F457867

General Info

Members Datasets Scaffolds Average Seq Length
515 200 1004 325

Family's Representative Sequence

Representative Sequence 3300025910|Ga0207684_10321316|Ga0207684_103213161
Length 386
Sequence MHTLAFHGRLPAFINSCRFLLRFNLTFDRHPVPACRKKFAGLLPLPQARIMAVCQGRGMNNRRKLVIALGAGALAWAGAVRAQTPSTVRRIGLFSQSSPSVNAPSYQAFRLGLRELGWVEGKNISIEYRYAEGRHDRLLDLAADLVRLKVDVIVTFATSDTLAAQKATSAIPIVMAGGSDPVESGLVESLARSGGNVTGLSQMIVELAGKRLELLKEIVPALSRVAVLWNPLSVSATLNWKEIQQPARQLGIQLHSLEVRSPNEFDQALEDAIRARAGALVTLADPVTGANLKRIAGLAAKSRLPSIYHDSAFADAGGLLTYGAHRPDLYRRAATYVDKILKGAKPGDLPIEQPTKFELVINLQTAKALGITIPQSVRFRADRVIE

Samples

Sample ID Description Type Environment
1 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
131 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
132 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
133 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
134 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
135 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
136 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
144 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
145 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
146 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
147 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
150 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
151 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
152 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
153 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
154 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
155 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
156 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
157 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
163 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
178 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
179 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
180 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
181 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
182 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
183 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
186 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
190 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
191 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
194 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
195 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
196 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
197 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
198 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
199 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
200 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.18
Rhizosphere 92.82
Stem 0
Stem Tuber 0
Unclassified 17.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207684_10321316 3300025910 Bacteria 1334
2 Ga0070676_10113337 3300005328 Bacteria 1692
3 Ga0070676_10163486 3300005328 Bacteria 1434
4 Ga0070690_100123929 3300005330 Bacteria 1738
5 Ga0070690_100326706 3300005330 Bacteria 1107
6 Ga0070670_100012091 3300005331 Bacteria 7381
7 Ga0070670_100020627 3300005331 Bacteria 5668
8 Ga0070670_100030873 3300005331 Bacteria 4615
9 Ga0070670_100032552 3300005331 Bacteria 4490
10 Ga0070670_100045316 3300005331 Bacteria 3780
11 Ga0070670_100051510 3300005331 Bacteria 3535
12 Ga0070670_100107310 3300005331 Bacteria 2406
13 Ga0070670_100131481 3300005331 Unclassified 2161
14 Ga0070670_100233716 3300005331 Bacteria 1600
15 Ga0070670_100396556 3300005331 Unclassified 1218
16 Ga0068869_100039065 3300005334 Bacteria 3386
17 Ga0068869_100134939 3300005334 Bacteria 1901
18 Ga0068869_100170428 3300005334 Unclassified 1700
19 Ga0068869_100270764 3300005334 Unclassified 1362
20 Ga0068868_100005884 3300005338 Bacteria 8648
21 Ga0068868_100229555 3300005338 Bacteria 1557
22 Ga0070687_100143049 3300005343 Unclassified 1395
23 Ga0070661_100278714 3300005344 Unclassified 1296
24 Ga0070692_10005941 3300005345 Bacteria 5257
25 Ga0070692_10181956 3300005345 Bacteria 1219
26 Ga0070668_100157315 3300005347 Bacteria 1842
27 Ga0070668_100404847 3300005347 Unclassified 1166
28 Ga0070669_100039183 3300005353 Bacteria 3442
29 Ga0070669_100098961 3300005353 Bacteria 2197
30 Ga0070669_100370371 3300005353 Unclassified 1167
31 Ga0070675_100014757 3300005354 Bacteria 6164
32 Ga0070675_100033435 3300005354 Unclassified 4169
33 Ga0070675_100052986 3300005354 Unclassified 3336
34 Ga0070675_100087907 3300005354 Bacteria 2599
35 Ga0070675_100232755 3300005354 Bacteria 1608
36 Ga0070675_100361763 3300005354 Bacteria 1288
37 Ga0070671_100077921 3300005355 Bacteria 2770
38 Ga0070671_100092277 3300005355 Unclassified 2537
39 Ga0070671_100139764 3300005355 Bacteria 2043
40 Ga0070674_100053331 3300005356 Unclassified 2791
41 Ga0070674_100102625 3300005356 Bacteria 2086
42 Ga0070673_100010895 3300005364 Bacteria 6181
43 Ga0070673_100066479 3300005364 Bacteria 2880
44 Ga0070673_100155460 3300005364 Bacteria 1941
45 Ga0070673_100187265 3300005364 Unclassified 1775
46 Ga0070673_100250168 3300005364 Bacteria 1544
