F457916

General Info

Members Datasets Scaffolds Average Seq Length
515 285 513 161

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0176340|Ga0501032_0176340_537_1157
Length 188
Sequence MQAPVDILAEVADAAPRAALWFSNTPWWEFMLRGAIMYVFVLFLLRISGKRQVGQLAPFDLVLLLVLSNAVQNAMNGGDNSVVGGIISASTLVALNYAVGFMTFKSKAMEALIEGKPIMLIHNGAVDHRAMNKARMTIHELNAALRAGGCNGAHEVRIAVLENGGNITVIRKNGEGNGAHPPGEPPHG

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
4 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
5 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
6 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
7 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
163 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
164 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
165 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
166 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
167 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
168 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
169 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
170 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
171 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
172 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
173 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
174 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
175 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
176 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
177 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
178 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
179 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
180 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
181 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
182 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
183 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
184 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
185 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
186 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
187 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
188 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
189 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
190 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
191 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
192 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
193 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
194 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
195 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
199 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
200 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
201 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
202 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
203 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
204 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
205 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
206 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
207 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
208 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
209 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
210 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
211 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
212 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
213 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
214 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
215 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
216 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
217 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
218 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
219 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
220 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
221 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
222 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
223 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
224 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
225 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
226 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
227 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
228 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
229 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
230 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
231 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
232 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
233 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
234 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
235 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
236 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
237 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
238 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
239 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
240 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
241 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
242 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
243 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
244 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
245 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
246 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
247 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
248 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
249 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
250 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
251 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
252 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
253 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
254 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
255 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
256 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
257 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
258 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
259 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
260 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
261 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
262 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
263 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
264 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
265 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
266 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
267 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
268 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
269 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
277 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
278 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
279 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
280 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
281 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
282 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
283 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
284 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
285 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0
Isolates 0.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.19
Nodule 0
Rhizoplane 4.27
Rhizosphere 93.2
Stem 0
Stem Tuber 0
Unclassified 2.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_8435162 2162886011 Unclassified 1159
2 MBSR1b_contig_11449826 2162886012 Bacteria 994
3 2214854657 2209111006 Unclassified 611
4 CNXas_1000037 3300000545 Bacteria 28063
5 JGI25405J52794_10029100 3300003911 Bacteria 1142
6 Ga0065716_1007179 3300005277 Unclassified 767
7 Ga0065712_10076611 3300005290 Bacteria 3632
8 Ga0065715_10174240 3300005293 Bacteria 1524
9 Ga0065715_10333635 3300005293 Bacteria 979
10 Ga0070683_100000881 3300005329 Bacteria 22260
11 Ga0070683_101259483 3300005329 Bacteria 711
12 Ga0070690_100176937 3300005330 Unclassified 1472
13 Ga0070690_100453777 3300005330 Unclassified 951
14 Ga0070670_100000026 3300005331 Bacteria 187946
15 Ga0070670_100047373 3300005331 Bacteria 3699
16 Ga0070666_10025057 3300005335 Bacteria 3887
