F457827

General Info

Members Datasets Scaffolds Average Seq Length
515 279 1030 122

Family's Representative Sequence

Representative Sequence 3300005456|Ga0070678_100705506|Ga0070678_1007055061
Length 139
Sequence MAKFERHIFVCCNQRPEGHPRGCCDPAGQAQLQLAFKQKLAVLGYKHRVRANKSGCLDQCEHGPNVVVYPDAVWYGGVTAADVDEIIESHIVGGKPVERLRIADSCLNTPSCPHRAPKPGGTKDVAAHSAPAESGRTSE

Samples

Sample ID Description Type Environment
1 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
89 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
104 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
123 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
124 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
189 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
191 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
192 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
193 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
194 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
195 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
196 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
197 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
199 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
200 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
201 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
202 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
203 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
204 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
205 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
206 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
207 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
208 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
209 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
210 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
211 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
212 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
213 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
216 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
217 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
218 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
219 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
220 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
221 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
222 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
223 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
224 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
225 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
226 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
227 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
228 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
229 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
230 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
231 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
232 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
233 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
234 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
235 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
236 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
237 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
238 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
239 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
242 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
243 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
244 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
245 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
246 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
247 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
248 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
249 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
250 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
251 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
252 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
253 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
254 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
264 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
265 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
266 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
267 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
268 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
269 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
270 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
272 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
273 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
274 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
275 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
276 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
277 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
278 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
279 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.41
Rhizosphere 93.01
Stem 0
Stem Tuber 0
Unclassified 20.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070678_100705506 3300005456 Unclassified 909
2 MBSR1b_contig_13842245 2162886012 Bacteria 1419
3 JGI24743J22301_10001675 3300001991 Bacteria 3153
4 JGI24033J26618_1058280 3300002155 Unclassified 565
5 JGI24751J29686_10012685 3300002459 Unclassified 1739
6 rootH1_10222530 3300003323 Bacteria 2981
7 Ga0065712_10041646 3300005290 Unclassified 947
8 Ga0065715_10123951 3300005293 Bacteria 2165
9 Ga0065715_10155463 3300005293 Bacteria 1682
10 Ga0065715_10169462 3300005293 Bacteria 1559
11 Ga0065707_10366080 3300005295 Unclassified 897
12 Ga0070658_10278775 3300005327 Bacteria 1423
13 Ga0070676_10009563 3300005328 Bacteria 5236
14 Ga0070676_10113392 3300005328 Bacteria 1691
15 Ga0070683_100010794 3300005329 Bacteria 7861
16 Ga0070683_100031752 3300005329 Unclassified 4805
17 Ga0070690_100003218 3300005330 Bacteria 8908
18 Ga0070670_100044904 3300005331 Bacteria 3798
19 Ga0068869_100052729 3300005334 Bacteria 2954
20 Ga0068869_100432499 3300005334 Bacteria 1088
21 Ga0068869_100470045 3300005334 Bacteria 1045
22 Ga0070666_10190875 3300005335 Bacteria 1439
23 Ga0070682_100026528 3300005337 Bacteria 3469
24 Ga0070682_100208173 3300005337 Unclassified 1384
25 Ga0068868_100006770 3300005338 Bacteria 8141
26 Ga0068868_100009355 3300005338 Bacteria 7044
27 Ga0068868_100044424 3300005338 Bacteria 3474
28 Ga0070660_100006538 3300005339 Bacteria 8085
29 Ga0070660_100372373 3300005339 Bacteria 1178
30 Ga0070689_100003943 3300005340 Bacteria 9959
31 Ga0070689_100018883 3300005340 Bacteria 5090
32 Ga0070687_100101800 3300005343 Bacteria 1610
33 Ga0070661_100003162 3300005344 Bacteria 11333
34 Ga0070661_100054692 3300005344 Bacteria 2923
35 Ga0070661_100073850 3300005344 Unclassified 2511
36 Ga0070661_101098726 3300005344 Unclassified 662
37 Ga0070692_10283336 3300005345 Bacteria 1005
38 Ga0070668_100190725 3300005347 Bacteria 1678
39 Ga0070668_100461624 3300005347 Bacteria 1093
40 Ga0070669_100005834 3300005353 Bacteria 8877
41 Ga0070669_100159092 3300005353 Bacteria 1754
42 Ga0070669_100229163 3300005353 Bacteria 1472
43 Ga0070675_100723858 3300005354 Bacteria 907
44 Ga0070675_100790709 3300005354 Bacteria 867
45 Ga0070675_101216863 3300005354 Unclassified 693
46 Ga0070671_100258212 3300005355 Bacteria 1481
47 Ga0070674_100003815 3300005356 Bacteria 8523
48 Ga0070673_100063008 3300005364 Bacteria 2948
49 Ga0070673_101231332 3300005364 Bacteria 702
50 Ga0070688_100004735 3300005365 Bacteria 7109