47 Ga0070667_100073951 3300005367 Bacteria 2907
48 Ga0070713_100095549 3300005436 Bacteria 2564
49 Ga0070710_10005049 3300005437 Bacteria 6246
50 Ga0070711_100008886 3300005439 Bacteria 6165
51 Ga0070700_100260921 3300005441 Bacteria 1248
52 Ga0070694_100040841 3300005444 Bacteria 3093
53 Ga0070694_100107457 3300005444 Bacteria 1983
54 Ga0070694_100303248 3300005444 Bacteria 1225
55 Ga0070708_100069095 3300005445 Bacteria 3176
56 Ga0070708_100144665 3300005445 Bacteria 2207
57 Ga0070708_100330836 3300005445 Bacteria 1435
58 Ga0070678_100008592 3300005456 Bacteria 6122
59 Ga0070678_100022781 3300005456 Bacteria 4160
60 Ga0070678_100088218 3300005456 Bacteria 2371
61 Ga0070678_100096344 3300005456 Bacteria 2282
62 Ga0070662_100143368 3300005457 Bacteria 1854
63 Ga0070662_100337125 3300005457 Unclassified 1233
64 Ga0068867_100198849 3300005459 Unclassified 1603
65 Ga0068867_100236135 3300005459 Unclassified 1480
66 Ga0068867_100249137 3300005459 Bacteria 1444
67 Ga0070685_10162509 3300005466 Bacteria 1424
68 Ga0070685_10227660 3300005466 Bacteria 1224
69 Ga0070706_100153138 3300005467 Bacteria 2152
70 Ga0070706_100247875 3300005467 Bacteria 1663
71 Ga0070707_100027184 3300005468 Bacteria 5441
72 Ga0070707_100066589 3300005468 Bacteria 3462
73 Ga0070707_100076430 3300005468 Bacteria 3230
74 Ga0070707_100151378 3300005468 Bacteria 2259
75 Ga0070707_100295430 3300005468 Bacteria 1574
76 Ga0070698_100027468 3300005471 Bacteria 5918
77 Ga0070698_100043663 3300005471 Bacteria 4595
78 Ga0070698_100082451 3300005471 Bacteria 3208
79 Ga0070698_100334555 3300005471 Bacteria 1445
80 Ga0070699_100006441 3300005518 Bacteria 10224
81 Ga0070699_100010936 3300005518 Bacteria 7850
82 Ga0070699_100017554 3300005518 Bacteria 6143
83 Ga0070699_100116862 3300005518 Bacteria 2344
84 Ga0070697_100031198 3300005536 Bacteria 4285
85 Ga0070697_100127152 3300005536 Bacteria 2135
86 Ga0070697_100162593 3300005536 Unclassified 1886
87 Ga0070672_100089701 3300005543 Unclassified 2477
88 Ga0070672_100093561 3300005543 Bacteria 2428
89 Ga0070672_100173736 3300005543 Bacteria 1793
90 Ga0070672_100226629 3300005543 Bacteria 1569
91 Ga0070672_100240906 3300005543 Bacteria 1521
92 Ga0070695_100086424 3300005545 Unclassified 2084
93 Ga0070695_100235882 3300005545 Bacteria 1325
94 Ga0070696_100233783 3300005546 Bacteria 1384
95 Ga0070665_100132036 3300005548 Bacteria 2499
96 Ga0070665_100267594 3300005548 Bacteria 1711
97 Ga0070665_100439129 3300005548 Bacteria 1314
98 Ga0070704_100063874 3300005549 Bacteria 2644
99 Ga0070704_100076917 3300005549 Bacteria 2443
100 Ga0070704_100290793 3300005549 Bacteria 1358
101 Ga0070664_100054841 3300005564 Bacteria 3384
102 Ga0070664_100115896 3300005564 Bacteria 2342
103 Ga0070664_100265006 3300005564 Bacteria 1546
104 Ga0070664_100396079 3300005564 Unclassified 1262
105 Ga0068852_100135366 3300005616 Unclassified 2274
106 Ga0068852_100224874 3300005616 Bacteria 1786
107 Ga0068864_100010228 3300005618 Bacteria 7748
108 Ga0068864_100040554 3300005618 Bacteria 3982
109 Ga0068864_100047271 3300005618 Bacteria 3695
110 Ga0068864_100048413 3300005618 Bacteria 3654
111 Ga0068864_100057139 3300005618 Bacteria 3371
112 Ga0068864_100066986 3300005618 Bacteria 3118
113 Ga0068864_100086243 3300005618 Bacteria 2762
114 Ga0068864_100112606 3300005618 Bacteria 2425
115 Ga0068864_100131032 3300005618 Unclassified 2252
116 Ga0068864_100185774 3300005618 Unclassified 1903
117 Ga0068864_100344345 3300005618 Unclassified 1405
118 Ga0068864_100481760 3300005618 Bacteria 1191
119 Ga0068866_10033197 3300005718 Bacteria 2501
120 Ga0068866_10147853 3300005718 Bacteria 1357
121 Ga0068863_100037559 3300005841 Bacteria 4611
122 Ga0068863_100047262 3300005841 Bacteria 4083
123 Ga0068863_100057132 3300005841 Unclassified 3693
124 Ga0068863_100080363 3300005841 Bacteria 3088
125 Ga0068863_100082084 3300005841 Bacteria 3054
126 Ga0068863_100149680 3300005841 Unclassified 2233
127 Ga0068863_100197796 3300005841 Unclassified 1933
128 Ga0068863_100229179 3300005841 Bacteria 1791
129 Ga0068863_100484422 3300005841 Bacteria 1217
130 Ga0068860_100350564 3300005843 Bacteria 1453
131 Ga0068862_100230360 3300005844 Bacteria 1680
132 Ga0081455_10016238 3300005937 Bacteria 7194
133 Ga0081455_10040004 3300005937 Bacteria 4139
134 Ga0081455_10155693 3300005937 Bacteria 1757
135 Ga0081540_1010750 3300005983 Bacteria 6161
136 Ga0070717_10293753 3300006028 Bacteria 1443
137 Ga0075432_10023849 3300006058 Bacteria 2096
138 Ga0070716_100058489 3300006173 Bacteria 2219
139 Ga0070712_100086146 3300006175 Bacteria 2289
140 Ga0070712_100307441 3300006175 Unclassified 1285
141 Ga0075427_10001725 3300006194 Bacteria 2844
142 Ga0097621_100015423 3300006237 Bacteria 5748
143 Ga0097621_100019289 3300006237 Bacteria 5231
144 Ga0097621_100019494 3300006237 Bacteria 5206
145 Ga0097621_100057930 3300006237 Unclassified 3170
146 Ga0068871_100002419 3300006358 Bacteria 12747
147 Ga0068871_100067028 3300006358 Bacteria 2943
148 Ga0068871_100108595 3300006358 Bacteria 2332
149 Ga0068871_100191000 3300006358 Bacteria 1764