17 Ga0070666_10046676 3300005335 Bacteria 2906
18 Ga0070666_10158951 3300005335 Bacteria 1579
19 Ga0070666_10162900 3300005335 Bacteria 1559
20 Ga0070680_100131625 3300005336 Bacteria 2093
21 Ga0070680_100748999 3300005336 Bacteria 841
22 Ga0070682_100576893 3300005337 Bacteria 884
23 Ga0070660_100948812 3300005339 Bacteria 726
24 Ga0070689_100064550 3300005340 Bacteria 2850
25 Ga0070691_10073901 3300005341 Bacteria 1658
26 Ga0070691_10644492 3300005341 Bacteria 630
27 Ga0070687_100420570 3300005343 Bacteria 881
28 Ga0070661_100010450 3300005344 Bacteria 6457
29 Ga0070661_100210472 3300005344 Bacteria 1488
30 Ga0070661_100236499 3300005344 Bacteria 1405
31 Ga0070661_100306042 3300005344 Bacteria 1238
32 Ga0070661_100473967 3300005344 Bacteria 999
33 Ga0070661_100931001 3300005344 Unclassified 718
34 Ga0070668_100056398 3300005347 Bacteria 3034
35 Ga0070669_100004728 3300005353 Bacteria 9815
36 Ga0070675_100090133 3300005354 Bacteria 2568
37 Ga0070675_101235292 3300005354 Unclassified 688
38 Ga0070671_100000058 3300005355 Bacteria 74538
39 Ga0070671_100097825 3300005355 Bacteria 2461
40 Ga0070671_100169212 3300005355 Bacteria 1848
41 Ga0070671_100541025 3300005355 Bacteria 1004
42 Ga0070671_100550163 3300005355 Bacteria 995
43 Ga0070674_100001939 3300005356 Bacteria 11297
44 Ga0070674_101757172 3300005356 Bacteria 562
45 Ga0070673_100305364 3300005364 Unclassified 1402
46 Ga0070673_100481611 3300005364 Bacteria 1120
47 Ga0070673_101109773 3300005364 Bacteria 739
48 Ga0070673_102008393 3300005364 Bacteria 549
49 Ga0070688_100010523 3300005365 Bacteria 5105
50 Ga0070688_100174747 3300005365 Bacteria 1485
51 Ga0070659_100069552 3300005366 Bacteria 2795
52 Ga0070659_100108229 3300005366 Bacteria 2242
53 Ga0070667_100000002 3300005367 Bacteria 504831
54 Ga0070667_101514810 3300005367 Bacteria 630
55 Ga0070709_10000056 3300005434 Bacteria 88178
56 Ga0070709_10669565 3300005434 Bacteria 805
57 Ga0070714_101259465 3300005435 Bacteria 722
58 Ga0070713_100999027 3300005436 Bacteria 807
59 Ga0070711_100005129 3300005439 Bacteria 7805
60 Ga0070711_100153397 3300005439 Bacteria 1739
61 Ga0070711_100417655 3300005439 Bacteria 1092
62 Ga0070705_101145821 3300005440 Bacteria 638
63 Ga0070694_100009786 3300005444 Bacteria 5889
64 Ga0070708_101135205 3300005445 Unclassified 732
65 Ga0070663_100298732 3300005455 Bacteria 1288
66 Ga0070663_100729951 3300005455 Bacteria 844
67 Ga0070678_100224724 3300005456 Unclassified 1562
68 Ga0070678_100446334 3300005456 Unclassified 1132
69 Ga0070662_100399290 3300005457 Unclassified 1134
70 Ga0070681_10136841 3300005458 Bacteria 2380
71 Ga0070681_10944621 3300005458 Unclassified 781
72 Ga0068867_100238307 3300005459 Bacteria 1474
73 Ga0070685_10000009 3300005466 Bacteria 166260
74 Ga0070685_10437387 3300005466 Unclassified 913
75 Ga0070707_100011021 3300005468 Bacteria 8420
76 Ga0070707_100122143 3300005468 Bacteria 2529
77 Ga0070698_100255917 3300005471 Bacteria 1683
78 Ga0070698_100296124 3300005471 Bacteria 1549
79 Ga0070698_101697618 3300005471 Bacteria 584
80 Ga0070679_100533363 3300005530 Bacteria 1118
81 Ga0070679_101768547 3300005530 Bacteria 566
82 Ga0070684_100008961 3300005535 Bacteria 7859
83 Ga0070684_100999873 3300005535 Bacteria 785
84 Ga0068853_100000457 3300005539 Bacteria 27851
85 Ga0068853_100012540 3300005539 Bacteria 6897
86 Ga0068853_100194985 3300005539 Bacteria 1841
87 Ga0068853_101094713 3300005539 Unclassified 768
88 Ga0068853_101358693 3300005539 Unclassified 687
89 Ga0070672_100008753 3300005543 Bacteria 6947
90 Ga0070686_100000232 3300005544 Bacteria 38298
91 Ga0070686_100531925 3300005544 Bacteria 917
92 Ga0070686_100705650 3300005544 Bacteria 805
93 Ga0070686_101803499 3300005544 Bacteria 521
94 Ga0070695_100097051 3300005545 Bacteria 1978
95 Ga0070696_100503112 3300005546 Bacteria 964
96 Ga0070696_100568998 3300005546 Bacteria 910
97 Ga0070696_100750991 3300005546 Bacteria 799
98 Ga0070693_100024109 3300005547 Bacteria 3259
99 Ga0070693_100024916 3300005547 Bacteria 3214
100 Ga0070693_100248882 3300005547 Bacteria 1177
101 Ga0070665_100060745 3300005548 Bacteria 3788
102 Ga0070665_100156646 3300005548 Bacteria 2279
103 Ga0070665_100991548 3300005548 Unclassified 852
104 Ga0070665_101045293 3300005548 Bacteria 829
105 Ga0068855_100131281 3300005563 Bacteria 2861
106 Ga0070664_100000363 3300005564 Bacteria 33478
107 Ga0068854_100463455 3300005578 Bacteria 1061
108 Ga0068852_100097332 3300005616 Bacteria 2647
109 Ga0068852_100186633 3300005616 Bacteria 1953
110 Ga0068852_100432971 3300005616 Bacteria 1299
111 Ga0068852_101792469 3300005616 Unclassified 636
112 Ga0068859_100121223 3300005617 Bacteria 2681
113 Ga0068859_100515713 3300005617 Bacteria 1290
114 Ga0068864_100000002 3300005618 Bacteria 658857
115 Ga0068864_100068432 3300005618 Bacteria 3085
116 Ga0068864_100103898 3300005618 Bacteria 2523
117 Ga0068864_100150734 3300005618 Bacteria 2106
118 Ga0068866_10222138 3300005718 Bacteria 1140
119 Ga0068861_100594968 3300005719 Bacteria 1014
120 Ga0068863_100521402 3300005841 Bacteria 1172
121 Ga0068863_100801451 3300005841 Bacteria 939
122 Ga0068863_100872866 3300005841 Unclassified 899
123 Ga0068863_102184775 3300005841 Unclassified 563
124 Ga0068858_100081864 3300005842 Bacteria 3000
125 Ga0068858_100431444 3300005842 Unclassified 1268
126 Ga0068860_100000684 3300005843 Bacteria 39188
127 Ga0068860_100001664 3300005843 Bacteria 23774
128 Ga0068860_100632445 3300005843 Bacteria 1077
129 Ga0068860_100679213 3300005843 Bacteria 1039
130 Ga0068862_100000541 3300005844 Bacteria 39542
131 Ga0068862_101435289 3300005844 Bacteria 694
132 Ga0081455_10001646 3300005937 Bacteria 27149
133 Ga0081540_1000363 3300005983 Bacteria 45608
134 Ga0081539_10105332 3300005985 Bacteria 1430
135 Ga0070717_10031644 3300006028 Bacteria 4258
136 Ga0075364_10821667 3300006051 Unclassified 633
137 Ga0075432_10085433 3300006058 Bacteria 1149
138 Ga0070715_10020210 3300006163 Bacteria 2565
139 Ga0070716_100215448 3300006173 Bacteria 1286
140 Ga0070712_100086783 3300006175 Bacteria 2281
141 Ga0070712_100557298 3300006175 Unclassified 966
142 Ga0097621_100729021 3300006237 Bacteria 914
143 Ga0068871_100178836 3300006358 Bacteria 1822
144 Ga0068871_100603563 3300006358 Bacteria 998
145 Ga0068871_101117718 3300006358 Bacteria 737
146 Ga0068871_101380952 3300006358 Bacteria 664
147 Ga0075428_100125343 3300006844 Plasmid 2795
148 Ga0075433_10001298 3300006852 Bacteria 18276
149 Ga0075433_10452990 3300006852 Bacteria 1131
150 Ga0075433_10612519 3300006852 Bacteria 956
151 Ga0075433_11042721 3300006852 Bacteria 712
152 Ga0075434_100000948 3300006871 Bacteria 23348
153 Ga0075434_100053356 3300006871 Bacteria 4017
154 Ga0075434_100129365 3300006871 Bacteria 2543
155 Ga0075434_100148997 3300006871 Bacteria 2360
156 Ga0075434_101918583 3300006871 Unclassified 598
157 Ga0068865_101462429 3300006881 Unclassified 611
158 Ga0075436_100640251 3300006914 Unclassified 785
159 Ga0097620_100121230 3300006931 Bacteria 2681
160 Ga0097620_100515679 3300006931 Bacteria 1290
161 Ga0097620_101266204 3300006931 Bacteria 813
162 Ga0075435_100148435 3300007076 Bacteria 1970
163 Ga0105240_10175793 3300009093 Bacteria 2531
164 Ga0105240_10230639 3300009093 Bacteria 2152
165 Ga0105240_10475691 3300009093 Unclassified 1393
166 Ga0111539_10014638 3300009094 Bacteria 9787
167 Ga0111539_10031954 3300009094 Bacteria 6395
168 Ga0111539_10976255 3300009094 Unclassified 985
169 Ga0105245_10062299 3300009098 Bacteria 3365
170 Ga0105247_10003659 3300009101 Bacteria 9980
171 Ga0105247_10013464 3300009101 Bacteria 4906
172 Ga0105247_10198348 3300009101 Bacteria 1347
173 Ga0114129_10151298 3300009147 Bacteria 3176
174 Ga0114129_10488818 3300009147 Bacteria 1609
175 Ga0105243_10290306 3300009148 Bacteria 1477
176 Ga0105243_10759716 3300009148 Bacteria 951
177 Ga0105242_10062322 3300009176 Bacteria 3068
178 Ga0105242_10169686 3300009176 Bacteria 1916
179 Ga0105242_12353962 3300009176 Bacteria 579
180 Ga0105248_10029546 3300009177 Bacteria 6114
181 Ga0105248_10038798 3300009177 Bacteria 5332
182 Ga0105248_10071253 3300009177 Bacteria 3904
183 Ga0105248_10082001 3300009177 Bacteria 3626
184 Ga0105248_10620660 3300009177 Bacteria 1220