51 Ga0070659_100000650 3300005366 Bacteria 25412
52 Ga0070659_100027940 3300005366 Bacteria 4351
53 Ga0070659_100055756 3300005366 Bacteria 3115
54 Ga0070667_100118687 3300005367 Bacteria 2299
55 Ga0070667_100680873 3300005367 Unclassified 951
56 Ga0070709_10000566 3300005434 Bacteria 21596
57 Ga0070709_10510388 3300005434 Bacteria 914
58 Ga0070714_100000188 3300005435 Bacteria 49788
59 Ga0070714_100847585 3300005435 Bacteria 886
60 Ga0070713_100000319 3300005436 Bacteria 31472
61 Ga0070713_100474228 3300005436 Bacteria 1178
62 Ga0070713_100908955 3300005436 Unclassified 847
63 Ga0070713_101417238 3300005436 Bacteria 674
64 Ga0070710_10005651 3300005437 Bacteria 5955
65 Ga0070710_10055183 3300005437 Bacteria 2244
66 Ga0070710_10173228 3300005437 Bacteria 1346
67 Ga0070710_10249206 3300005437 Unclassified 1141
68 Ga0070701_10177887 3300005438 Bacteria 1243
69 Ga0070711_100001058 3300005439 Bacteria 14682
70 Ga0070711_100011286 3300005439 Bacteria 5543
71 Ga0070711_100081389 3300005439 Unclassified 2308
72 Ga0070694_100011412 3300005444 Bacteria 5502
73 Ga0070694_100387852 3300005444 Bacteria 1091
74 Ga0070708_100003653 3300005445 Bacteria 12067
75 Ga0070708_100295062 3300005445 Bacteria 1526
76 Ga0070663_100059797 3300005455 Bacteria 2739
77 Ga0070663_100333928 3300005455 Unclassified 1222
78 Ga0070678_100013959 3300005456 Bacteria 5053
79 Ga0070662_100011699 3300005457 Bacteria 5792
80 Ga0070662_100029478 3300005457 Bacteria 3830
81 Ga0070662_100673635 3300005457 Bacteria 874
82 Ga0070681_10001262 3300005458 Bacteria 22071
83 Ga0070681_10201846 3300005458 Unclassified 1906
84 Ga0068867_100016696 3300005459 Bacteria 5216
85 Ga0068867_100108904 3300005459 Bacteria 2125
86 Ga0070685_10013842 3300005466 Bacteria 4265
87 Ga0070685_10377799 3300005466 Bacteria 975
88 Ga0070706_100325977 3300005467 Bacteria 1432
89 Ga0070707_100413709 3300005468 Unclassified 1309
90 Ga0070698_100233030 3300005471 Bacteria 1774
91 Ga0070698_100833968 3300005471 Unclassified 866
92 Ga0070699_100005505 3300005518 Bacteria 11102
93 Ga0070679_100002389 3300005530 Bacteria 17023
94 Ga0070684_100031454 3300005535 Bacteria 4518
95 Ga0070684_100044921 3300005535 Bacteria 3823
96 Ga0070684_100444040 3300005535 Unclassified 1198
97 Ga0070697_100000724 3300005536 Bacteria 24575
98 Ga0070697_101223540 3300005536 Bacteria 669
99 Ga0068853_100005001 3300005539 Bacteria 10334
100 Ga0068853_100148370 3300005539 Bacteria 2109
101 Ga0068853_100150553 3300005539 Bacteria 2094
102 Ga0070672_100049811 3300005543 Bacteria 3260
103 Ga0070672_100531878 3300005543 Bacteria 1019
104 Ga0070686_100013298 3300005544 Bacteria 4707
105 Ga0070686_100300224 3300005544 Bacteria 1191
106 Ga0070695_100233443 3300005545 Bacteria 1331
107 Ga0070696_100128939 3300005546 Bacteria 1838
108 Ga0070693_100041489 3300005547 Bacteria 2589
109 Ga0070665_100023982 3300005548 Bacteria 6143
110 Ga0070665_100479868 3300005548 Bacteria 1254
111 Ga0070665_101041644 3300005548 Bacteria 830
112 Ga0070704_100702471 3300005549 Bacteria 897
113 Ga0068855_100068474 3300005563 Bacteria 4132
114 Ga0068855_100308831 3300005563 Unclassified 1750
115 Ga0068855_102292771 3300005563 Bacteria 540
116 Ga0070664_100000209 3300005564 Bacteria 41930
117 Ga0070664_100063290 3300005564 Bacteria 3154
118 Ga0068857_100000200 3300005577 Bacteria 38947
119 Ga0068857_100001021 3300005577 Bacteria 21601
120 Ga0068857_100081954 3300005577 Bacteria 2881
121 Ga0068854_100017237 3300005578 Bacteria 4830
122 Ga0068854_100175646 3300005578 Bacteria 1670
123 Ga0068856_100033925 3300005614 Bacteria 4998
124 Ga0068856_100210060 3300005614 Bacteria 1962
125 Ga0068856_101096295 3300005614 Unclassified 813
126 Ga0070702_100008695 3300005615 Bacteria 4931
127 Ga0068852_100035312 3300005616 Bacteria 4168
128 Ga0068852_100578995 3300005616 Unclassified 1125