150 Ga0075430_100000260 3300006846 Bacteria 37092
151 Ga0075430_100175224 3300006846 Unclassified 1784
152 Ga0075431_100003631 3300006847 Bacteria 14954
153 Ga0075433_10010081 3300006852 Bacteria 7572
154 Ga0075433_10014757 3300006852 Bacteria 6394
155 Ga0075433_10070543 3300006852 Bacteria 3071
156 Ga0075434_100000992 3300006871 Bacteria 22984
157 Ga0075434_100034826 3300006871 Bacteria 4975
158 Ga0075434_100040929 3300006871 Bacteria 4588
159 Ga0075434_100131790 3300006871 Bacteria 2519
160 Ga0075434_100248660 3300006871 Bacteria 1797
161 Ga0075434_100265378 3300006871 Bacteria 1736
162 Ga0075429_100000023 3300006880 Bacteria 68064
163 Ga0075429_100053629 3300006880 Bacteria 3508
164 Ga0075429_100073604 3300006880 Bacteria 2975
165 Ga0075429_100101613 3300006880 Unclassified 2510
166 Ga0068865_100005745 3300006881 Bacteria 7541
167 Ga0075435_100008517 3300007076 Bacteria 7366
168 Ga0075435_100031799 3300007076 Bacteria 4162
169 Ga0075435_100037477 3300007076 Bacteria 3861
170 Ga0075435_100093425 3300007076 Unclassified 2485
171 Ga0075435_100122072 3300007076 Bacteria 2175
172 Ga0075435_100127530 3300007076 Bacteria 2127
173 Ga0099794_10001340 3300007265 Bacteria 8540
174 Ga0099794_10004752 3300007265 Bacteria 5381
175 Ga0111539_10123221 3300009094 Unclassified 3038
176 Ga0111539_10404809 3300009094 Bacteria 1589
177 Ga0111539_10808862 3300009094 Bacteria 1091
178 Ga0105247_10032474 3300009101 Bacteria 3172
179 Ga0105247_10077531 3300009101 Bacteria 2089
180 Ga0114129_10005717 3300009147 Bacteria 17619
181 Ga0114129_10037657 3300009147 Bacteria 6828
182 Ga0114129_10040065 3300009147 Bacteria 6606
183 Ga0114129_10117084 3300009147 Bacteria 3672
184 Ga0114129_10126095 3300009147 Bacteria 3519
185 Ga0114129_10139071 3300009147 Bacteria 3330
186 Ga0114129_10621574 3300009147 Unclassified 1397
187 Ga0105243_10085533 3300009148 Bacteria 2585
188 Ga0105241_10138998 3300009174 Bacteria 1976
189 Ga0105242_10092970 3300009176 Bacteria 2542
190 Ga0105248_10063971 3300009177 Bacteria 4130
191 Ga0105248_10110949 3300009177 Unclassified 3093
192 Ga0105248_10140953 3300009177 Bacteria 2719
193 Ga0105248_10152500 3300009177 Bacteria 2607
194 Ga0105248_10195504 3300009177 Unclassified 2279
195 Ga0105248_10454453 3300009177 Unclassified 1443
196 Ga0105237_10264394 3300009545 Bacteria 1723
197 Ga0105238_10096525 3300009551 Unclassified 2942
198 Ga0105249_10154718 3300009553 Unclassified 2210
199 Ga0105239_10223368 3300010375 Bacteria 2112
200 Ga0105246_10302821 3300011119 Bacteria 1291
201 Ga0157374_10021349 3300013296 Bacteria 5760
202 Ga0157374_10074159 3300013296 Unclassified 3212
203 Ga0157374_10127396 3300013296 Bacteria 2461
204 Ga0157374_10136175 3300013296 Bacteria 2381
205 Ga0157378_10041260 3300013297 Bacteria 4093
206 Ga0157378_10166285 3300013297 Bacteria 2066
207 Ga0163162_10098759 3300013306 Unclassified 3010
208 Ga0163162_10189625 3300013306 Bacteria 2183
209 Ga0163162_10232963 3300013306 Unclassified 1972
210 Ga0163162_10307977 3300013306 Unclassified 1716
211 Ga0163162_10401893 3300013306 Unclassified 1502
212 Ga0163162_10528634 3300013306 Bacteria 1308
213 Ga0163162_10913189 3300013306 Unclassified 991
214 Ga0157375_10005862 3300013308 Bacteria 10696
215 Ga0157375_10020542 3300013308 Bacteria 6035
216 Ga0157375_10037943 3300013308 Bacteria 4623
217 Ga0157375_10086434 3300013308 Bacteria 3186
218 Ga0157375_10109623 3300013308 Unclassified 2857
219 Ga0157375_10189578 3300013308 Unclassified 2210
220 Ga0157375_10257211 3300013308 Unclassified 1907
221 Ga0157375_10281134 3300013308 Unclassified 1827
222 Ga0157375_10433366 3300013308 Unclassified 1480
223 Ga0163163_10040686 3300014325 Bacteria 4540
224 Ga0163163_10041003 3300014325 Bacteria 4525
225 Ga0163163_10042843 3300014325 Bacteria 4435
226 Ga0163163_10059832 3300014325 Unclassified 3769
227 Ga0163163_10246117 3300014325 Unclassified 1838
228 Ga0163163_10414804 3300014325 Bacteria 1405
229 Ga0182008_10002547 3300014497 Bacteria 11360
230 Ga0157377_10023029 3300014745 Bacteria 3296
231 Ga0157379_10046788 3300014968 Bacteria 3860
232 Ga0157379_10202220 3300014968 Bacteria 1796
233 Ga0157376_10023195 3300014969 Bacteria 4854
234 Ga0157376_10024918 3300014969 Bacteria 4705
235 Ga0157376_10089032 3300014969 Unclassified 2668
236 Ga0157376_10101428 3300014969 Bacteria 2515
237 Ga0157376_10165476 3300014969 Bacteria 2009
238 Ga0157376_10358394 3300014969 Unclassified 1398
239 Ga0157376_10481796 3300014969 Bacteria 1216
240 Ga0182007_10003949 3300015262 Bacteria 6849
241 Ga0163161_10005277 3300017792 Bacteria 8994
242 Ga0163161_10331241 3300017792 Bacteria 1206
243 Ga0207697_10044826 3300025315 Bacteria 1820
244 Ga0207697_10055788 3300025315 Bacteria 1638
245 Ga0207653_10014815 3300025885 Bacteria 2447
246 Ga0207692_10099146 3300025898 Bacteria 1596
247 Ga0207642_10041714 3300025899 Bacteria 2012
248 Ga0207642_10199821 3300025899 Bacteria 1103
249 Ga0207688_10019484 3300025901 Bacteria 3698
250 Ga0207688_10045890 3300025901 Bacteria 2439
251 Ga0207688_10113212 3300025901 Bacteria 1577
252 Ga0207680_10175049 3300025903 Bacteria 1448