185 Ga0105248_10909787 3300009177 Bacteria 993
186 Ga0105248_11259550 3300009177 Bacteria 836
187 Ga0105237_10032082 3300009545 Bacteria 5319
188 Ga0105238_10000161 3300009551 Bacteria 73229
189 Ga0105238_10023731 3300009551 Bacteria 6251
190 Ga0105238_11762237 3300009551 Unclassified 651
191 Ga0105249_10043221 3300009553 Bacteria 4099
192 Ga0105249_10350894 3300009553 Unclassified 1495
193 Ga0105249_10420435 3300009553 Unclassified 1370
194 Ga0105249_10481431 3300009553 Bacteria 1284
195 Ga0105249_10699691 3300009553 Bacteria 1073
196 Ga0105249_12315356 3300009553 Bacteria 610
197 Ga0105239_10795038 3300010375 Unclassified 1084
198 Ga0105246_10727834 3300011119 Unclassified 872
199 Ga0157370_10065619 3300013104 Bacteria 3434
200 Ga0157370_10427067 3300013104 Bacteria 1219
201 Ga0157369_10293694 3300013105 Unclassified 1692
202 Ga0157369_10805790 3300013105 Bacteria 965
203 Ga0157374_10000888 3300013296 Bacteria 26115
204 Ga0157378_10147039 3300013297 Bacteria 2193
205 Ga0157378_11137422 3300013297 Unclassified 819
206 Ga0157378_12546827 3300013297 Bacteria 564
207 Ga0163162_10150958 3300013306 Bacteria 2441
208 Ga0163162_10540607 3300013306 Bacteria 1294
209 Ga0163162_11019051 3300013306 Unclassified 936
210 Ga0157372_10415924 3300013307 Bacteria 1567
211 Ga0157372_10678771 3300013307 Unclassified 1199
212 Ga0157372_10919161 3300013307 Bacteria 1015
213 Ga0157372_12474625 3300013307 Bacteria 596
214 Ga0163163_10000003 3300014325 Bacteria 455102
215 Ga0163163_10000081 3300014325 Bacteria 104678
216 Ga0163163_10007770 3300014325 Bacteria 9478
217 Ga0163163_10008376 3300014325 Bacteria 9184
218 Ga0163163_10033265 3300014325 Bacteria 4986
219 Ga0163163_11690650 3300014325 Bacteria 694
220 Ga0157380_11124029 3300014326 Unclassified 826
221 Ga0157379_10094281 3300014968 Bacteria 2686
222 Ga0157379_10174568 3300014968 Bacteria 1940
223 Ga0157379_10518208 3300014968 Bacteria 1106
224 Ga0157379_10538086 3300014968 Bacteria 1086
225 Ga0157379_10830432 3300014968 Bacteria 873
226 Ga0157379_10972236 3300014968 Bacteria 808
227 Ga0157376_10134072 3300014969 Bacteria 2214
228 Ga0157376_11261293 3300014969 Bacteria 768
229 Ga0163161_10576206 3300017792 Unclassified 925
230 Ga0207697_10019712 3300025315 Bacteria 2763
231 Ga0207710_10005992 3300025900 Bacteria 5211
232 Ga0207680_10064014 3300025903 Bacteria 2253
233 Ga0207680_10103267 3300025903 Bacteria 1835
234 Ga0207680_10990312 3300025903 Unclassified 602
235 Ga0207685_10079084 3300025905 Bacteria 1355
236 Ga0207685_10473367 3300025905 Bacteria 655
237 Ga0207699_10000062 3300025906 Bacteria 88201
238 Ga0207699_10436612 3300025906 Bacteria 937
239 Ga0207705_10029387 3300025909 Bacteria 3918
240 Ga0207654_10060682 3300025911 Bacteria 2210
241 Ga0207707_10631494 3300025912 Unclassified 904
242 Ga0207695_10069848 3300025913 Bacteria 3593
243 Ga0207695_10287852 3300025913 Unclassified 1536
244 Ga0207671_10163214 3300025914 Unclassified 1726
245 Ga0207693_10062973 3300025915 Bacteria 2906
246 Ga0207663_10014529 3300025916 Unclassified 4314
247 Ga0207663_10876259 3300025916 Bacteria 717
248 Ga0207660_10222626 3300025917 Bacteria 1481
249 Ga0207662_10043784 3300025918 Bacteria 2641
250 Ga0207657_10851144 3300025919 Unclassified 704
251 Ga0207657_11007231 3300025919 Bacteria 639
252 Ga0207649_10008173 3300025920 Bacteria 5696
253 Ga0207649_10268631 3300025920 Unclassified 1235
254 Ga0207649_10414283 3300025920 Bacteria 1011
255 Ga0207649_10775951 3300025920 Unclassified 747
256 Ga0207652_10592315 3300025921 Bacteria 995
257 Ga0207646_10084033 3300025922 Bacteria 2848
258 Ga0207681_10005488 3300025923 Bacteria 7789
259 Ga0207694_10015481 3300025924 Bacteria 5751
260 Ga0207694_10143281 3300025924 Bacteria 1922
261 Ga0207650_10000002 3300025925 Bacteria 1439222
262 Ga0207650_10013674 3300025925 Bacteria 5626
263 Ga0207659_10929536 3300025926 Unclassified 748
264 Ga0207659_11358019 3300025926 Unclassified 610
265 Ga0207687_10243622 3300025927 Bacteria 1426
266 Ga0207700_10192506 3300025928 Bacteria 1714
267 Ga0207700_10338597 3300025928 Bacteria 1307
268 Ga0207700_11053170 3300025928 Bacteria 728
269 Ga0207644_10000020 3300025931 Bacteria 165455
270 Ga0207644_10073326 3300025931 Bacteria 2510
271 Ga0207644_10274520 3300025931 Bacteria 1352
272 Ga0207644_10575225 3300025931 Bacteria 934
273 Ga0207690_10025060 3300025932 Bacteria 3742
274 Ga0207706_10340653 3300025933 Bacteria 1304
275 Ga0207686_10055975 3300025934 Bacteria 2477
276 Ga0207686_10142927 3300025934 Bacteria 1656
277 Ga0207670_10026542 3300025936 Bacteria 3651
278 Ga0207669_10008297 3300025937 Bacteria 4867
279 Ga0207665_10014070 3300025939 Bacteria 5264
280 Ga0207665_10137922 3300025939 Bacteria 1737
281 Ga0207691_10084208 3300025940 Bacteria 2855
282 Ga0207711_10000619 3300025941 Bacteria 35743
283 Ga0207711_10028554 3300025941 Bacteria 4696
284 Ga0207711_10041408 3300025941 Bacteria 3923
285 Ga0207711_10128794 3300025941 Bacteria 2267
286 Ga0207711_10183707 3300025941 Bacteria 1903
287 Ga0207711_10968651 3300025941 Bacteria 790
288 Ga0207711_11048836 3300025941 Unclassified 755
289 Ga0207661_10009199 3300025944 Bacteria 7079
290 Ga0207661_10236316 3300025944 Bacteria 1620
291 Ga0207679_10003025 3300025945 Bacteria 10416
292 Ga0207679_10043863 3300025945 Bacteria 3223
293 Ga0207667_10442550 3300025949 Bacteria 1321
294 Ga0207651_10245926 3300025960 Bacteria 1461
295 Ga0207651_10839612 3300025960 Bacteria 816
296 Ga0207651_11048596 3300025960 Bacteria 730
297 Ga0207712_10116943 3300025961 Bacteria 2010
298 Ga0207712_10269881 3300025961 Unclassified 1383
299 Ga0207712_10529258 3300025961 Unclassified 1011
300 Ga0207668_10076364 3300025972 Bacteria 2412
301 Ga0207640_11396271 3300025981 Bacteria 627
302 Ga0207658_10000001 3300025986 Bacteria 1439333
303 Ga0207703_10099349 3300026035 Bacteria 2463
304 Ga0207703_10760182 3300026035 Unclassified 924
305 Ga0207639_10000006 3300026041 Bacteria 544415
306 Ga0207639_10137304 3300026041 Unclassified 2033
307 Ga0207639_10219628 3300026041 Bacteria 1641
308 Ga0207639_10577002 3300026041 Unclassified 1035
309 Ga0207639_11135068 3300026041 Unclassified 733
310 Ga0207678_10155701 3300026067 Bacteria 1951
311 Ga0207678_10269587 3300026067 Bacteria 1460
312 Ga0207678_10563403 3300026067 Bacteria 997
313 Ga0207702_11856228 3300026078 Bacteria 594
314 Ga0207641_10055145 3300026088 Bacteria 3374
315 Ga0207676_10000001 3300026095 Bacteria 1439222
316 Ga0207676_10072258 3300026095 Bacteria 2773
317 Ga0207676_10301472 3300026095 Bacteria 1463
318 Ga0207683_10347576 3300026121 Unclassified 1361
319 Ga0207683_11199374 3300026121 Bacteria 703
320 Ga0207698_10275609 3300026142 Unclassified 1553
321 Ga0207698_10479832 3300026142 Bacteria 1206
322 Ga0207428_10052652 3300027907 Bacteria 3250
323 Ga0207428_10587793 3300027907 Unclassified 803
324 Ga0268266_10014651 3300028379 Bacteria 6737
325 Ga0268266_10216891 3300028379 Bacteria 1757
326 Ga0268266_10461761 3300028379 Bacteria 1208
327 Ga0268266_11148273 3300028379 Unclassified 751
328 Ga0268265_10000258 3300028380 Bacteria 60430
329 Ga0268264_10000004 3300028381 Bacteria 1116842
330 Ga0268264_10929234 3300028381 Bacteria 874
331 Ga0268264_11517571 3300028381 Unclassified 681
332 Ga0265319_1080419 3300028563 Bacteria 1035
333 Ga0265318_10000004 3300028577 Bacteria 319325
334 Ga0265318_10031832 3300028577 Unclassified 2043
335 Ga0265318_10081903 3300028577 Bacteria 1192
336 Ga0265318_10294520 3300028577 Bacteria 592
337 Ga0265323_10008972 3300028653 Bacteria 4105
338 Ga0265322_10062869 3300028654 Unclassified 1053
339 Ga0265338_10002888 3300028800 Bacteria 25044
340 Ga0265338_10037276 3300028800 Bacteria 4633
341 Ga0265338_10302792 3300028800 Bacteria 1161
342 Ga0265324_10007272 3300029957 Bacteria 4511
343 Ga0265324_10008528 3300029957 Bacteria 4068
344 Ga0265320_10023350 3300031240 Bacteria 3293
345 Ga0265320_10060374 3300031240 Bacteria 1811
346 Ga0265325_10181756 3300031241 Bacteria 979
347 Ga0265331_10006766 3300031250 Bacteria 6719
348 Ga0265316_10016479 3300031344 Bacteria 6407
349 Ga0265316_10104024 3300031344 Bacteria 2155
350 Ga0265316_10227217 3300031344 Bacteria 1375
351 Ga0265316_10270165 3300031344 Bacteria 1244