129 Ga0068852_102143474 3300005616 Unclassified 581
130 Ga0068859_100038823 3300005617 Bacteria 4776
131 Ga0068859_100056101 3300005617 Bacteria 3964
132 Ga0068859_101848284 3300005617 Unclassified 667
133 Ga0068864_100008050 3300005618 Bacteria 8693
134 Ga0068864_100011616 3300005618 Bacteria 7272
135 Ga0068866_10010449 3300005718 Bacteria 3979
136 Ga0068866_10648391 3300005718 Unclassified 718
137 Ga0068861_101262123 3300005719 Unclassified 717
138 Ga0068851_10007611 3300005834 Bacteria 4979
139 Ga0068851_10288386 3300005834 Bacteria 940
140 Ga0068870_10000451 3300005840 Bacteria 15527
141 Ga0068863_100013533 3300005841 Bacteria 7870
142 Ga0068863_100388775 3300005841 Bacteria 1363
143 Ga0068858_100038951 3300005842 Bacteria 4409
144 Ga0068858_100377320 3300005842 Bacteria 1360
145 Ga0068860_100059753 3300005843 Bacteria 3623
146 Ga0068860_100123839 3300005843 Unclassified 2477
147 Ga0068860_100202430 3300005843 Bacteria 1924
148 Ga0068862_100010533 3300005844 Bacteria 7640
149 Ga0070717_10000586 3300006028 Bacteria 23231
150 Ga0070717_10100292 3300006028 Bacteria 2458
151 Ga0070717_11394737 3300006028 Unclassified 636
152 Ga0070715_10021620 3300006163 Bacteria 2497
153 Ga0070715_10278846 3300006163 Bacteria 885
154 Ga0070716_100006446 3300006173 Bacteria 5733
155 Ga0070716_100105447 3300006173 Bacteria 1737
156 Ga0070716_101244461 3300006173 Unclassified 599
157 Ga0070712_100001025 3300006175 Bacteria 16857
158 Ga0070712_100543732 3300006175 Unclassified 978
159 Ga0070712_100612855 3300006175 Bacteria 922
160 Ga0097621_100234510 3300006237 Bacteria 1603
161 Ga0097621_100324369 3300006237 Bacteria 1365
162 Ga0097621_100838521 3300006237 Unclassified 853
163 Ga0068871_100009272 3300006358 Bacteria 7122
164 Ga0068871_100016139 3300006358 Bacteria 5613
165 Ga0068871_100056126 3300006358 Bacteria 3200
166 Ga0068871_100142600 3300006358 Bacteria 2038
167 Ga0068871_100250601 3300006358 Unclassified 1542
168 Ga0075430_100297942 3300006846 Bacteria 1334
169 Ga0075431_100497208 3300006847 Bacteria 1211
170 Ga0075431_100581151 3300006847 Bacteria 1105
171 Ga0068865_100008456 3300006881 Bacteria 6362
172 Ga0068865_100227068 3300006881 Bacteria 1463
173 Ga0097620_100038823 3300006931 Bacteria 4776
174 Ga0097620_100056102 3300006931 Bacteria 3964
175 Ga0097620_101847465 3300006931 Unclassified 667
176 Ga0105251_10093111 3300009011 Bacteria 1383
177 Ga0105250_10024892 3300009092 Bacteria 2412
178 Ga0105240_10015555 3300009093 Bacteria 10340
179 Ga0105240_10123645 3300009093 Bacteria 3112
180 Ga0105240_11470407 3300009093 Unclassified 715
181 Ga0111539_10031413 3300009094 Bacteria 6451
182 Ga0111539_10882291 3300009094 Bacteria 1040
183 Ga0105245_10002296 3300009098 Bacteria 17304
184 Ga0105245_10054457 3300009098 Bacteria 3592
185 Ga0105245_10056289 3300009098 Bacteria 3534
186 Ga0105245_10285436 3300009098 Bacteria 1615
187 Ga0105245_11916530 3300009098 Unclassified 646
188 Ga0105247_10006775 3300009101 Bacteria 7065
189 Ga0105247_10025396 3300009101 Bacteria 3574
190 Ga0105247_10496949 3300009101 Unclassified 888
191 Ga0105247_10840625 3300009101 Unclassified 704
192 Ga0105243_10022032 3300009148 Bacteria 4840
193 Ga0105241_10009790 3300009174 Bacteria 7043
194 Ga0105241_10012953 3300009174 Bacteria 6117
195 Ga0105241_10812309 3300009174 Unclassified 862
196 Ga0105242_10004255 3300009176 Bacteria 11156
197 Ga0105242_10070347 3300009176 Bacteria 2901
198 Ga0105242_12578805 3300009176 Unclassified 557
199 Ga0105248_10796626 3300009177 Bacteria 1066
200 Ga0105248_11629416 3300009177 Unclassified 731
201 Ga0105237_10065550 3300009545 Unclassified 3628
202 Ga0105237_10070280 3300009545 Bacteria 3497
203 Ga0105237_10096843 3300009545 Bacteria 2941
204 Ga0105237_11561687 3300009545 Unclassified 667