253 Ga0207680_10225721 3300025903 Unclassified 1286
254 Ga0207685_10003100 3300025905 Bacteria 3971
255 Ga0207699_10074343 3300025906 Bacteria 2087
256 Ga0207645_10026061 3300025907 Bacteria 3780
257 Ga0207645_10033398 3300025907 Bacteria 3307
258 Ga0207645_10073124 3300025907 Bacteria 2195
259 Ga0207645_10096363 3300025907 Unclassified 1906
260 Ga0207643_10010294 3300025908 Bacteria 5032
261 Ga0207684_10004820 3300025910 Bacteria 12624
262 Ga0207684_10010533 3300025910 Bacteria 8127
263 Ga0207684_10022872 3300025910 Bacteria 5337
264 Ga0207684_10024401 3300025910 Bacteria 5156
265 Ga0207684_10051765 3300025910 Bacteria 3484
266 Ga0207684_10104472 3300025910 Bacteria 2422
267 Ga0207684_10208930 3300025910 Bacteria 1684
268 Ga0207671_10169569 3300025914 Bacteria 1694
269 Ga0207693_10203848 3300025915 Bacteria 1555
270 Ga0207662_10185377 3300025918 Bacteria 1341
271 Ga0207646_10019638 3300025922 Bacteria 6276
272 Ga0207646_10029755 3300025922 Bacteria 4958
273 Ga0207646_10123792 3300025922 Bacteria 2324
274 Ga0207646_10297903 3300025922 Bacteria 1457
275 Ga0207646_10319080 3300025922 Bacteria 1404
276 Ga0207681_10018915 3300025923 Bacteria 4344
277 Ga0207681_10023165 3300025923 Unclassified 3969
278 Ga0207681_10188072 3300025923 Bacteria 1578
279 Ga0207681_10199229 3300025923 Unclassified 1536
280 Ga0207650_10014120 3300025925 Bacteria 5548
281 Ga0207650_10014482 3300025925 Bacteria 5480
282 Ga0207650_10026670 3300025925 Bacteria 4124
283 Ga0207650_10067080 3300025925 Unclassified 2692
284 Ga0207650_10075704 3300025925 Unclassified 2541
285 Ga0207650_10082460 3300025925 Bacteria 2441
286 Ga0207650_10109296 3300025925 Unclassified 2138
287 Ga0207659_10016754 3300025926 Unclassified 4775
288 Ga0207659_10018165 3300025926 Bacteria 4606
289 Ga0207659_10034722 3300025926 Bacteria 3480
290 Ga0207659_10159006 3300025926 Bacteria 1772
291 Ga0207659_10164229 3300025926 Bacteria 1746
292 Ga0207659_10209660 3300025926 Unclassified 1561
293 Ga0207659_10356145 3300025926 Bacteria 1215
294 Ga0207700_10092047 3300025928 Bacteria 2396
295 Ga0207664_10058800 3300025929 Bacteria 3060
296 Ga0207644_10058326 3300025931 Bacteria 2790
297 Ga0207644_10171700 3300025931 Bacteria 1693
298 Ga0207706_10168165 3300025933 Bacteria 1927
299 Ga0207706_10274394 3300025933 Unclassified 1471
300 Ga0207706_10364213 3300025933 Bacteria 1256
301 Ga0207709_10039998 3300025935 Bacteria 2805
302 Ga0207709_10136534 3300025935 Bacteria 1680
303 Ga0207669_10129009 3300025937 Bacteria 1733
304 Ga0207704_10092233 3300025938 Bacteria 1993
305 Ga0207665_10024630 3300025939 Bacteria 3969
306 Ga0207691_10028882 3300025940 Bacteria 5190
307 Ga0207691_10039949 3300025940 Bacteria 4339
308 Ga0207691_10121845 3300025940 Bacteria 2310
309 Ga0207691_10147294 3300025940 Bacteria 2072
310 Ga0207691_10463374 3300025940 Bacteria 1078
311 Ga0207711_10055209 3300025941 Bacteria 3411
312 Ga0207711_10076742 3300025941 Unclassified 2911
313 Ga0207711_10130260 3300025941 Bacteria 2255
314 Ga0207711_10219121 3300025941 Bacteria 1740
315 Ga0207711_10265126 3300025941 Unclassified 1580
316 Ga0207711_10441982 3300025941 Bacteria 1210
317 Ga0207689_10035420 3300025942 Bacteria 4147
318 Ga0207689_10036474 3300025942 Bacteria 4081
319 Ga0207689_10036544 3300025942 Bacteria 4076
320 Ga0207689_10098254 3300025942 Bacteria 2405
321 Ga0207689_10234144 3300025942 Bacteria 1518
322 Ga0207679_10244827 3300025945 Unclassified 1521
323 Ga0207679_10347676 3300025945 Unclassified 1291
324 Ga0207651_10098025 3300025960 Bacteria 2166
325 Ga0207651_10100977 3300025960 Bacteria 2140
326 Ga0207651_10105362 3300025960 Bacteria 2103
327 Ga0207651_10114119 3300025960 Bacteria 2034
328 Ga0207651_10127830 3300025960 Bacteria 1939
329 Ga0207668_10205074 3300025972 Unclassified 1573
330 Ga0207640_10108319 3300025981 Unclassified 1963
331 Ga0207677_10019705 3300026023 Unclassified 4080
332 Ga0207677_10443872 3300026023 Bacteria 1110
333 Ga0207708_10073342 3300026075 Bacteria 2623
334 Ga0207708_10215147 3300026075 Bacteria 1537
335 Ga0207641_10026067 3300026088 Unclassified 4823
336 Ga0207641_10030414 3300026088 Bacteria 4473
337 Ga0207641_10144481 3300026088 Bacteria 2150
338 Ga0207641_10164333 3300026088 Bacteria 2020
339 Ga0207641_10265273 3300026088 Bacteria 1609
340 Ga0207648_10111252 3300026089 Bacteria 2404
341 Ga0207648_10246242 3300026089 Unclassified 1593
342 Ga0207676_10006027 3300026095 Bacteria 8548
343 Ga0207676_10014903 3300026095 Bacteria 5599
344 Ga0207676_10022131 3300026095 Bacteria 4673
345 Ga0207676_10035921 3300026095 Unclassified 3766
346 Ga0207676_10072341 3300026095 Bacteria 2771
347 Ga0207676_10133204 3300026095 Bacteria 2116
348 Ga0207676_10154657 3300026095 Unclassified 1979
349 Ga0207676_10278542 3300026095 Bacteria 1517
350 Ga0207676_10439631 3300026095 Unclassified 1227
351 Ga0207675_100122127 3300026118 Bacteria 2465
352 Ga0207675_100199073 3300026118 Bacteria 1924
353 Ga0207683_10010524 3300026121 Bacteria 7894
354 Ga0207683_10041084 3300026121 Bacteria 4037
355 Ga0207683_10043031 3300026121 Bacteria 3945
356 Ga0207683_10064911 3300026121 Bacteria 3218