352 Ga0265313_10007882 3300031595 Bacteria 7177
353 Ga0307508_10023041 3300031616 Bacteria 5657
354 Ga0265314_10006333 3300031711 Bacteria 10498
355 Ga0265314_10015744 3300031711 Bacteria 5991
356 Ga0265342_10409978 3300031712 Bacteria 699
357 Ga0373958_0006144 3300034819 Unclassified 1858
358 Ga0373959_0020684 3300034820 Unclassified 1257
359 Ga0373938_0003364 3300034957 Bacteria 2618
360 Ga0373928_0100657 3300035084 Unclassified 753
361 Ga0373929_0065248 3300035085 Unclassified 860
362 Ga0373940_0220531 3300035088 Bacteria 630
363 Ga0373940_0243620 3300035088 Bacteria 604
364 Ga0373951_0014747 3300035091 Bacteria 1758
365 Ga0373932_0000554 3300035112 Bacteria 11458
366 Ga0373932_0066575 3300035112 Unclassified 1107
367 Ga0373939_0000572 3300035114 Bacteria 9204
368 Ga0373941_0083955 3300035115 Bacteria 1081
369 Ga0373954_0193016 3300035118 Bacteria 1000
370 Ga0373956_0330280 3300035119 Unclassified 727
371 Ga0373960_0078435 3300035121 Unclassified 1035
372 Ga0373960_0110174 3300035121 Bacteria 902
373 Ga0373960_0157502 3300035121 Unclassified 780
374 Ga0373955_0218355 3300035172 Unclassified 1138
375 Ga0373961_0010295 3300035241 Bacteria 2303
376 Ga0373961_0088558 3300035241 Bacteria 985
377 Ga0373931_0267442 3300035691 Bacteria 1045
378 Ga0373935_0001058 3300035692 Bacteria 14994
379 Ga0373927_0240296 3300035695 Bacteria 1190
380 Ga0373933_0271122 3300035724 Unclassified 1095
381 Ga0373937_0027491 3300036401 Bacteria 5144
382 Ga0373937_0098018 3300036401 Bacteria 2719
383 Ga0373937_0102235 3300036401 Bacteria 2661
384 Ga0373937_0505954 3300036401 Bacteria 1148
385 Ga0373925_0906436 3300037068 Unclassified 726
386 Ga0373925_1248872 3300037068 Unclassified 610
387 Ga0395900_1170885 3300037418 Bacteria 685
388 Ga0395905_0333753 3300037471 Unclassified 1407
389 Ga0242420_021659 3300038996 Bacteria 1152
390 Ga0451793_1570102 3300041452 Bacteria 781
391 Ga0451800_1414222 3300041459 Unclassified 605
392 Ga0451839_0800656 3300041496 Unclassified 616
393 Ga0451853_3698162 3300041512 Bacteria 836
394 Ga0466972_0004392 3300044658 Bacteria 7049
395 Ga0453683_0499802 3300044673 Bacteria 789
396 Ga0466965_0000219 3300044683 Bacteria 18114
397 Ga0466963_0102940 3300044694 Bacteria 1956
398 Ga0466964_0027920 3300044706 Bacteria 2219
399 Ga0453684_0742823 3300044712 Bacteria 1063
400 Ga0466968_0004840 3300044735 Bacteria 5039
401 Ga0466968_0026704 3300044735 Bacteria 2371
402 Ga0451576_0018178 3300045051 Bacteria 7711
403 Ga0451576_0247060 3300045051 Unclassified 1865
404 Ga0466967_0479417 3300045976 Bacteria 1219
405 Ga0495592_0017853 3300046454 Bacteria 5393
406 Ga0495592_0242154 3300046454 Bacteria 1196
407 Ga0495603_0031650 3300046455 Bacteria 3185
408 Ga0495629_0632222 3300046459 Bacteria 714
409 Ga0495641_0022124 3300046461 Bacteria 3186
410 Ga0495651_0195024 3300046462 Bacteria 1422
411 Ga0495653_0224458 3300046463 Bacteria 1261
412 Ga0495580_0014743 3300046472 Bacteria 5924
413 Ga0495639_0005859 3300046475 Bacteria 5283
414 Ga0495662_0012045 3300046476 Bacteria 4226
415 Ga0495664_0019469 3300046477 Bacteria 3902
416 Ga0495594_0003568 3300046499 Bacteria 8003
417 Ga0495608_0689722 3300046511 Unclassified 608
418 Ga0495618_0025281 3300046514 Bacteria 3684
419 Ga0495628_0271177 3300046516 Bacteria 1262
420 Ga0495630_0004043 3300046517 Bacteria 10266
421 Ga0495630_0402386 3300046517 Bacteria 1049
422 Ga0495663_0200630 3300046525 Bacteria 696
423 Ga0495666_0000862 3300046526 Bacteria 14127
424 Ga0495652_0177384 3300046529 Bacteria 1639
425 Ga0495652_0629376 3300046529 Bacteria 729
426 Ga0495652_0662379 3300046529 Unclassified 706
427 Ga0495665_0146044 3300046531 Bacteria 1235
428 Ga0495640_0068815 3300046533 Bacteria 2381
429 Ga0495586_0162046 3300046535 Bacteria 1262
430 Ga0495645_0084367 3300046543 Bacteria 2275
431 Ga0495633_0002630 3300046558 Bacteria 12550
432 Ga0495667_0102817 3300046559 Unclassified 1848
433 Ga0495656_0464165 3300046615 Bacteria 668
434 Ga0495634_0010840 3300046642 Bacteria 6664
435 Ga0495635_0287921 3300046663 Bacteria 1103
436 Ga0495659_0297138 3300046664 Bacteria 682
437 Ga0495647_0010674 3300046681 Bacteria 3131
438 Ga0495647_0386583 3300046681 Unclassified 641
439 Ga0495658_0003363 3300046683 Bacteria 7927
440 Ga0495658_0067894 3300046683 Bacteria 2063
441 Ga0495658_0456226 3300046683 Bacteria 817
442 Ga0495658_0506917 3300046683 Bacteria 772
443 Ga0495613_0177909 3300046689 Unclassified 1507
444 Ga0495604_0570696 3300047317 Bacteria 728
445 Ga0495636_0017934 3300047318 Bacteria 2837
446 Ga0495636_0150621 3300047318 Bacteria 1044
447 Ga0495674_0008071 3300047319 Bacteria 10050
448 Ga0495676_0075930 3300047321 Bacteria 2568
449 Ga0495680_0004092 3300047322 Bacteria 14049
450 Ga0495680_0177799 3300047322 Bacteria 1538
451 Ga0495680_0694307 3300047322 Unclassified 673
452 Ga0495680_0834367 3300047322 Unclassified 600
453 Ga0495675_0152871 3300047444 Bacteria 1425
454 Ga0495684_0116149 3300047471 Unclassified 2017
455 Ga0495684_0201480 3300047471 Unclassified 1467
456 Ga0496101_0418704 3300048904 Bacteria 1056
457 Ga0496101_0665188 3300048904 Bacteria 823
458 Ga0496103_0170410 3300048906 Bacteria 1398
459 Ga0496104_0001375 3300048907 Bacteria 21046
460 Ga0496105_0037210 3300048908 Bacteria 4008
461 Ga0496107_0098377 3300048910 Bacteria 2143
462 Ga0496108_0004677 3300048911 Bacteria 11037
463 Ga0496109_0000528 3300048912 Bacteria 32391
464 Ga0496110_0000489 3300048913 Bacteria 26927
465 Ga0496110_0003072 3300048913 Bacteria 12655
466 Ga0496110_0107182 3300048913 Bacteria 2508
467 Ga0496110_0600856 3300048913 Bacteria 998
468 Ga0496111_0605254 3300048914 Unclassified 802
469 Ga0496112_0001610 3300048915 Bacteria 17454
470 Ga0496112_0097427 3300048915 Bacteria 2912
471 Ga0496114_0236467 3300048917 Bacteria 1606
472 Ga0496114_0471502 3300048917 Bacteria 1111
473 Ga0496114_1184592 3300048917 Bacteria 650
474 Ga0496115_0176577 3300048918 Bacteria 1766
475 Ga0496115_0303179 3300048918 Unclassified 1309
476 Ga0496118_0355947 3300048921 Viruses 778
477 Ga0496121_0135577 3300048924 Bacteria 1835
478 Ga0496123_0042515 3300048926 Bacteria 3135
479 Ga0496124_0000003 3300048927 Bacteria 1300161
480 Ga0496124_0132640 3300048927 Bacteria 1977
481 Ga0496125_0046998 3300048928 Bacteria 3615
482 Ga0496125_0084509 3300048928 Bacteria 2410
483 Ga0496126_0039148 3300048929 Bacteria 4402
484 Ga0496126_0237026 3300048929 Bacteria 1526
485 Ga0501032_0176340 3300049569 Bacteria 1400
486 Ga0501033_0019858 3300049570 Bacteria 5078
487 Ga0501034_0001235 3300049571 Bacteria 34757
488 Ga0501034_0937593 3300049571 Bacteria 752
489 Ga0501036_0072178 3300049572 Bacteria 2918
490 Ga0501037_0008455 3300049573 Bacteria 7548
491 Ga0501038_0000764 3300049574 Bacteria 28572
492 Ga0501047_0439963 3300049581 Bacteria 1134
493 Ga0501080_0633034 3300049742 Bacteria 947
494 Ga0501035_0361344 3300049822 Bacteria 1213
495 nmdc:mga05p37_418847_c1 3300050507 Bacteria 1559
496 nmdc:mga05p37_60063_c1 3300050507 Bacteria 4681
497 nmdc:mga08y16_1330731_c1 3300050511 Unclassified 684
498 nmdc:mga08y16_30123_c1 3300050511 Bacteria 5713
499 nmdc:mga08y16_458592_c1 3300050511 Bacteria 1299
500 nmdc:mga0n895_15223_c1 3300050512 Bacteria 7009
501 nmdc:mga0n895_1922_c1 3300050512 Bacteria 15921
502 nmdc:mga0n895_264052_c1 3300050512 Bacteria 1747
503 nmdc:mga0n895_312741_c1 3300050512 Bacteria 1592
504 nmdc:mga0n895_505173_c1 3300050512 Bacteria 1218
505 nmdc:mga0rr50_409067_c1 3300050513 Bacteria 1147
506 nmdc:mga0rr50_543778_c1 3300050513 Bacteria 989
507 nmdc:mga0a205_234257_c1 3300050515 Bacteria 1718
508 nmdc:mga0a205_7966_c1 3300050515 Bacteria 9625
509 Ga0495601_0061960 3300053077 Bacteria 2375
510 Ga0495601_0360861 3300053077 Unclassified 944
511 Ga0495595_0208841 3300053084 Unclassified 973
512 Ga0495595_0497361 3300053084 Unclassified 621
513 Ga0501082_0871930 3300060353 Unclassified 787

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044673 Ga0453683_0499802 Ga0453683_0499802_147_707 137
2 3300031712 Ga0265342_10409978 Ga0265342_104099781 141
3 3300036401 Ga0373937_0505954 Ga0373937_0505954_601_1101 150
4 3300047322 Ga0495680_0694307 Ga0495680_0694307_146_646 150
5 3300005435 Ga0070714_101259465 Ga0070714_1012594651 152