205 Ga0105238_10046843 3300009551 Bacteria 4360
206 Ga0105238_10192129 3300009551 Bacteria 2017
207 Ga0105238_10399590 3300009551 Bacteria 1367
208 Ga0105249_10041140 3300009553 Bacteria 4200
209 Ga0105249_10092428 3300009553 Bacteria 2832
210 Ga0105249_10128800 3300009553 Bacteria 2413
211 Ga0105249_12015146 3300009553 Unclassified 650
212 Ga0105239_10113336 3300010375 Bacteria 3007
213 Ga0105239_10115924 3300010375 Bacteria 2972
214 Ga0105246_10016118 3300011119 Bacteria 4730
215 Ga0105246_10025387 3300011119 Bacteria 3862
216 Ga0105246_10215067 3300011119 Bacteria 1503
217 Ga0105246_10375302 3300011119 Bacteria 1173
218 Ga0157325_1006378 3300012485 Unclassified 759
219 Ga0157315_1017165 3300012508 Unclassified 725
220 Ga0157373_10006583 3300013100 Bacteria 8665
221 Ga0157373_10734361 3300013100 Unclassified 725
222 Ga0157371_10015345 3300013102 Bacteria 5750
223 Ga0157371_10217977 3300013102 Bacteria 1370
224 Ga0157370_11176597 3300013104 Bacteria 692
225 Ga0157369_10034820 3300013105 Bacteria 5523
226 Ga0157374_10242431 3300013296 Bacteria 1773
227 Ga0157374_10991002 3300013296 Unclassified 859
228 Ga0157374_12336587 3300013296 Unclassified 562
229 Ga0157378_10016191 3300013297 Bacteria 6531
230 Ga0157378_11579709 3300013297 Unclassified 701
231 Ga0163162_10000147 3300013306 Bacteria 64948
232 Ga0163162_10039094 3300013306 Bacteria 4739
233 Ga0163162_10074084 3300013306 Bacteria 3462
234 Ga0163162_10152914 3300013306 Bacteria 2426
235 Ga0157372_10011135 3300013307 Bacteria 9567
236 Ga0157372_10064442 3300013307 Bacteria 4112
237 Ga0157372_10229687 3300013307 Unclassified 2151
238 Ga0157375_10093140 3300013308 Bacteria 3078
239 Ga0157375_11225452 3300013308 Bacteria 881
240 Ga0157375_11964804 3300013308 Unclassified 695
241 Ga0163163_10004219 3300014325 Bacteria 12250
242 Ga0163163_10008091 3300014325 Bacteria 9316
243 Ga0163163_10020294 3300014325 Bacteria 6255
244 Ga0163163_10031517 3300014325 Bacteria 5117
245 Ga0163163_10371672 3300014325 Unclassified 1487
246 Ga0157380_10038064 3300014326 Bacteria 3733
247 Ga0182008_10012259 3300014497 Bacteria 4527
248 Ga0157377_10000329 3300014745 Bacteria 21293
249 Ga0157379_10008240 3300014968 Bacteria 9051
250 Ga0157379_10033987 3300014968 Bacteria 4545
251 Ga0157379_10049642 3300014968 Bacteria 3747
252 Ga0157376_10028675 3300014969 Bacteria 4427
253 Ga0157376_10078122 3300014969 Bacteria 2833
254 Ga0157376_10128313 3300014969 Unclassified 2259
255 Ga0157376_10377846 3300014969 Bacteria 1364
256 Ga0157376_10414185 3300014969 Bacteria 1306
257 Ga0157376_12711296 3300014969 Bacteria 535
258 Ga0182007_10015381 3300015262 Bacteria 2856
259 Ga0163161_10007103 3300017792 Bacteria 7742
260 Ga0224569_100937 3300022732 Bacteria 2478
261 Ga0224572_1030574 3300024225 Bacteria 1028
262 Ga0228598_1000580 3300024227 Bacteria 7660
263 Ga0228598_1002328 3300024227 Bacteria 4153
264 Ga0207697_10243895 3300025315 Bacteria 794
265 Ga0207656_10027627 3300025321 Bacteria 2322
266 Ga0207692_10041330 3300025898 Bacteria 2282
267 Ga0207692_10087235 3300025898 Bacteria 1683
268 Ga0207692_10285509 3300025898 Unclassified 1000
269 Ga0207642_10083303 3300025899 Bacteria 1559
270 Ga0207642_10729170 3300025899 Bacteria 626
271 Ga0207710_10098551 3300025900 Bacteria 1376
272 Ga0207710_10139449 3300025900 Unclassified 1170
273 Ga0207680_10138508 3300025903 Bacteria 1611
274 Ga0207685_10039906 3300025905 Bacteria 1746
275 Ga0207685_10158147 3300025905 Bacteria 1032
276 Ga0207685_10478436 3300025905 Bacteria 652
277 Ga0207699_10001295 3300025906 Bacteria 11891
278 Ga0207699_10017321 3300025906 Bacteria 3788
279 Ga0207699_10359648 3300025906 Bacteria 1029
280 Ga0207699_10729720 3300025906 Bacteria 726
281 Ga0207645_10004246 3300025907 Bacteria 10638
282 Ga0207643_10007912 3300025908 Bacteria 5705