357 Ga0207683_10239180 3300026121 Bacteria 1656
358 Ga0207683_10403756 3300026121 Unclassified 1257
359 Ga0207683_10429718 3300026121 Unclassified 1217
360 Ga0207698_10230980 3300026142 Bacteria 1679
361 Ga0209588_1003078 3300027671 Bacteria 4598
362 Ga0209588_1017495 3300027671 Bacteria 2223
363 Ga0207428_10001287 3300027907 Bacteria 26772
364 Ga0268266_10102785 3300028379 Bacteria 2521
365 Ga0268266_10340965 3300028379 Bacteria 1407
366 Ga0268266_10401033 3300028379 Bacteria 1297
367 Ga0268265_10058578 3300028380 Bacteria 2942
368 Ga0268264_10403539 3300028381 Unclassified 1314
369 Ga0307409_100256478 3300031995 Bacteria 1602
370 Ga0307411_10082885 3300032005 Bacteria 2213
371 Ga0373956_0046459 3300035119 Bacteria 1940
372 Ga0373955_0057487 3300035172 Bacteria 2137
373 Ga0373935_0134636 3300035692 Bacteria 1664
374 Ga0373927_0213238 3300035695 Bacteria 1268
375 Ga0373927_0258741 3300035695 Unclassified 1144
376 Ga0373933_0097576 3300035724 Bacteria 1820
377 Ga0373947_0104787 3300035725 Bacteria 1781
378 Ga0373947_0300836 3300035725 Bacteria 1070
379 Ga0373937_0000934 3300036401 Bacteria 24791
380 Ga0373937_0144309 3300036401 Bacteria 2228
381 Ga0373925_0275095 3300037068 Bacteria 1355
382 Ga0395899_0025249 3300037312 Bacteria 4486
383 Ga0395900_0041266 3300037418 Bacteria 4757
384 Ga0395898_0376178 3300037466 Bacteria 1354
385 Ga0395901_0415357 3300038443 Bacteria 1380
386 Ga0439435_0000259 3300042436 Bacteria 7722
387 Ga0439460_0027350 3300042461 Bacteria 1602
388 Ga0453683_0091065 3300044673 Bacteria 1911
389 Ga0451576_0066754 3300045051 Bacteria 3745
390 Ga0495641_0081145 3300046461 Unclassified 1453
391 Ga0495580_0005119 3300046472 Bacteria 10910
392 Ga0495630_0232686 3300046517 Bacteria 1408
393 Ga0495652_0243551 3300046529 Bacteria 1336
394 Ga0495598_0015371 3300046537 Bacteria 1932
395 Ga0495667_0023130 3300046559 Bacteria 4188
396 Ga0495635_0022733 3300046663 Bacteria 4371
397 Ga0495588_0058771 3300046674 Bacteria 1988
398 Ga0495647_0129212 3300046681 Bacteria 1069
399 Ga0495636_0038160 3300047318 Unclassified 1986
400 Ga0495593_0165065 3300047673 Unclassified 1117
401 Ga0496100_0068380 3300048903 Bacteria 2362
402 Ga0496100_0379492 3300048903 Bacteria 1073
403 Ga0496102_0111880 3300048905 Bacteria 2546
404 Ga0496104_0006181 3300048907 Bacteria 10516
405 Ga0496104_0080144 3300048907 Bacteria 3113
406 Ga0496105_0000538 3300048908 Bacteria 24990
407 Ga0496105_0055806 3300048908 Bacteria 3261
408 Ga0496105_0313912 3300048908 Bacteria 1258
409 Ga0496106_0151230 3300048909 Bacteria 1831
410 Ga0496106_0477912 3300048909 Bacteria 1001
411 Ga0496107_0066756 3300048910 Bacteria 2608
412 Ga0496107_0416620 3300048910 Bacteria 999
413 Ga0496108_0020061 3300048911 Bacteria 5493
414 Ga0496108_0057942 3300048911 Bacteria 3255
415 Ga0496108_0151632 3300048911 Bacteria 2000
416 Ga0496108_0410552 3300048911 Bacteria 1183
417 Ga0496109_0042573 3300048912 Bacteria 4114
418 Ga0496109_0055127 3300048912 Bacteria 3626
419 Ga0496109_0129753 3300048912 Bacteria 2352
420 Ga0496109_0559296 3300048912 Bacteria 1079
421 Ga0496110_0052953 3300048913 Bacteria 3566
422 Ga0496110_0164366 3300048913 Bacteria 2012
423 Ga0496110_0388993 3300048913 Bacteria 1271
424 Ga0496110_0501010 3300048913 Bacteria 1106
425 Ga0496111_0022815 3300048914 Bacteria 4385
426 Ga0496111_0102862 3300048914 Bacteria 2100
427 Ga0496111_0175270 3300048914 Bacteria 1594
428 Ga0496112_0028637 3300048915 Bacteria 5378
429 Ga0496112_0107155 3300048915 Bacteria 2764
430 Ga0496112_0328584 3300048915 Bacteria 1473
431 Ga0496112_0373986 3300048915 Unclassified 1366
432 Ga0496113_0026632 3300048916 Bacteria 4136
433 Ga0496113_0324359 3300048916 Bacteria 1234
434 Ga0496114_0008838 3300048917 Bacteria 7984
435 Ga0496114_0219679 3300048917 Unclassified 1668
436 Ga0496114_0425608 3300048917 Bacteria 1176
437 Ga0496115_0277619 3300048918 Bacteria 1376
438 Ga0501033_0094240 3300049570 Bacteria 2190
439 Ga0501036_0076511 3300049572 Bacteria 2831
440 Ga0501040_0011225 3300049576 Bacteria 5862
441 Ga0501041_0002578 3300049577 Bacteria 10336
442 Ga0501041_0043945 3300049577 Bacteria 2716
443 Ga0501048_0134347 3300049582 Bacteria 1748
444 Ga0501071_0043945 3300049587 Bacteria 3205
445 Ga0501071_0137639 3300049587 Bacteria 1817
446 Ga0501072_0021052 3300049588 Bacteria 5058
447 Ga0501072_0130123 3300049588 Bacteria 2006
448 Ga0501074_0080859 3300049590 Bacteria 2331
449 Ga0501075_0057182 3300049591 Bacteria 2937
450 Ga0501076_0002136 3300049592 Bacteria 13570
451 Ga0501076_0015410 3300049592 Bacteria 5776
452 Ga0501077_0001151 3300049593 Bacteria 15963
453 Ga0501077_0026042 3300049593 Bacteria 3711
454 Ga0501079_0002877 3300049741 Bacteria 12561
455 Ga0501079_0004332 3300049741 Bacteria 10531
456 Ga0501080_0028191 3300049742 Bacteria 5222
457 Ga0501080_0224102 3300049742 Bacteria 1720
458 Ga0501081_0000139 3300049743 Bacteria 32505
459 Ga0501081_0001461 3300049743 Bacteria 14477
460 Ga0501035_0094980 3300049822 Bacteria 2621
461 Ga0501045_0079330 3300049824 Bacteria 2420
462 Ga0501045_0080251 3300049824 Bacteria 2405