6 3300005445 Ga0070708_101135205 Ga0070708_1011352051 152
7 3300028577 Ga0265318_10294520 Ga0265318_102945201 152
8 3300035112 Ga0373932_0000554 Ga0373932_0000554_5758_6294 152
9 3300034820 Ga0373959_0020684 Ga0373959_0020684_342_803 153
10 3300034957 Ga0373938_0003364 Ga0373938_0003364_797_1258 153
11 3300035084 Ga0373928_0100657 Ga0373928_0100657_158_619 153
12 3300035085 Ga0373929_0065248 Ga0373929_0065248_263_724 153
13 3300035112 Ga0373932_0066575 Ga0373932_0066575_443_904 153
14 3300035121 Ga0373960_0078435 Ga0373960_0078435_466_927 153
15 3300035241 Ga0373961_0010295 Ga0373961_0010295_740_1201 153
16 3300048913 Ga0496110_0000489 Ga0496110_0000489_15182_15643 153
17 3300048918 Ga0496115_0303179 Ga0496115_0303179_470_931 153
18 3300048927 Ga0496124_0000003 Ga0496124_0000003_378078_378539 153
19 3300050511 nmdc:mga08y16_1330731_c1 nmdc:mga08y16_1330731_c1_60_521 153
20 3300005436 Ga0070713_100999027 Ga0070713_1009990271 154
21 3300005439 Ga0070711_100005129 Ga0070711_1000051293 154
22 3300005548 Ga0070665_101045293 Ga0070665_1010452932 154
23 3300005618 Ga0068864_100150734 Ga0068864_1001507344 154
24 3300005843 Ga0068860_100001664 Ga0068860_10000166421 154
25 3300006175 Ga0070712_100086783 Ga0070712_1000867832 154
26 3300013306 Ga0163162_10150958 Ga0163162_101509582 154
27 3300025915 Ga0207693_10062973 Ga0207693_100629732 154
28 3300025916 Ga0207663_10014529 Ga0207663_100145294 154
29 3300025928 Ga0207700_11053170 Ga0207700_110531702 154
30 iso_pu_bacteria 2932422444 2932426282 154
31 iso_pu_bacteria 2939631187 2939635295 154
32 3300000545 CNXas_1000037 CNXas_100003712 155
33 3300005330 Ga0070690_100453777 Ga0070690_1004537771 155
34 3300005344 Ga0070661_100931001 Ga0070661_1009310011 155
35 3300005355 Ga0070671_100541025 Ga0070671_1005410251 155
36 3300005355 Ga0070671_100550163 Ga0070671_1005501631 155
37 3300005364 Ga0070673_101109773 Ga0070673_1011097731 155
38 3300005468 Ga0070707_100011021 Ga0070707_1000110215 155
39 3300005468 Ga0070707_100122143 Ga0070707_1001221433 155
40 3300005471 Ga0070698_100296124 Ga0070698_1002961242 155
41 3300005530 Ga0070679_101768547 Ga0070679_1017685471 155
42 3300005544 Ga0070686_101803499 Ga0070686_1018034991 155
43 3300005546 Ga0070696_100503112 Ga0070696_1005031122 155
44 3300005546 Ga0070696_100568998 Ga0070696_1005689982 155
45 3300005618 Ga0068864_100103898 Ga0068864_1001038982 155
46 3300005841 Ga0068863_100521402 Ga0068863_1005214022 155
47 3300005841 Ga0068863_100801451 Ga0068863_1008014511 155
48 3300005841 Ga0068863_102184775 Ga0068863_1021847751 155
49 3300005842 Ga0068858_100431444 Ga0068858_1004314442 155
50 3300006358 Ga0068871_100178836 Ga0068871_1001788362 155
51 3300006358 Ga0068871_101117718 Ga0068871_1011177182 155
52 3300006358 Ga0068871_101380952 Ga0068871_1013809521 155
53 3300006852 Ga0075433_11042721 Ga0075433_110427212 155
54 3300006871 Ga0075434_100053356 Ga0075434_1000533564 155
55 3300009098 Ga0105245_10062299 Ga0105245_100622994 155
56 3300009148 Ga0105243_10759716 Ga0105243_107597162 155
57 3300009176 Ga0105242_10169686 Ga0105242_101696863 155
58 3300009176 Ga0105242_12353962 Ga0105242_123539621 155
59 3300009177 Ga0105248_10071253 Ga0105248_100712533 155
60 3300009177 Ga0105248_10082001 Ga0105248_100820012 155
61 3300009177 Ga0105248_10909787 Ga0105248_109097871 155
62 3300009553 Ga0105249_10420435 Ga0105249_104204352 155
63 3300011119 Ga0105246_10727834 Ga0105246_107278342 155
64 3300014325 Ga0163163_10000003 Ga0163163_10000003305 155
65 3300014325 Ga0163163_10007770 Ga0163163_100077703 155
66 3300014968 Ga0157379_10830432 Ga0157379_108304322 155
67 3300014968 Ga0157379_10972236 Ga0157379_109722362 155
68 3300025920 Ga0207649_10775951 Ga0207649_107759512 155
69 3300025922 Ga0207646_10084033 Ga0207646_100840333 155
70 3300025926 Ga0207659_10929536 Ga0207659_109295361 155
71 3300025927 Ga0207687_10243622 Ga0207687_102436222 155
72 3300025931 Ga0207644_10575225 Ga0207644_105752251 155
73 3300025934 Ga0207686_10142927 Ga0207686_101429271 155
74 3300025941 Ga0207711_10041408 Ga0207711_100414083 155
75 3300025941 Ga0207711_10128794 Ga0207711_101287942 155
76 3300026035 Ga0207703_10760182 Ga0207703_107601822 155
77 3300026095 Ga0207676_10072258 Ga0207676_100722582 155
78 3300029957 Ga0265324_10008528 Ga0265324_100085282 155
79 3300035088 Ga0373940_0220531 Ga0373940_0220531_107_574 155
80 3300035118 Ga0373954_0193016 Ga0373954_0193016_445_912 155
81 3300035121 Ga0373960_0157502 Ga0373960_0157502_242_709 155
82 3300036401 Ga0373937_0027491 Ga0373937_0027491_3552_4019 155
83 3300037068 Ga0373925_0906436 Ga0373925_0906436_76_543 155
84 3300037418 Ga0395900_1170885 Ga0395900_1170885_155_640 155
85 3300045051 Ga0451576_0018178 Ga0451576_0018178_44_511 155
86 3300045051 Ga0451576_0247060 Ga0451576_0247060_49_516 155
87 3300046454 Ga0495592_0017853 Ga0495592_0017853_3770_4237 155
88 3300046462 Ga0495651_0195024 Ga0495651_0195024_291_758 155
89 3300046463 Ga0495653_0224458 Ga0495653_0224458_521_988 155
90 3300046516 Ga0495628_0271177 Ga0495628_0271177_484_951 155
91 3300046525 Ga0495663_0200630 Ga0495663_0200630_95_583 155
92 3300046529 Ga0495652_0177384 Ga0495652_0177384_554_1021 155
93 3300046615 Ga0495656_0464165 Ga0495656_0464165_50_535 155
94 3300046663 Ga0495635_0287921 Ga0495635_0287921_202_669 155
95 3300046683 Ga0495658_0067894 Ga0495658_0067894_542_1009 155
96 3300046683 Ga0495658_0506917 Ga0495658_0506917_251_718 155
97 3300047322 Ga0495680_0177799 Ga0495680_0177799_298_765 155
98 3300047471 Ga0495684_0201480 Ga0495684_0201480_60_527 155
99 3300048907 Ga0496104_0001375 Ga0496104_0001375_3056_3523 155
100 3300048908 Ga0496105_0037210 Ga0496105_0037210_1175_1642 155
101 3300048911 Ga0496108_0004677 Ga0496108_0004677_10461_10928 155
102 3300048912 Ga0496109_0000528 Ga0496109_0000528_27064_27531 155
103 3300048913 Ga0496110_0003072 Ga0496110_0003072_5729_6196 155
104 3300048913 Ga0496110_0600856 Ga0496110_0600856_395_862 155
105 3300048915 Ga0496112_0001610 Ga0496112_0001610_5206_5673 155
106 3300048917 Ga0496114_0236467 Ga0496114_0236467_261_728 155
107 3300050512 nmdc:mga0n895_312741_c1 nmdc:mga0n895_312741_c1_663_1130 155
108 3300053077 Ga0495601_0061960 Ga0495601_0061960_356_823 155
109 3300053084 Ga0495595_0208841 Ga0495595_0208841_189_656 155
110 3300003911 JGI25405J52794_10029100 JGI25405J52794_100291001 156
111 3300005329 Ga0070683_101259483 Ga0070683_1012594831 156
112 3300005336 Ga0070680_100131625 Ga0070680_1001316252 156
113 3300005341 Ga0070691_10073901 Ga0070691_100739012 156
114 3300005344 Ga0070661_100236499 Ga0070661_1002364992 156
115 3300005344 Ga0070661_100473967 Ga0070661_1004739671 156
116 3300005347 Ga0070668_100056398 Ga0070668_1000563983 156
117 3300005355 Ga0070671_100169212 Ga0070671_1001692123 156
118 3300005356 Ga0070674_100001939 Ga0070674_1000019393 156
119 3300005364 Ga0070673_100305364 Ga0070673_1003053641 156
120 3300005366 Ga0070659_100069552 Ga0070659_1000695522 156
121 3300005444 Ga0070694_100009786 Ga0070694_1000097865 156
122 3300005456 Ga0070678_100224724 Ga0070678_1002247241 156
123 3300005458 Ga0070681_10944621 Ga0070681_109446211 156
124 3300005539 Ga0068853_100012540 Ga0068853_1000125408 156
125 3300005545 Ga0070695_100097051 Ga0070695_1000970513 156
126 3300005546 Ga0070696_100750991 Ga0070696_1007509911 156
127 3300005548 Ga0070665_100060745 Ga0070665_1000607454 156
128 3300005616 Ga0068852_100097332 Ga0068852_1000973321 156
129 3300005616 Ga0068852_100432971 Ga0068852_1004329712 156
130 3300005718 Ga0068866_10222138 Ga0068866_102221381 156
131 3300005937 Ga0081455_10001646 Ga0081455_1000164610 156
132 3300005985 Ga0081539_10105332 Ga0081539_101053322 156
133 3300006051 Ga0075364_10821667 Ga0075364_108216671 156
134 3300006058 Ga0075432_10085433 Ga0075432_100854332 156
135 3300006844 Ga0075428_100125343 Ga0075428_1001253432 156
136 3300006852 Ga0075433_10001298 Ga0075433_1000129810 156
137 3300006871 Ga0075434_100000948 Ga0075434_1000009489 156
138 3300007076 Ga0075435_100148435 Ga0075435_1001484352 156
139 3300009094 Ga0111539_10031954 Ga0111539_100319541 156
140 3300009094 Ga0111539_10976255 Ga0111539_109762551 156
141 3300009147 Ga0114129_10151298 Ga0114129_101512982 156