283 Ga0207684_10707534 3300025910 Unclassified 856
284 Ga0207654_10278462 3300025911 Unclassified 1131
285 Ga0207707_10000923 3300025912 Bacteria 28533
286 Ga0207695_10111353 3300025913 Bacteria 2717
287 Ga0207695_10294433 3300025913 Bacteria 1515
288 Ga0207695_11361598 3300025913 Unclassified 590
289 Ga0207671_10153807 3300025914 Bacteria 1778
290 Ga0207671_10600464 3300025914 Unclassified 877
291 Ga0207693_10000446 3300025915 Bacteria 37811
292 Ga0207693_10426911 3300025915 Unclassified 1036
293 Ga0207693_10657743 3300025915 Unclassified 814
294 Ga0207693_11055198 3300025915 Bacteria 619
295 Ga0207663_10008308 3300025916 Bacteria 5419
296 Ga0207663_10026418 3300025916 Bacteria 3370
297 Ga0207663_10065578 3300025916 Unclassified 2322
298 Ga0207660_10140145 3300025917 Unclassified 1848
299 Ga0207662_10025091 3300025918 Bacteria 3432
300 Ga0207657_10007479 3300025919 Bacteria 11195
301 Ga0207649_10001946 3300025920 Bacteria 11775
302 Ga0207649_10042781 3300025920 Unclassified 2765
303 Ga0207649_10987649 3300025920 Unclassified 662
304 Ga0207652_10089411 3300025921 Unclassified 2704
305 Ga0207681_10030313 3300025923 Bacteria 3525
306 Ga0207681_10167654 3300025923 Bacteria 1662
307 Ga0207694_10198587 3300025924 Unclassified 1631
308 Ga0207694_10531788 3300025924 Bacteria 986
309 Ga0207650_10000169 3300025925 Bacteria 77854
310 Ga0207650_10645826 3300025925 Bacteria 892
311 Ga0207659_10002981 3300025926 Bacteria 10086
312 Ga0207659_10654049 3300025926 Bacteria 898
313 Ga0207687_10015336 3300025927 Bacteria 5022
314 Ga0207687_10069194 3300025927 Bacteria 2517
315 Ga0207687_10122989 3300025927 Bacteria 1943
316 Ga0207687_10183750 3300025927 Bacteria 1622
317 Ga0207700_10000252 3300025928 Bacteria 32074
318 Ga0207700_10414897 3300025928 Bacteria 1182
319 Ga0207700_10433821 3300025928 Bacteria 1156
320 Ga0207700_10907719 3300025928 Unclassified 788
321 Ga0207664_10001212 3300025929 Bacteria 17120
322 Ga0207664_10066704 3300025929 Bacteria 2886
323 Ga0207664_10116698 3300025929 Bacteria 2228
324 Ga0207664_10308430 3300025929 Bacteria 1394
325 Ga0207664_10713647 3300025929 Bacteria 902
326 Ga0207644_10003698 3300025931 Bacteria 9917
327 Ga0207644_10754600 3300025931 Unclassified 813
328 Ga0207690_10007097 3300025932 Bacteria 6654
329 Ga0207706_10002044 3300025933 Bacteria 19783
330 Ga0207706_10007761 3300025933 Bacteria 9904
331 Ga0207706_10726061 3300025933 Bacteria 847
332 Ga0207686_10491959 3300025934 Bacteria 950
333 Ga0207709_10446628 3300025935 Bacteria 999
334 Ga0207670_10003007 3300025936 Bacteria 8900
335 Ga0207669_10100269 3300025937 Bacteria 1912
336 Ga0207669_10607319 3300025937 Bacteria 890
337 Ga0207665_10003611 3300025939 Bacteria 10333
338 Ga0207665_10012413 3300025939 Bacteria 5596
339 Ga0207691_10000729 3300025940 Bacteria 32500
340 Ga0207711_10003642 3300025941 Bacteria 13324
341 Ga0207711_10153538 3300025941 Bacteria 2079
342 Ga0207689_10000588 3300025942 Bacteria 34685
343 Ga0207689_10510022 3300025942 Bacteria 1008
344 Ga0207661_10000716 3300025944 Bacteria 21544
345 Ga0207679_10000668 3300025945 Bacteria 22978
346 Ga0207679_10070572 3300025945 Unclassified 2632
347 Ga0207667_10178955 3300025949 Unclassified 2178
348 Ga0207651_10313171 3300025960 Bacteria 1309
349 Ga0207651_10941238 3300025960 Bacteria 770
350 Ga0207712_10107053 3300025961 Bacteria 2090
351 Ga0207668_10012117 3300025972 Bacteria 5269
352 Ga0207640_10004142 3300025981 Bacteria 7835
353 Ga0207640_10087427 3300025981 Bacteria 2148
354 Ga0207658_10016483 3300025986 Bacteria 5081
355 Ga0207658_10890542 3300025986 Unclassified 810
356 Ga0207677_10037101 3300026023 Bacteria 3183
357 Ga0207677_10149497 3300026023 Bacteria 1800
358 Ga0207677_11176713 3300026023 Unclassified 701
359 Ga0207703_10108447 3300026035 Bacteria 2365
360 Ga0207703_11315026 3300026035 Unclassified 695