463 nmdc:mga05p37_130889_c1 3300050507 Bacteria 3078
464 nmdc:mga05p37_13239_c1 3300050507 Bacteria 9875
465 nmdc:mga05p37_134273_c1 3300050507 Bacteria 3036
466 nmdc:mga05p37_169114_c1 3300050507 Unclassified 2667
467 nmdc:mga05p37_318557_c1 3300050507 Unclassified 1841
468 nmdc:mga05p37_37331_c1 3300050507 Bacteria 5956
469 nmdc:mga05p37_397237_c1 3300050507 Bacteria 1611
470 nmdc:mga05p37_40406_c1 3300050507 Bacteria 5729
471 nmdc:mga05p37_409311_c1 3300050507 Bacteria 1581
472 nmdc:mga05p37_98739_c1 3300050507 Bacteria 3596
473 nmdc:mga09592_2019_c1 3300050508 Bacteria 16369
474 nmdc:mga09592_30615_c1 3300050508 Unclassified 4479
475 nmdc:mga09592_63738_c1 3300050508 Bacteria 3120
476 nmdc:mga09592_7634_c1 3300050508 Bacteria 8794
477 nmdc:mga0qj67_24112_c1 3300050509 Bacteria 4688
478 nmdc:mga06r32_110977_c1 3300050510 Bacteria 2698
479 nmdc:mga08y16_339281_c1 3300050511 Bacteria 1545
480 nmdc:mga08y16_98036_c1 3300050511 Bacteria 3053
481 nmdc:mga0n895_31616_c1 3300050512 Bacteria 5070
482 nmdc:mga0n895_37818_c1 3300050512 Unclassified 4672
483 nmdc:mga0n895_68835_c1 3300050512 Bacteria 3507
484 nmdc:mga0n895_891_c1 3300050512 Bacteria 21503
485 nmdc:mga0rr50_11500_c1 3300050513 Bacteria 5671
486 nmdc:mga0rr50_12931_c1 3300050513 Bacteria 5414
487 nmdc:mga0rr50_166405_c1 3300050513 Bacteria 1793
488 nmdc:mga0rr50_251598_c1 3300050513 Bacteria 1468
489 nmdc:mga0rr50_350917_c1 3300050513 Bacteria 1241
490 nmdc:mga0rr50_43937_c1 3300050513 Bacteria 3274
491 nmdc:mga08x19_29481_c1 3300050514 Bacteria 3442
492 nmdc:mga0a205_172603_c1 3300050515 Bacteria 2058
493 nmdc:mga0a205_269705_c1 3300050515 Bacteria 1579
494 nmdc:mga0a205_3636_c1 3300050515 Bacteria 13807
495 nmdc:mga0a205_8669_c1 3300050515 Bacteria 9258
496 nmdc:mga0a205_89679_c1 3300050515 Bacteria 2972
497 Ga0495601_0019934 3300053077 Bacteria 4093
498 Ga0501084_0004619 3300054114 Bacteria 11250
499 Ga0501084_0048028 3300054114 Bacteria 3574
500 Ga0501082_0000526 3300060353 Bacteria 34036
501 Ga0501082_0010186 3300060353 Bacteria 8096
502 Ga0530510_0000479 3300061734 Bacteria 25666
503 Ga0207684_10321316
504 Ga0070676_10113337
505 Ga0070676_10163486
506 Ga0070690_100123929
507 Ga0070690_100326706
508 Ga0070670_100012091
509 Ga0070670_100020627
510 Ga0070670_100030873
511 Ga0070670_100032552
512 Ga0070670_100045316
513 Ga0070670_100051510
514 Ga0070670_100107310
515 Ga0070670_100131481
516 Ga0070670_100233716
517 Ga0070670_100396556
518 Ga0068869_100039065
519 Ga0068869_100134939
520 Ga0068869_100170428
521 Ga0068869_100270764
522 Ga0068868_100005884
523 Ga0068868_100229555
524 Ga0070687_100143049
525 Ga0070661_100278714
526 Ga0070692_10005941
527 Ga0070692_10181956
528 Ga0070668_100157315
529 Ga0070668_100404847
530 Ga0070669_100039183
531 Ga0070669_100098961
532 Ga0070669_100370371
533 Ga0070675_100014757
534 Ga0070675_100033435
535 Ga0070675_100052986
536 Ga0070675_100087907
537 Ga0070675_100232755
538 Ga0070675_100361763
539 Ga0070671_100077921
540 Ga0070671_100092277
541 Ga0070671_100139764
542 Ga0070674_100053331
543 Ga0070674_100102625
544 Ga0070673_100010895
545 Ga0070673_100066479
546 Ga0070673_100155460
547 Ga0070673_100187265
548 Ga0070673_100250168
549 Ga0070667_100073951
550 Ga0070713_100095549
551 Ga0070710_10005049
552 Ga0070711_100008886
553 Ga0070700_100260921
554 Ga0070694_100040841
555 Ga0070694_100107457
556 Ga0070694_100303248
557 Ga0070708_100069095
558 Ga0070708_100144665
559 Ga0070708_100330836
560 Ga0070678_100008592
561 Ga0070678_100022781
562 Ga0070678_100088218
563 Ga0070678_100096344
564 Ga0070662_100143368
565 Ga0070662_100337125
566 Ga0068867_100198849
567 Ga0068867_100236135
568 Ga0068867_100249137
569 Ga0070685_10162509
570 Ga0070685_10227660
571 Ga0070706_100153138
572 Ga0070706_100247875
573 Ga0070707_100027184
574 Ga0070707_100066589
575 Ga0070707_100076430
576 Ga0070707_100151378
577 Ga0070707_100295430
578 Ga0070698_100027468
579 Ga0070698_100043663
580 Ga0070698_100082451
581 Ga0070698_100334555
582 Ga0070699_100006441
583 Ga0070699_100010936
584 Ga0070699_100017554
585 Ga0070699_100116862
586 Ga0070697_100031198
587 Ga0070697_100127152
588 Ga0070697_100162593
589 Ga0070672_100089701
590 Ga0070672_100093561
591 Ga0070672_100173736
592 Ga0070672_100226629
593 Ga0070672_100240906
594 Ga0070695_100086424
595 Ga0070695_100235882
596 Ga0070696_100233783
597 Ga0070665_100132036
598 Ga0070665_100267594
599 Ga0070665_100439129
600 Ga0070704_100063874
601 Ga0070704_100076917
602 Ga0070704_100290793
603 Ga0070664_100054841
604 Ga0070664_100115896
605 Ga0070664_100265006
606 Ga0070664_100396079
607 Ga0068852_100135366
608 Ga0068852_100224874
609 Ga0068864_100010228
610 Ga0068864_100040554
611 Ga0068864_100047271
612 Ga0068864_100048413
613 Ga0068864_100057139
614 Ga0068864_100066986
615 Ga0068864_100086243
616 Ga0068864_100112606
617 Ga0068864_100131032
618 Ga0068864_100185774
619 Ga0068864_100344345
620 Ga0068864_100481760
621 Ga0068866_10033197
622 Ga0068866_10147853
623 Ga0068863_100037559
624 Ga0068863_100047262
625 Ga0068863_100057132
626 Ga0068863_100080363
627 Ga0068863_100082084
628 Ga0068863_100149680