142 3300013105 Ga0157369_10805790 Ga0157369_108057902 156
143 3300013307 Ga0157372_10919161 Ga0157372_109191612 156
144 3300025917 Ga0207660_10222626 Ga0207660_102226262 156
145 3300025920 Ga0207649_10414283 Ga0207649_104142832 156
146 3300025931 Ga0207644_10274520 Ga0207644_102745202 156
147 3300025932 Ga0207690_10025060 Ga0207690_100250601 156
148 3300025937 Ga0207669_10008297 Ga0207669_100082972 156
149 3300025944 Ga0207661_10236316 Ga0207661_102363162 156
150 3300025945 Ga0207679_10043863 Ga0207679_100438633 156
151 3300025960 Ga0207651_11048596 Ga0207651_110485961 156
152 3300025972 Ga0207668_10076364 Ga0207668_100763642 156
153 3300026041 Ga0207639_10137304 Ga0207639_101373044 156
154 3300026041 Ga0207639_10577002 Ga0207639_105770022 156
155 3300026067 Ga0207678_10269587 Ga0207678_102695873 156
156 3300026121 Ga0207683_10347576 Ga0207683_103475761 156
157 3300026142 Ga0207698_10275609 Ga0207698_102756092 156
158 3300026142 Ga0207698_10479832 Ga0207698_104798322 156
159 3300027907 Ga0207428_10587793 Ga0207428_105877931 156
160 3300028379 Ga0268266_10216891 Ga0268266_102168912 156
161 3300028800 Ga0265338_10037276 Ga0265338_100372763 156
162 3300028800 Ga0265338_10302792 Ga0265338_103027921 156
163 3300031240 Ga0265320_10060374 Ga0265320_100603744 156
164 3300034819 Ga0373958_0006144 Ga0373958_0006144_231_701 156
165 3300035088 Ga0373940_0243620 Ga0373940_0243620_44_514 156
166 3300035091 Ga0373951_0014747 Ga0373951_0014747_161_631 156
167 3300035114 Ga0373939_0000572 Ga0373939_0000572_1385_1855 156
168 3300035115 Ga0373941_0083955 Ga0373941_0083955_203_673 156
169 3300035121 Ga0373960_0110174 Ga0373960_0110174_112_582 156
170 3300035241 Ga0373961_0088558 Ga0373961_0088558_433_903 156
171 3300035691 Ga0373931_0267442 Ga0373931_0267442_497_967 156
172 3300038996 Ga0242420_021659 Ga0242420_021659_295_765 156
173 3300046459 Ga0495629_0632222 Ga0495629_0632222_13_483 156
174 3300047322 Ga0495680_0834367 Ga0495680_0834367_46_516 156
175 3300047444 Ga0495675_0152871 Ga0495675_0152871_785_1255 156
176 3300048904 Ga0496101_0418704 Ga0496101_0418704_91_561 156
177 3300048929 Ga0496126_0039148 Ga0496126_0039148_59_529 156
178 3300050507 nmdc:mga05p37_60063_c1 nmdc:mga05p37_60063_c1_1407_1877 156
179 3300050511 nmdc:mga08y16_458592_c1 nmdc:mga08y16_458592_c1_551_1021 156
180 3300050512 nmdc:mga0n895_1922_c1 nmdc:mga0n895_1922_c1_5554_6024 156
181 3300050513 nmdc:mga0rr50_409067_c1 nmdc:mga0rr50_409067_c1_434_904 156
182 3300050515 nmdc:mga0a205_7966_c1 nmdc:mga0a205_7966_c1_2095_2565 156
183 3300005335 Ga0070666_10046676 Ga0070666_100466762 157
184 3300005340 Ga0070689_100064550 Ga0070689_1000645503 157
185 3300005343 Ga0070687_100420570 Ga0070687_1004205702 157
186 3300005356 Ga0070674_101757172 Ga0070674_1017571721 157
187 3300005434 Ga0070709_10000056 Ga0070709_1000005641 157
188 3300005544 Ga0070686_100000232 Ga0070686_1000002323 157
189 3300005544 Ga0070686_100531925 Ga0070686_1005319252 157
190 3300005547 Ga0070693_100248882 Ga0070693_1002488821 157
191 3300005578 Ga0068854_100463455 Ga0068854_1004634551 157
192 3300005719 Ga0068861_100594968 Ga0068861_1005949682 157
193 3300005843 Ga0068860_100632445 Ga0068860_1006324452 157
194 3300006028 Ga0070717_10031644 Ga0070717_100316445 157
195 3300006871 Ga0075434_100129365 Ga0075434_1001293655 157
196 3300009094 Ga0111539_10014638 Ga0111539_100146383 157
197 3300009553 Ga0105249_10699691 Ga0105249_106996911 157
198 3300025906 Ga0207699_10000062 Ga0207699_1000006235 157
199 3300025911 Ga0207654_10060682 Ga0207654_100606823 157
200 3300025918 Ga0207662_10043784 Ga0207662_100437843 157
201 3300025928 Ga0207700_10192506 Ga0207700_101925063 157
202 3300025936 Ga0207670_10026542 Ga0207670_100265422 157
203 3300025939 Ga0207665_10014070 Ga0207665_100140704 157
204 3300025960 Ga0207651_10245926 Ga0207651_102459262 157
205 3300025981 Ga0207640_11396271 Ga0207640_113962711 157
206 3300027907 Ga0207428_10052652 Ga0207428_100526522 157
207 3300035724 Ga0373933_0271122 Ga0373933_0271122_466_942 157
208 3300036401 Ga0373937_0102235 Ga0373937_0102235_1328_1804 157
209 3300046529 Ga0495652_0662379 Ga0495652_0662379_14_490 157
210 3300046543 Ga0495645_0084367 Ga0495645_0084367_1741_2217 157
211 3300047318 Ga0495636_0017934 Ga0495636_0017934_2281_2754 157
212 3300047318 Ga0495636_0150621 Ga0495636_0150621_426_908 157
213 3300048904 Ga0496101_0665188 Ga0496101_0665188_295_777 157
214 3300048906 Ga0496103_0170410 Ga0496103_0170410_355_828 157
215 3300048910 Ga0496107_0098377 Ga0496107_0098377_57_530 157
216 3300050511 nmdc:mga08y16_30123_c1 nmdc:mga08y16_30123_c1_1296_1769 157
217 3300050512 nmdc:mga0n895_505173_c1 nmdc:mga0n895_505173_c1_353_835 157
218 3300053077 Ga0495601_0360861 Ga0495601_0360861_42_518 157
219 2162886011 MRS1b_contig_8435162 MRS1b_0552.00003080 158
220 2162886012 MBSR1b_contig_11449826 MBSR1b_0904.00006150 158
221 2209111006 2214854657 2213900376 158
222 3300005277 Ga0065716_1007179 Ga0065716_10071791 158
223 3300005290 Ga0065712_10076611 Ga0065712_100766116 158
224 3300005293 Ga0065715_10174240 Ga0065715_101742402 158
225 3300005293 Ga0065715_10333635 Ga0065715_103336352 158
226 3300005329 Ga0070683_100000881 Ga0070683_10000088117 158
227 3300005330 Ga0070690_100176937 Ga0070690_1001769372 158
228 3300005331 Ga0070670_100000026 Ga0070670_10000002685 158
229 3300005331 Ga0070670_100047373 Ga0070670_1000473734 158
230 3300005335 Ga0070666_10025057 Ga0070666_100250573 158
231 3300005335 Ga0070666_10158951 Ga0070666_101589512 158
232 3300005335 Ga0070666_10162900 Ga0070666_101629001 158
233 3300005336 Ga0070680_100748999 Ga0070680_1007489991 158
234 3300005337 Ga0070682_100576893 Ga0070682_1005768931 158
235 3300005339 Ga0070660_100948812 Ga0070660_1009488121 158
236 3300005341 Ga0070691_10644492 Ga0070691_106444921 158
237 3300005344 Ga0070661_100010450 Ga0070661_1000104509 158
238 3300005344 Ga0070661_100210472 Ga0070661_1002104722 158
239 3300005344 Ga0070661_100306042 Ga0070661_1003060421 158
240 3300005353 Ga0070669_100004728 Ga0070669_1000047282 158
241 3300005354 Ga0070675_100090133 Ga0070675_1000901332 158
242 3300005354 Ga0070675_101235292 Ga0070675_1012352921 158
243 3300005355 Ga0070671_100000058 Ga0070671_10000005824 158
244 3300005355 Ga0070671_100097825 Ga0070671_1000978253 158
245 3300005364 Ga0070673_100481611 Ga0070673_1004816112 158
246 3300005364 Ga0070673_102008393 Ga0070673_1020083931 158
247 3300005365 Ga0070688_100010523 Ga0070688_1000105234 158
248 3300005365 Ga0070688_100174747 Ga0070688_1001747472 158
249 3300005366 Ga0070659_100108229 Ga0070659_1001082294 158
250 3300005367 Ga0070667_100000002 Ga0070667_100000002234 158
251 3300005367 Ga0070667_101514810 Ga0070667_1015148101 158
252 3300005434 Ga0070709_10669565 Ga0070709_106695652 158
253 3300005439 Ga0070711_100153397 Ga0070711_1001533973 158
254 3300005439 Ga0070711_100417655 Ga0070711_1004176552 158
255 3300005440 Ga0070705_101145821 Ga0070705_1011458211 158
256 3300005455 Ga0070663_100298732 Ga0070663_1002987322 158
257 3300005455 Ga0070663_100729951 Ga0070663_1007299512 158
258 3300005456 Ga0070678_100446334 Ga0070678_1004463342 158
259 3300005457 Ga0070662_100399290 Ga0070662_1003992902 158
260 3300005458 Ga0070681_10136841 Ga0070681_101368412 158
261 3300005459 Ga0068867_100238307 Ga0068867_1002383073 158
262 3300005466 Ga0070685_10000009 Ga0070685_1000000917 158
263 3300005466 Ga0070685_10437387 Ga0070685_104373871 158
264 3300005471 Ga0070698_100255917 Ga0070698_1002559171 158
265 3300005471 Ga0070698_101697618 Ga0070698_1016976181 158
266 3300005530 Ga0070679_100533363 Ga0070679_1005333631 158
267 3300005535 Ga0070684_100008961 Ga0070684_1000089615 158
268 3300005535 Ga0070684_100999873 Ga0070684_1009998731 158
269 3300005539 Ga0068853_100000457 Ga0068853_1000004572 158
270 3300005539 Ga0068853_100194985 Ga0068853_1001949852 158
271 3300005539 Ga0068853_101094713 Ga0068853_1010947131 158
272 3300005539 Ga0068853_101358693 Ga0068853_1013586932 158
273 3300005543 Ga0070672_100008753 Ga0070672_10000875310 158
274 3300005544 Ga0070686_100705650 Ga0070686_1007056501 158
275 3300005547 Ga0070693_100024109 Ga0070693_1000241095 158
276 3300005547 Ga0070693_100024916 Ga0070693_1000249162 158
