439 198
438 3300048922 Ga0496119_0150157 Ga0496119_0150157_14_616 198
439 3300048922 Ga0496119_0323939 Ga0496119_0323939_42_644 198
440 3300048923 Ga0496120_0005810 Ga0496120_0005810_2507_3109 198
441 3300048923 Ga0496120_0047956 Ga0496120_0047956_133_735 198
442 3300048924 Ga0496121_0008805 Ga0496121_0008805_4045_4647 198
443 3300048924 Ga0496121_0025199 Ga0496121_0025199_41_643 198
444 3300048924 Ga0496121_0052189 Ga0496121_0052189_196_792 198
445 3300048924 Ga0496121_0100869 Ga0496121_0100869_110_712 198
446 3300048924 Ga0496121_0575869 Ga0496121_0575869_49_651 198
447 3300048925 Ga0496122_0001570 Ga0496122_0001570_7216_7818 198
448 3300048925 Ga0496122_0013173 Ga0496122_0013173_3905_4507 198
449 3300048925 Ga0496122_0074424 Ga0496122_0074424_596_1192 198
450 3300048926 Ga0496123_0002682 Ga0496123_0002682_7216_7818 198
451 3300048926 Ga0496123_0008358 Ga0496123_0008358_5795_6397 198
452 3300048926 Ga0496123_0207974 Ga0496123_0207974_234_830 198
453 3300048927 Ga0496124_0014594 Ga0496124_0014594_2562_3164 198
454 3300048927 Ga0496124_0015545 Ga0496124_0015545_3827_4423 198
455 3300048927 Ga0496124_0088094 Ga0496124_0088094_1582_2178 198
456 3300048927 Ga0496124_0275876 Ga0496124_0275876_480_1082 198
457 3300048927 Ga0496124_0622676 Ga0496124_0622676_54_650 198
458 3300048928 Ga0496125_0000175 Ga0496125_0000175_85392_85988 198
459 3300048928 Ga0496125_0073700 Ga0496125_0073700_131_727 198
460 3300048928 Ga0496125_0108454 Ga0496125_0108454_133_735 198
461 3300048929 Ga0496126_0022222 Ga0496126_0022222_5369_5971 198
462 3300048929 Ga0496126_0143438 Ga0496126_0143438_1255_1857 198
463 3300050491 nmdc:mga00v17_474593_c1 nmdc:mga00v17_474593_c1_116_718 198
464 3300050493 nmdc:mga0k408_40054_c1 nmdc:mga0k408_40054_c1_566_1168 198
465 2010549000 RicEn_C2281 RicEn_41850 199
466 3300002773 JGI25152J39213_1000244 JGI25152J39213_100024424 199
467 3300003856 Ga0058692_1013477 Ga0058692_10134772 199
468 3300003856 Ga0058692_1013787 Ga0058692_10137873 199
469 3300003856 Ga0058692_1046331 Ga0058692_10463311 199
470 3300003856 Ga0058692_1053643 Ga0058692_10536431 199
471 3300005564 Ga0070664_100561499 Ga0070664_1005614992 199
472 3300006946 Ga0079104_1001419 Ga0079104_10014199 199
473 3300009011 Ga0105251_10006274 Ga0105251_100062744 199
474 3300009036 Ga0105244_10000168 Ga0105244_1000016847 199
475 3300013102 Ga0157371_10034358 Ga0157371_100343584 199
476 3300013105 Ga0157369_10000367 Ga0157369_1000036722 199
477 3300013307 Ga0157372_10000088 Ga0157372_1000008859 199
478 3300015261 Ga0182006_1000071 Ga0182006_100007135 199
479 3300025258 Ga0209129_1000173 Ga0209129_100017335 199
480 3300025728 Ga0207655_1000043 Ga0207655_100004357 199
481 3300025735 Ga0207713_1000091 Ga0207713_100009184 199
482 3300025735 Ga0207713_1040457 Ga0207713_10404572 199
483 3300025945 Ga0207679_10455781 Ga0207679_104557812 199
484 3300027111 Ga0209281_1000460 Ga0209281_100046019 199
485 3300027312 Ga0209371_1000143 Ga0209371_100014337 199
486 3300027312 Ga0209371_1000362 Ga0209371_100036218 199
487 3300027312 Ga0209371_1002255 Ga0209371_10022559 199
488 3300027312 Ga0209371_1003254 Ga0209371_10032543 199
489 3300027312 Ga0209371_1003903 Ga0209371_10039032 199
490 3300027312 Ga0209371_1005508 Ga0209371_10055085 199
491 3300030500 Ga0268256_1000113 Ga0268256_100011336 199
492 3300030500 Ga0268256_1000413 Ga0268256_10004134 199
493 3300030500 Ga0268256_1001194 Ga0268256_10011943 199
494 3300030500 Ga0268256_1005431 Ga0268256_10054315 199
495 3300030500 Ga0268256_1005628 Ga0268256_10056281 199
496 3300041405 Ga0439438_033755 Ga0439438_033755_673_1278 199
497 3300042010 Ga0439452_000042 Ga0439452_000042_97173_97778 199
498 3300042010 Ga0439452_000063 Ga0439452_000063_39100_39699 199
499 3300042010 Ga0439452_000601 Ga0439452_000601_12154_12753 199
500 3300042439 Ga0439464_0027777 Ga0439464_0027777_117_716 199
501 3300046458 Ga0495591_013284 Ga0495591_013284_224_823 199
502 3300046460 Ga0495638_0007451 Ga0495638_0007451_6928_7527 199
503 3300046515 Ga0495620_0055821 Ga0495620_0055821_321_920 199
504 3300046694 Ga0495649_0005525 Ga0495649_0005525_135_734 199
505 3300046694 Ga0495649_0007113 Ga0495649_0007113_6060_6659 199
506 3300047446 Ga0495679_000919 Ga0495679_000919_12149_12748 199
507 3300048920 Ga0496117_0008929 Ga0496117_0008929_6557_7156 199
508 3300048921 Ga0496118_0089502 Ga0496118_0089502_197_796 199
509 3300048922 Ga0496119_0000154 Ga0496119_0000154_38980_39579 199
510 3300048923 Ga0496120_0020461 Ga0496120_0020461_2055_2654 199
511 3300048925 Ga0496122_0270429 Ga0496122_0270429_183_782 199
512 3300048927 Ga0496124_0000594 Ga0496124_0000594_25894_26493 199
513 3300048927 Ga0496124_0001177 Ga0496124_0001177_1191_1790 199
514 3300048928 Ga0496125_0028409 Ga0496125_0028409_1797_2396 199
515 3300048929 Ga0496126_0157559 Ga0496126_0157559_1311_1910 199