629 Ga0068863_100197796
630 Ga0068863_100229179
631 Ga0068863_100484422
632 Ga0068860_100350564
633 Ga0068862_100230360
634 Ga0081455_10016238
635 Ga0081455_10040004
636 Ga0081455_10155693
637 Ga0081540_1010750
638 Ga0070717_10293753
639 Ga0075432_10023849
640 Ga0070716_100058489
641 Ga0070712_100086146
642 Ga0070712_100307441
643 Ga0075427_10001725
644 Ga0097621_100015423
645 Ga0097621_100019289
646 Ga0097621_100019494
647 Ga0097621_100057930
648 Ga0068871_100002419
649 Ga0068871_100067028
650 Ga0068871_100108595
651 Ga0068871_100191000
652 Ga0075430_100000260
653 Ga0075430_100175224
654 Ga0075431_100003631
655 Ga0075433_10010081
656 Ga0075433_10014757
657 Ga0075433_10070543
658 Ga0075434_100000992
659 Ga0075434_100034826
660 Ga0075434_100040929
661 Ga0075434_100131790
662 Ga0075434_100248660
663 Ga0075434_100265378
664 Ga0075429_100000023
665 Ga0075429_100053629
666 Ga0075429_100073604
667 Ga0075429_100101613
668 Ga0068865_100005745
669 Ga0075435_100008517
670 Ga0075435_100031799
671 Ga0075435_100037477
672 Ga0075435_100093425
673 Ga0075435_100122072
674 Ga0075435_100127530
675 Ga0099794_10001340
676 Ga0099794_10004752
677 Ga0111539_10123221
678 Ga0111539_10404809
679 Ga0111539_10808862
680 Ga0105247_10032474
681 Ga0105247_10077531
682 Ga0114129_10005717
683 Ga0114129_10037657
684 Ga0114129_10040065
685 Ga0114129_10117084
686 Ga0114129_10126095
687 Ga0114129_10139071
688 Ga0114129_10621574
689 Ga0105243_10085533
690 Ga0105241_10138998
691 Ga0105242_10092970
692 Ga0105248_10063971
693 Ga0105248_10110949
694 Ga0105248_10140953
695 Ga0105248_10152500
696 Ga0105248_10195504
697 Ga0105248_10454453
698 Ga0105237_10264394
699 Ga0105238_10096525
700 Ga0105249_10154718
701 Ga0105239_10223368
702 Ga0105246_10302821
703 Ga0157374_10021349
704 Ga0157374_10074159
705 Ga0157374_10127396
706 Ga0157374_10136175
707 Ga0157378_10041260
708 Ga0157378_10166285
709 Ga0163162_10098759
710 Ga0163162_10189625
711 Ga0163162_10232963
712 Ga0163162_10307977
713 Ga0163162_10401893
714 Ga0163162_10528634
715 Ga0163162_10913189
716 Ga0157375_10005862
717 Ga0157375_10020542
718 Ga0157375_10037943
719 Ga0157375_10086434
720 Ga0157375_10109623
721 Ga0157375_10189578
722 Ga0157375_10257211
723 Ga0157375_10281134
724 Ga0157375_10433366
725 Ga0163163_10040686
726 Ga0163163_10041003
727 Ga0163163_10042843
728 Ga0163163_10059832
729 Ga0163163_10246117
730 Ga0163163_10414804
731 Ga0182008_10002547
732 Ga0157377_10023029
733 Ga0157379_10046788
734 Ga0157379_10202220
735 Ga0157376_10023195
736 Ga0157376_10024918
737 Ga0157376_10089032
738 Ga0157376_10101428
739 Ga0157376_10165476
740 Ga0157376_10358394
741 Ga0157376_10481796
742 Ga0182007_10003949
743 Ga0163161_10005277
744 Ga0163161_10331241
745 Ga0207697_10044826
746 Ga0207697_10055788
747 Ga0207653_10014815
748 Ga0207692_10099146
749 Ga0207642_10041714
750 Ga0207642_10199821
751 Ga0207688_10019484
752 Ga0207688_10045890
753 Ga0207688_10113212
754 Ga0207680_10175049
755 Ga0207680_10225721
756 Ga0207685_10003100
757 Ga0207699_10074343
758 Ga0207645_10026061
759 Ga0207645_10033398
760 Ga0207645_10073124
761 Ga0207645_10096363
762 Ga0207643_10010294
763 Ga0207684_10004820
764 Ga0207684_10010533
765 Ga0207684_10022872
766 Ga0207684_10024401
767 Ga0207684_10051765
768 Ga0207684_10104472
769 Ga0207684_10208930
770 Ga0207671_10169569
771 Ga0207693_10203848
772 Ga0207662_10185377
773 Ga0207646_10019638
774 Ga0207646_10029755
775 Ga0207646_10123792
776 Ga0207646_10297903
777 Ga0207646_10319080
778 Ga0207681_10018915
779 Ga0207681_10023165
780 Ga0207681_10188072
781 Ga0207681_10199229
782 Ga0207650_10014120
783 Ga0207650_10014482
784 Ga0207650_10026670
785 Ga0207650_10067080
786 Ga0207650_10075704
787 Ga0207650_10082460
788 Ga0207650_10109296
789 Ga0207659_10016754
790 Ga0207659_10018165
791 Ga0207659_10034722
792 Ga0207659_10159006
793 Ga0207659_10164229
794 Ga0207659_10209660
795 Ga0207659_10356145
796 Ga0207700_10092047
797 Ga0207664_10058800
798 Ga0207644_10058326
799 Ga0207644_10171700
800 Ga0207706_10168165
801 Ga0207706_10274394
802 Ga0207706_10364213
803 Ga0207709_10039998
804 Ga0207709_10136534
805 Ga0207669_10129009
806 Ga0207704_10092233
807 Ga0207665_10024630
808 Ga0207691_10028882
809 Ga0207691_10039949
810 Ga0207691_10121845
811 Ga0207691_10147294
812 Ga0207691_10463374
813 Ga0207711_10055209
814 Ga0207711_10076742
815 Ga0207711_10130260
816 Ga0207711_10219121
817 Ga0207711_10265126
818 Ga0207711_10441982
819 Ga0207689_10035420
820 Ga0207689_10036474
821 Ga0207689_10036544
822 Ga0207689_10098254
823 Ga0207689_10234144
824 Ga0207679_10244827
825 Ga0207679_10347676
826 Ga0207651_10098025
827 Ga0207651_10100977
828 Ga0207651_10105362
829 Ga0207651_10114119
830 Ga0207651_10127830
831 Ga0207668_10205074
832 Ga0207640_10108319
833 Ga0207677_10019705
834 Ga0207677_10443872
835 Ga0207708_10073342
836 Ga0207708_10215147
837 Ga0207641_10026067
838 Ga0207641_10030414
839 Ga0207641_10144481
840 Ga0207641_10164333
841 Ga0207641_10265273
842 Ga0207648_10111252
843 Ga0207648_10246242
844 Ga0207676_10006027
845 Ga0207676_10014903
846 Ga0207676_10022131