277 3300005548 Ga0070665_100156646 Ga0070665_1001566461 158
278 3300005548 Ga0070665_100991548 Ga0070665_1009915482 158
279 3300005563 Ga0068855_100131281 Ga0068855_1001312813 158
280 3300005564 Ga0070664_100000363 Ga0070664_10000036310 158
281 3300005616 Ga0068852_100186633 Ga0068852_1001866333 158
282 3300005616 Ga0068852_101792469 Ga0068852_1017924691 158
283 3300005617 Ga0068859_100121223 Ga0068859_1001212232 158
284 3300005617 Ga0068859_100515713 Ga0068859_1005157131 158
285 3300005618 Ga0068864_100000002 Ga0068864_100000002243 158
286 3300005618 Ga0068864_100068432 Ga0068864_1000684321 158
287 3300005841 Ga0068863_100872866 Ga0068863_1008728662 158
288 3300005842 Ga0068858_100081864 Ga0068858_1000818642 158
289 3300005843 Ga0068860_100000684 Ga0068860_10000068425 158
290 3300005843 Ga0068860_100679213 Ga0068860_1006792132 158
291 3300005844 Ga0068862_100000541 Ga0068862_1000005413 158
292 3300005844 Ga0068862_101435289 Ga0068862_1014352892 158
293 3300005983 Ga0081540_1000363 Ga0081540_100036325 158
294 3300006163 Ga0070715_10020210 Ga0070715_100202102 158
295 3300006173 Ga0070716_100215448 Ga0070716_1002154482 158
296 3300006175 Ga0070712_100557298 Ga0070712_1005572981 158
297 3300006237 Ga0097621_100729021 Ga0097621_1007290212 158
298 3300006358 Ga0068871_100603563 Ga0068871_1006035631 158
299 3300006852 Ga0075433_10452990 Ga0075433_104529902 158
300 3300006852 Ga0075433_10612519 Ga0075433_106125191 158
301 3300006871 Ga0075434_100148997 Ga0075434_1001489974 158
302 3300006871 Ga0075434_101918583 Ga0075434_1019185831 158
303 3300006881 Ga0068865_101462429 Ga0068865_1014624291 158
304 3300006914 Ga0075436_100640251 Ga0075436_1006402511 158
305 3300006931 Ga0097620_100121230 Ga0097620_1001212302 158
306 3300006931 Ga0097620_100515679 Ga0097620_1005156791 158
307 3300006931 Ga0097620_101266204 Ga0097620_1012662042 158
308 3300009093 Ga0105240_10175793 Ga0105240_101757932 158
309 3300009093 Ga0105240_10230639 Ga0105240_102306392 158
310 3300009093 Ga0105240_10475691 Ga0105240_104756911 158
311 3300009101 Ga0105247_10003659 Ga0105247_100036595 158
312 3300009101 Ga0105247_10013464 Ga0105247_100134647 158
313 3300009101 Ga0105247_10198348 Ga0105247_101983482 158
314 3300009147 Ga0114129_10488818 Ga0114129_104888181 158
315 3300009148 Ga0105243_10290306 Ga0105243_102903061 158
316 3300009176 Ga0105242_10062322 Ga0105242_100623222 158
317 3300009177 Ga0105248_10029546 Ga0105248_100295466 158
318 3300009177 Ga0105248_10038798 Ga0105248_100387983 158
319 3300009177 Ga0105248_10620660 Ga0105248_106206601 158
320 3300009177 Ga0105248_11259550 Ga0105248_112595501 158
321 3300009545 Ga0105237_10032082 Ga0105237_100320823 158
322 3300009551 Ga0105238_10000161 Ga0105238_1000016111 158
323 3300009551 Ga0105238_10023731 Ga0105238_100237313 158
324 3300009551 Ga0105238_11762237 Ga0105238_117622371 158
325 3300009553 Ga0105249_10043221 Ga0105249_100432213 158
326 3300009553 Ga0105249_10350894 Ga0105249_103508942 158
327 3300009553 Ga0105249_10481431 Ga0105249_104814312 158
328 3300009553 Ga0105249_12315356 Ga0105249_123153561 158
329 3300010375 Ga0105239_10795038 Ga0105239_107950383 158
330 3300013104 Ga0157370_10065619 Ga0157370_100656192 158
331 3300013104 Ga0157370_10427067 Ga0157370_104270672 158
332 3300013105 Ga0157369_10293694 Ga0157369_102936942 158
333 3300013296 Ga0157374_10000888 Ga0157374_1000088820 158
334 3300013297 Ga0157378_10147039 Ga0157378_101470394 158
335 3300013297 Ga0157378_11137422 Ga0157378_111374222 158
336 3300013297 Ga0157378_12546827 Ga0157378_125468271 158
337 3300013306 Ga0163162_10540607 Ga0163162_105406072 158
338 3300013306 Ga0163162_11019051 Ga0163162_110190511 158
339 3300013307 Ga0157372_10415924 Ga0157372_104159243 158
340 3300013307 Ga0157372_10678771 Ga0157372_106787712 158
341 3300013307 Ga0157372_12474625 Ga0157372_124746251 158
342 3300014325 Ga0163163_10000081 Ga0163163_10000081101 158
343 3300014325 Ga0163163_10008376 Ga0163163_100083765 158
344 3300014325 Ga0163163_10033265 Ga0163163_100332654 158
345 3300014325 Ga0163163_11690650 Ga0163163_116906501 158
346 3300014326 Ga0157380_11124029 Ga0157380_111240291 158
347 3300014968 Ga0157379_10094281 Ga0157379_100942814 158
348 3300014968 Ga0157379_10174568 Ga0157379_101745682 158
349 3300014968 Ga0157379_10518208 Ga0157379_105182081 158
350 3300014968 Ga0157379_10538086 Ga0157379_105380862 158
351 3300014969 Ga0157376_10134072 Ga0157376_101340722 158
352 3300014969 Ga0157376_11261293 Ga0157376_112612931 158
353 3300017792 Ga0163161_10576206 Ga0163161_105762062 158
354 3300025315 Ga0207697_10019712 Ga0207697_100197122 158
355 3300025900 Ga0207710_10005992 Ga0207710_100059926 158
356 3300025903 Ga0207680_10064014 Ga0207680_100640142 158
357 3300025903 Ga0207680_10103267 Ga0207680_101032672 158
358 3300025903 Ga0207680_10990312 Ga0207680_109903121 158
359 3300025905 Ga0207685_10079084 Ga0207685_100790841 158
360 3300025905 Ga0207685_10473367 Ga0207685_104733671 158
361 3300025906 Ga0207699_10436612 Ga0207699_104366121 158
362 3300025909 Ga0207705_10029387 Ga0207705_100293874 158
363 3300025912 Ga0207707_10631494 Ga0207707_106314941 158
364 3300025913 Ga0207695_10069848 Ga0207695_100698481 158
365 3300025913 Ga0207695_10287852 Ga0207695_102878522 158
366 3300025914 Ga0207671_10163214 Ga0207671_101632142 158
367 3300025916 Ga0207663_10876259 Ga0207663_108762591 158
368 3300025919 Ga0207657_10851144 Ga0207657_108511441 158
369 3300025919 Ga0207657_11007231 Ga0207657_110072311 158
370 3300025920 Ga0207649_10008173 Ga0207649_100081732 158
371 3300025920 Ga0207649_10268631 Ga0207649_102686312 158
372 3300025921 Ga0207652_10592315 Ga0207652_105923151 158
373 3300025923 Ga0207681_10005488 Ga0207681_100054884 158
374 3300025924 Ga0207694_10015481 Ga0207694_100154812 158
375 3300025924 Ga0207694_10143281 Ga0207694_101432813 158
376 3300025925 Ga0207650_10000002 Ga0207650_10000002239 158
377 3300025925 Ga0207650_10013674 Ga0207650_100136748 158
378 3300025926 Ga0207659_11358019 Ga0207659_113580191 158
379 3300025928 Ga0207700_10338597 Ga0207700_103385973 158
380 3300025931 Ga0207644_10000020 Ga0207644_1000002073 158
381 3300025931 Ga0207644_10073326 Ga0207644_100733263 158
382 3300025933 Ga0207706_10340653 Ga0207706_103406532 158
383 3300025934 Ga0207686_10055975 Ga0207686_100559752 158
384 3300025939 Ga0207665_10137922 Ga0207665_101379222 158
385 3300025940 Ga0207691_10084208 Ga0207691_100842084 158
386 3300025941 Ga0207711_10000619 Ga0207711_1000061924 158
387 3300025941 Ga0207711_10028554 Ga0207711_100285544 158
388 3300025941 Ga0207711_10183707 Ga0207711_101837074 158
389 3300025941 Ga0207711_10968651 Ga0207711_109686511 158
390 3300025941 Ga0207711_11048836 Ga0207711_110488362 158
391 3300025944 Ga0207661_10009199 Ga0207661_100091998 158
392 3300025945 Ga0207679_10003025 Ga0207679_100030258 158
393 3300025949 Ga0207667_10442550 Ga0207667_104425503 158
394 3300025960 Ga0207651_10839612 Ga0207651_108396121 158
395 3300025961 Ga0207712_10116943 Ga0207712_101169432 158
396 3300025961 Ga0207712_10269881 Ga0207712_102698811 158
397 3300025961 Ga0207712_10529258 Ga0207712_105292582 158
398 3300025986 Ga0207658_10000001 Ga0207658_100000011113 158
399 3300026035 Ga0207703_10099349 Ga0207703_100993492 158
400 3300026041 Ga0207639_10000006 Ga0207639_100000066 158
401 3300026041 Ga0207639_10219628 Ga0207639_102196284 158
402 3300026041 Ga0207639_11135068 Ga0207639_111350682 158
403 3300026067 Ga0207678_10155701 Ga0207678_101557012 158
404 3300026067 Ga0207678_10563403 Ga0207678_105634031 158
405 3300026078 Ga0207702_11856228 Ga0207702_118562281 158
406 3300026088 Ga0207641_10055145 Ga0207641_100551453 158
407 3300026095 Ga0207676_10000001 Ga0207676_10000001239 158
408 3300026095 Ga0207676_10301472 Ga0207676_103014722 158
409 3300026121 Ga0207683_11199374 Ga0207683_111993741 158
410 3300028379 Ga0268266_10014651 Ga0268266_100146514 158
411 3300028379 Ga0268266_10461761 Ga0268266_104617611 158
412 3300028379 Ga0268266_11148273 Ga0268266_111482731 158
413 3300028380 Ga0268265_10000258 Ga0268265_1000025850 158
414 3300028381 Ga0268264_10000004 Ga0268264_10000004239 158
415 3300028381 Ga0268264_10929234 Ga0268264_109292341 158