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07305

DUF1454

Protein of unknown function (DUF1454)

2

188

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5yk5-assembly1.cif.gz_A structure of the human lamtor4-lamtor5 complex 0.695 142 187
4dx9-assembly14.cif.gz_a icap1 in complex with integrin beta 1 cytoplasmic tail 0.6928 159 186
1qsm-assembly1.cif.gz_D histone acetyltransferase hpa2 from saccharomyces cerevisiae in complex with acetyl coenzyme a 0.6919 82 112
7ux2-assembly1.cif.gz_G error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.6807 142 187
5vok-assembly6.cif.gz_H-3 crystal structure of the c7orf59-hbxip dimer 0.6753 142 187
ID Description Score Start End Superfamily
af_K7KMF1_95_188_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8247 76 112 3.40.630.30
af_A0A1D6KE93_390_631_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7925 77 104 3.60.21.10
af_Q5RHK5_4_99_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7783 159 185 2.30.29.30
af_B5BM30_1_361_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.751 159 186 3.50.50.60
af_Q4D2K4_12_131_3.30.450.30 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.7364 143 185 3.30.450.30
ID Description Score Start End GO Terms
AF-H5V433-F1-model_v4 DUF1454 family protein 0.9459 30 199
AF-A0A358L813-F1-model_v4 DUF1454 domain-containing protein 0.9277 80 193
AF-Q9Z6B8-F1-model_v4 DUF1454 family protein 0.9219 43 198
AF-H5V433-F1-model_v4 DUF1454 family protein 0.9195 30 199
AF-Q9Z6B8-F1-model_v4 DUF1454 family protein 0.9161 43 198

Feature Viewer

pLDDT pTM Quality
83.97 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map