847 Ga0207676_10035921
848 Ga0207676_10072341
849 Ga0207676_10133204
850 Ga0207676_10154657
851 Ga0207676_10278542
852 Ga0207676_10439631
853 Ga0207675_100122127
854 Ga0207675_100199073
855 Ga0207683_10010524
856 Ga0207683_10041084
857 Ga0207683_10043031
858 Ga0207683_10064911
859 Ga0207683_10239180
860 Ga0207683_10403756
861 Ga0207683_10429718
862 Ga0207698_10230980
863 Ga0209588_1003078
864 Ga0209588_1017495
865 Ga0207428_10001287
866 Ga0268266_10102785
867 Ga0268266_10340965
868 Ga0268266_10401033
869 Ga0268265_10058578
870 Ga0268264_10403539
871 Ga0307409_100256478
872 Ga0307411_10082885
873 Ga0373956_0046459
874 Ga0373955_0057487
875 Ga0373935_0134636
876 Ga0373927_0213238
877 Ga0373927_0258741
878 Ga0373933_0097576
879 Ga0373947_0104787
880 Ga0373947_0300836
881 Ga0373937_0000934
882 Ga0373937_0144309
883 Ga0373925_0275095
884 Ga0395899_0025249
885 Ga0395900_0041266
886 Ga0395898_0376178
887 Ga0395901_0415357
888 Ga0439435_0000259
889 Ga0439460_0027350
890 Ga0453683_0091065
891 Ga0451576_0066754
892 Ga0495641_0081145
893 Ga0495580_0005119
894 Ga0495630_0232686
895 Ga0495652_0243551
896 Ga0495598_0015371
897 Ga0495667_0023130
898 Ga0495635_0022733
899 Ga0495588_0058771
900 Ga0495647_0129212
901 Ga0495636_0038160
902 Ga0495593_0165065
903 Ga0496100_0068380
904 Ga0496100_0379492
905 Ga0496102_0111880
906 Ga0496104_0006181
907 Ga0496104_0080144
908 Ga0496105_0000538
909 Ga0496105_0055806
910 Ga0496105_0313912
911 Ga0496106_0151230
912 Ga0496106_0477912
913 Ga0496107_0066756
914 Ga0496107_0416620
915 Ga0496108_0020061
916 Ga0496108_0057942
917 Ga0496108_0151632
918 Ga0496108_0410552
919 Ga0496109_0042573
920 Ga0496109_0055127
921 Ga0496109_0129753
922 Ga0496109_0559296
923 Ga0496110_0052953
924 Ga0496110_0164366
925 Ga0496110_0388993
926 Ga0496110_0501010
927 Ga0496111_0022815
928 Ga0496111_0102862
929 Ga0496111_0175270
930 Ga0496112_0028637
931 Ga0496112_0107155
932 Ga0496112_0328584
933 Ga0496112_0373986
934 Ga0496113_0026632
935 Ga0496113_0324359
936 Ga0496114_0008838
937 Ga0496114_0219679
938 Ga0496114_0425608
939 Ga0496115_0277619
940 Ga0501033_0094240
941 Ga0501036_0076511
942 Ga0501040_0011225
943 Ga0501041_0002578
944 Ga0501041_0043945
945 Ga0501048_0134347
946 Ga0501071_0043945
947 Ga0501071_0137639
948 Ga0501072_0021052
949 Ga0501072_0130123
950 Ga0501074_0080859
951 Ga0501075_0057182
952 Ga0501076_0002136
953 Ga0501076_0015410
954 Ga0501077_0001151
955 Ga0501077_0026042
956 Ga0501079_0002877
957 Ga0501079_0004332
958 Ga0501080_0028191
959 Ga0501080_0224102
960 Ga0501081_0000139
961 Ga0501081_0001461
962 Ga0501035_0094980
963 Ga0501045_0079330
964 Ga0501045_0080251
965 nmdc:mga05p37_130889_c1
966 nmdc:mga05p37_13239_c1
967 nmdc:mga05p37_134273_c1
968 nmdc:mga05p37_169114_c1
969 nmdc:mga05p37_318557_c1
970 nmdc:mga05p37_37331_c1
971 nmdc:mga05p37_397237_c1
972 nmdc:mga05p37_40406_c1
973 nmdc:mga05p37_409311_c1
974 nmdc:mga05p37_98739_c1
975 nmdc:mga09592_2019_c1
976 nmdc:mga09592_30615_c1
977 nmdc:mga09592_63738_c1
978 nmdc:mga09592_7634_c1
979 nmdc:mga0qj67_24112_c1
980 nmdc:mga06r32_110977_c1
981 nmdc:mga08y16_339281_c1
982 nmdc:mga08y16_98036_c1
983 nmdc:mga0n895_31616_c1
984 nmdc:mga0n895_37818_c1
985 nmdc:mga0n895_68835_c1
986 nmdc:mga0n895_891_c1
987 nmdc:mga0rr50_11500_c1
988 nmdc:mga0rr50_12931_c1
989 nmdc:mga0rr50_166405_c1
990 nmdc:mga0rr50_251598_c1
991 nmdc:mga0rr50_350917_c1
992 nmdc:mga0rr50_43937_c1
993 nmdc:mga08x19_29481_c1
994 nmdc:mga0a205_172603_c1
995 nmdc:mga0a205_269705_c1
996 nmdc:mga0a205_3636_c1
997 nmdc:mga0a205_8669_c1
998 nmdc:mga0a205_89679_c1
999 Ga0495601_0019934
1000 Ga0501084_0004619
1001 Ga0501084_0048028
1002 Ga0501082_0000526
1003 Ga0501082_0010186
1004 Ga0530510_0000479

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04392

ABC_sub_bind

ABC transporter substrate binding protein

96

385

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.9524 29 326
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.9462 29 326
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.9348 29 327
3lft-assembly2.cif.gz_B the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.9342 33 327
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.9318 29 327
ID Description Score Start End Superfamily
3lkvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9171 29 298 3.40.50.2300
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9157 150 326 3.40.50.2300
3lkvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9112 29 298 3.40.50.2300
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9035 150 327 3.40.50.2300
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8916 150 326 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A537H7S6-F1-model_v4 ABC transporter substrate-binding protein 0.9915 214 328
AF-A0A7V9HTZ8-F1-model_v4 ABC transporter substrate-binding protein 0.9909 222 328
AF-A0A2V6ZIS3-F1-model_v4 ABC transporter substrate-binding protein 0.9899 225 328
AF-A0A536TI46-F1-model_v4 ABC transporter substrate-binding protein 0.9875 56 328 GO:0016020
AF-A0A2V7I331-F1-model_v4 ABC transporter substrate-binding protein 0.9845 218 328

Map