361 Ga0207639_10012667 3300026041 Bacteria 5881
362 Ga0207639_10356231 3300026041 Bacteria 1308
363 Ga0207639_10421876 3300026041 Bacteria 1206
364 Ga0207678_10000037 3300026067 Bacteria 102480
365 Ga0207702_10057095 3300026078 Bacteria 3316
366 Ga0207702_10293974 3300026078 Bacteria 1540
367 Ga0207702_11098540 3300026078 Unclassified 789
368 Ga0207641_10000086 3300026088 Bacteria 133444
369 Ga0207648_10000295 3300026089 Bacteria 54257
370 Ga0207648_10043811 3300026089 Bacteria 3928
371 Ga0207676_10014272 3300026095 Bacteria 5711
372 Ga0207676_10015871 3300026095 Bacteria 5447
373 Ga0207674_10000070 3300026116 Bacteria 106245
374 Ga0207674_10000124 3300026116 Bacteria 89220
375 Ga0207674_10040375 3300026116 Bacteria 4834
376 Ga0207675_100265194 3300026118 Bacteria 1665
377 Ga0207675_100575539 3300026118 Bacteria 1127
378 Ga0207683_10000062 3300026121 Bacteria 81362
379 Ga0207683_10710370 3300026121 Unclassified 932
380 Ga0207428_10127934 3300027907 Bacteria 1945
381 Ga0207428_10293130 3300027907 Bacteria 1205
382 Ga0268266_10014047 3300028379 Bacteria 6893
383 Ga0268266_10749055 3300028379 Bacteria 943
384 Ga0268266_12095570 3300028379 Bacteria 538
385 Ga0268265_10723263 3300028380 Bacteria 964
386 Ga0268264_10155091 3300028381 Bacteria 2057
387 Ga0268264_10907928 3300028381 Bacteria 884
388 Ga0265338_10084837 3300028800 Bacteria 2642
389 Ga0265760_10000966 3300031090 Bacteria 8321
390 Ga0265325_10010518 3300031241 Bacteria 5353
391 Ga0265340_10261788 3300031247 Unclassified 770
392 Ga0265339_10230967 3300031249 Bacteria 901
393 Ga0307415_102121713 3300032126 Bacteria 549
394 Ga0373938_0052772 3300034957 Bacteria 933
395 Ga0373926_0412084 3300035083 Bacteria 534
396 Ga0373934_0319093 3300035086 Unclassified 645
397 Ga0373923_0068511 3300035111 Bacteria 1519
398 Ga0373936_0003142 3300035113 Bacteria 6181
399 Ga0373939_0458559 3300035114 Bacteria 538
400 Ga0373945_0001964 3300035116 Bacteria 6379
401 Ga0373954_0157000 3300035118 Bacteria 1112
402 Ga0373957_0030375 3300035120 Bacteria 1980
403 Ga0373943_0001585 3300035170 Bacteria 10297
404 Ga0373946_0001567 3300035171 Bacteria 7969
405 Ga0373955_0020136 3300035172 Bacteria 3349
406 Ga0373942_0274384 3300035207 Bacteria 579
407 Ga0373924_0119214 3300035410 Bacteria 1144
408 Ga0373931_0015843 3300035691 Bacteria 3701
409 Ga0373935_0015149 3300035692 Bacteria 4658
410 Ga0373935_0251150 3300035692 Unclassified 1237
411 Ga0373927_0000705 3300035695 Bacteria 25605
412 Ga0373927_0628512 3300035695 Unclassified 710
413 Ga0373933_0216722 3300035724 Bacteria 1227
414 Ga0373947_0000098 3300035725 Bacteria 44133
415 Ga0373937_0087263 3300036401 Bacteria 2888
416 Ga0373937_0270384 3300036401 Unclassified 1604
417 Ga0373937_0419905 3300036401 Bacteria 1269
418 Ga0373925_0040038 3300037068 Bacteria 3468
419 Ga0373925_0068570 3300037068 Bacteria 2678
420 Ga0395905_0095725 3300037471 Bacteria 2787
421 Ga0436363_0244877 3300039450 Unclassified 867
422 Ga0436363_0423020 3300039450 Unclassified 573
423 Ga0439432_239734 3300042006 Unclassified 521
424 Ga0450912_025459 3300042116 Bacteria 592
425 Ga0466966_0676007 3300044684 Unclassified 622
426 Ga0466964_0355813 3300044706 Bacteria 754
427 Ga0453684_1547139 3300044712 Unclassified 683
428 Ga0466968_0588582 3300044735 Unclassified 561
429 Ga0466959_0009893 3300045049 Bacteria 6796
430 Ga0466958_1053648 3300045836 Unclassified 531
431 Ga0466967_0085057 3300045976 Bacteria 2863
432 Ga0495653_0115157 3300046463 Bacteria 1925
433 Ga0495580_0010980 3300046472 Bacteria 7021
434 Ga0495580_0217151 3300046472 Bacteria 1315
435 Ga0495580_1063040 3300046472 Bacteria 513
436 Ga0495664_0063643 3300046477 Bacteria 2199
437 Ga0495608_0131566 3300046511 Bacteria 1601
438 Ga0495618_0917993 3300046514 Bacteria 505
439 Ga0495645_0830610 3300046543 Bacteria 552