416 3300028381 Ga0268264_11517571 Ga0268264_115175711 158
417 3300028563 Ga0265319_1080419 Ga0265319_10804191 158
418 3300028577 Ga0265318_10000004 Ga0265318_10000004210 158
419 3300028577 Ga0265318_10031832 Ga0265318_100318322 158
420 3300028577 Ga0265318_10081903 Ga0265318_100819032 158
421 3300028653 Ga0265323_10008972 Ga0265323_100089724 158
422 3300028654 Ga0265322_10062869 Ga0265322_100628691 158
423 3300028800 Ga0265338_10002888 Ga0265338_1000288816 158
424 3300029957 Ga0265324_10007272 Ga0265324_100072727 158
425 3300031240 Ga0265320_10023350 Ga0265320_100233503 158
426 3300031241 Ga0265325_10181756 Ga0265325_101817562 158
427 3300031250 Ga0265331_10006766 Ga0265331_100067664 158
428 3300031344 Ga0265316_10016479 Ga0265316_100164793 158
429 3300031344 Ga0265316_10104024 Ga0265316_101040241 158
430 3300031344 Ga0265316_10227217 Ga0265316_102272171 158
431 3300031344 Ga0265316_10270165 Ga0265316_102701653 158
432 3300031595 Ga0265313_10007882 Ga0265313_100078824 158
433 3300031616 Ga0307508_10023041 Ga0307508_100230415 158
434 3300031711 Ga0265314_10006333 Ga0265314_100063335 158
435 3300031711 Ga0265314_10015744 Ga0265314_100157442 158
436 3300035119 Ga0373956_0330280 Ga0373956_0330280_25_555 158
437 3300035172 Ga0373955_0218355 Ga0373955_0218355_493_978 158
438 3300035692 Ga0373935_0001058 Ga0373935_0001058_9292_9810 158
439 3300035695 Ga0373927_0240296 Ga0373927_0240296_343_825 158
440 3300036401 Ga0373937_0098018 Ga0373937_0098018_1632_2117 158
441 3300037068 Ga0373925_1248872 Ga0373925_1248872_62_544 158
442 3300037471 Ga0395905_0333753 Ga0395905_0333753_642_1157 158
443 3300041452 Ga0451793_1570102 Ga0451793_1570102_194_670 158
444 3300041459 Ga0451800_1414222 Ga0451800_1414222_58_549 158
445 3300041496 Ga0451839_0800656 Ga0451839_0800656_86_568 158
446 3300041512 Ga0451853_3698162 Ga0451853_3698162_55_543 158
447 3300044658 Ga0466972_0004392 Ga0466972_0004392_4518_5015 158
448 3300044683 Ga0466965_0000219 Ga0466965_0000219_13555_14052 158
449 3300044694 Ga0466963_0102940 Ga0466963_0102940_1346_1861 158
450 3300044706 Ga0466964_0027920 Ga0466964_0027920_591_1088 158
451 3300044712 Ga0453684_0742823 Ga0453684_0742823_297_776 158
452 3300044735 Ga0466968_0004840 Ga0466968_0004840_2555_3109 158
453 3300044735 Ga0466968_0026704 Ga0466968_0026704_919_1416 158
454 3300045976 Ga0466967_0479417 Ga0466967_0479417_701_1183 158
455 3300046454 Ga0495592_0242154 Ga0495592_0242154_679_1164 158
456 3300046455 Ga0495603_0031650 Ga0495603_0031650_1397_1882 158
457 3300046461 Ga0495641_0022124 Ga0495641_0022124_2224_2709 158
458 3300046472 Ga0495580_0014743 Ga0495580_0014743_1380_1865 158
459 3300046475 Ga0495639_0005859 Ga0495639_0005859_2821_3306 158
460 3300046476 Ga0495662_0012045 Ga0495662_0012045_2098_2583 158
461 3300046477 Ga0495664_0019469 Ga0495664_0019469_3121_3606 158
462 3300046499 Ga0495594_0003568 Ga0495594_0003568_4488_4973 158
463 3300046511 Ga0495608_0689722 Ga0495608_0689722_22_552 158
464 3300046514 Ga0495618_0025281 Ga0495618_0025281_1472_1957 158
465 3300046517 Ga0495630_0004043 Ga0495630_0004043_6868_7353 158
466 3300046517 Ga0495630_0402386 Ga0495630_0402386_500_979 158
467 3300046526 Ga0495666_0000862 Ga0495666_0000862_3352_3837 158
468 3300046529 Ga0495652_0629376 Ga0495652_0629376_169_654 158
469 3300046531 Ga0495665_0146044 Ga0495665_0146044_52_537 158
470 3300046533 Ga0495640_0068815 Ga0495640_0068815_77_562 158
471 3300046535 Ga0495586_0162046 Ga0495586_0162046_385_864 158
472 3300046558 Ga0495633_0002630 Ga0495633_0002630_3229_3726 158
473 3300046559 Ga0495667_0102817 Ga0495667_0102817_844_1329 158
474 3300046642 Ga0495634_0010840 Ga0495634_0010840_4266_4751 158
475 3300046664 Ga0495659_0297138 Ga0495659_0297138_119_595 158
476 3300046681 Ga0495647_0010674 Ga0495647_0010674_2362_2847 158
477 3300046681 Ga0495647_0386583 Ga0495647_0386583_124_606 158
478 3300046683 Ga0495658_0003363 Ga0495658_0003363_2879_3364 158
479 3300046683 Ga0495658_0456226 Ga0495658_0456226_318_800 158
480 3300046689 Ga0495613_0177909 Ga0495613_0177909_939_1469 158
481 3300047317 Ga0495604_0570696 Ga0495604_0570696_100_588 158
482 3300047319 Ga0495674_0008071 Ga0495674_0008071_9359_9844 158
483 3300047321 Ga0495676_0075930 Ga0495676_0075930_234_719 158
484 3300047322 Ga0495680_0004092 Ga0495680_0004092_3447_3932 158
485 3300047471 Ga0495684_0116149 Ga0495684_0116149_482_1012 158
486 3300048913 Ga0496110_0107182 Ga0496110_0107182_306_812 158
487 3300048914 Ga0496111_0605254 Ga0496111_0605254_34_540 158
488 3300048915 Ga0496112_0097427 Ga0496112_0097427_2049_2546 158
489 3300048917 Ga0496114_0471502 Ga0496114_0471502_604_1086 158
490 3300048917 Ga0496114_1184592 Ga0496114_1184592_63_560 158
491 3300048918 Ga0496115_0176577 Ga0496115_0176577_549_1034 158
492 3300048921 Ga0496118_0355947 Ga0496118_0355947_35_550 158
493 3300048924 Ga0496121_0135577 Ga0496121_0135577_210_746 158
494 3300048926 Ga0496123_0042515 Ga0496123_0042515_989_1525 158
495 3300048927 Ga0496124_0132640 Ga0496124_0132640_175_690 158
496 3300048928 Ga0496125_0046998 Ga0496125_0046998_1983_2498 158
497 3300048928 Ga0496125_0084509 Ga0496125_0084509_1314_1850 158
498 3300048929 Ga0496126_0237026 Ga0496126_0237026_791_1306 158
499 3300049569 Ga0501032_0176340 Ga0501032_0176340_537_1157 158
500 3300049570 Ga0501033_0019858 Ga0501033_0019858_3821_4441 158
501 3300049571 Ga0501034_0001235 Ga0501034_0001235_24207_24827 158
502 3300049571 Ga0501034_0937593 Ga0501034_0937593_103_585 158
503 3300049572 Ga0501036_0072178 Ga0501036_0072178_1185_1805 158
504 3300049573 Ga0501037_0008455 Ga0501037_0008455_310_930 158
505 3300049574 Ga0501038_0000764 Ga0501038_0000764_14411_15031 158
506 3300049581 Ga0501047_0439963 Ga0501047_0439963_173_790 158
507 3300049742 Ga0501080_0633034 Ga0501080_0633034_225_845 158
508 3300049822 Ga0501035_0361344 Ga0501035_0361344_283_903 158
509 3300050507 nmdc:mga05p37_418847_c1 nmdc:mga05p37_418847_c1_278_763 158
510 3300050512 nmdc:mga0n895_15223_c1 nmdc:mga0n895_15223_c1_4278_4769 158
511 3300050512 nmdc:mga0n895_264052_c1 nmdc:mga0n895_264052_c1_557_1042 158
512 3300050513 nmdc:mga0rr50_543778_c1 nmdc:mga0rr50_543778_c1_472_963 158
513 3300050515 nmdc:mga0a205_234257_c1 nmdc:mga0a205_234257_c1_711_1202 158
514 3300053084 Ga0495595_0497361 Ga0495595_0497361_25_504 158
515 3300060353 Ga0501082_0871930 Ga0501082_0871930_52_534 158

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04239

DUF421

YetF C-terminal domain

104

186

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c6f-assembly1.cif.gz_C crystal structure of protein bsu07140 from bacillus subtilis 0.8917 99 158
5uhs-assembly1.cif.gz_B structure of a semisweet d57a mutant 0.5418 8 78
4rng-assembly4.cif.gz_C-2 crystal structure of a bacterial homologue of sweet transporters 0.5201 8 79
4rng-assembly2.cif.gz_D crystal structure of a bacterial homologue of sweet transporters 0.5191 8 79
2kw6-assembly1.cif.gz_A solution nmr structure of cyclin-dependent kinase 2-associated protein 1 (cdk2-associated protein 1; oral cancer suppressor deleted in oral cancer 1, doc-1) from h.sapiens, northeast structural genomics consortium target target hr3057h 0.5144 42 87
ID Description Score Start End Superfamily
af_P75839_95_166_3.30.240.20 Alpha Beta;2-Layer Sandwich;CRO Repressor;bsu07140 like domains 0.9538 86 153 3.30.240.20
af_P75839_95_166_3.30.240.20 Alpha Beta;2-Layer Sandwich;CRO Repressor;bsu07140 like domains 0.8912 86 153 3.30.240.20
3c6fD01 Alpha Beta;2-Layer Sandwich;CRO Repressor;bsu07140 like domains 0.8838 99 158 3.30.240.20
3c6fC02 Alpha Beta;2-Layer Sandwich;CRO Repressor;bsu07140 like domains 0.8713 97 158 3.30.240.20
3c6fC02 Alpha Beta;2-Layer Sandwich;CRO Repressor;bsu07140 like domains 0.8462 97 158 3.30.240.20
ID Description Score Start End GO Terms
AF-U5RQX7-F1-model_v4 deleted 0.9142 64 158
AF-R5DRY5-F1-model_v4 deleted 0.8712 35 158
AF-A0A351F8V7-F1-model_v4 DUF421 domain-containing protein 0.8706 41 158 GO:0005886
AF-A0A831Y7Z0-F1-model_v4 DUF421 domain-containing protein 0.8698 8 153 GO:0005886
AF-A0A2D9T5A6-F1-model_v4 DUF421 domain-containing protein 0.8674 10 158 GO:0005886

Feature Viewer

pLDDT pTM Quality
77.86 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map