440 Ga0495657_0241166 3300046675 Bacteria 1091
441 Ga0495646_0281654 3300046680 Bacteria 883
442 Ga0495604_0297876 3300047317 Bacteria 1084
443 Ga0495674_0199281 3300047319 Bacteria 1661
444 Ga0495674_0727445 3300047319 Unclassified 777
445 Ga0495684_0627366 3300047471 Unclassified 722
446 Ga0495602_0204015 3300048088 Bacteria 1506
447 Ga0496100_0068961 3300048903 Bacteria 2353
448 Ga0496100_0788201 3300048903 Bacteria 744
449 Ga0496101_0023109 3300048904 Unclassified 4290
450 Ga0496101_0401817 3300048904 Bacteria 1079
451 Ga0496101_1030615 3300048904 Unclassified 647
452 Ga0496102_0170629 3300048905 Unclassified 2048
453 Ga0496102_0659543 3300048905 Unclassified 969
454 Ga0496103_0087150 3300048906 Bacteria 1968
455 Ga0496103_0247958 3300048906 Unclassified 1146
456 Ga0496103_0576613 3300048906 Bacteria 717
457 Ga0496104_0868250 3300048907 Bacteria 807
458 Ga0496105_0128480 3300048908 Bacteria 2090
459 Ga0496105_0198235 3300048908 Bacteria 1639
460 Ga0496105_0780286 3300048908 Unclassified 728
461 Ga0496106_0117945 3300048909 Bacteria 2072
462 Ga0496107_0021579 3300048910 Bacteria 4552
463 Ga0496108_0003263 3300048911 Bacteria 13044
464 Ga0496108_0365417 3300048911 Unclassified 1260
465 Ga0496109_0002672 3300048912 Bacteria 14965
466 Ga0496109_0028608 3300048912 Bacteria 4986
467 Ga0496109_0759867 3300048912 Unclassified 907
468 Ga0496109_0925868 3300048912 Bacteria 810
469 Ga0496110_0186165 3300048913 Bacteria 1885
470 Ga0496110_1512889 3300048913 Unclassified 581
471 Ga0496111_0108861 3300048914 Bacteria 2040
472 Ga0496112_0000049 3300048915 Bacteria 83780
473 Ga0496112_0367048 3300048915 Unclassified 1381
474 Ga0496113_0000994 3300048916 Bacteria 15185
475 Ga0496114_0057136 3300048917 Bacteria 3257
476 Ga0496114_0540731 3300048917 Unclassified 1030
477 Ga0496114_0582296 3300048917 Bacteria 987
478 Ga0496115_0007191 3300048918 Bacteria 8179
479 Ga0496115_0012807 3300048918 Bacteria 6323
480 Ga0501031_0408413 3300049568 Bacteria 878
481 Ga0501034_1698815 3300049571 Bacteria 504
482 Ga0501036_0178317 3300049572 Bacteria 1789
483 Ga0501036_0385110 3300049572 Bacteria 1170
484 Ga0501037_0712479 3300049573 Unclassified 667
485 Ga0501038_0313660 3300049574 Bacteria 1228
486 Ga0501039_0155220 3300049575 Bacteria 1798
487 Ga0501041_0028490 3300049577 Bacteria 3369
488 Ga0501046_1106362 3300049580 Unclassified 547
489 Ga0501048_0107761 3300049582 Bacteria 1967
490 Ga0501068_0373109 3300049584 Bacteria 918
491 Ga0501071_0211406 3300049587 Bacteria 1459
492 Ga0501072_0334292 3300049588 Bacteria 1203
493 Ga0501072_0837340 3300049588 Bacteria 720
494 Ga0501074_1204029 3300049590 Bacteria 531
495 Ga0501075_0206761 3300049591 Bacteria 1497
496 Ga0501075_0596677 3300049591 Bacteria 842
497 Ga0501076_0063499 3300049592 Bacteria 2942
498 Ga0501076_0249311 3300049592 Unclassified 1453
499 Ga0501081_0247851 3300049743 Bacteria 1300
500 Ga0501035_1476173 3300049822 Bacteria 519
501 Ga0501045_0133138 3300049824 Bacteria 1848
502 Ga0501045_0361609 3300049824 Bacteria 1080
503 Ga0501045_0589887 3300049824 Bacteria 823
504 nmdc:mga0qj67_173259_c1 3300050509 Bacteria 1752
505 nmdc:mga06r32_360819_c1 3300050510 Bacteria 1437
506 nmdc:mga08y16_281007_c1 3300050511 Bacteria 1717
507 nmdc:mga08y16_880831_c1 3300050511 Bacteria 883
508 nmdc:mga08x19_914999_c1 3300050514 Bacteria 623
509 Ga0495601_0673687 3300053077 Unclassified 661
510 Ga0495601_1080418 3300053077 Bacteria 503
511 Ga0495619_0016847 3300053085 Bacteria 4628
512 Ga0495619_1158476 3300053085 Bacteria 513
513 Ga0501082_1346942 3300060353 Unclassified 623
514 Ga0530510_0015549 3300061734 Bacteria 5379
515 Ga0530510_0157561 3300061734 Bacteria 1679
516 Ga0070678_100705506
517 MBSR1b_contig_13842245
518 JGI24743J22301_10001675
519 JGI24033J26618_1058280
520 JGI24751J29686_10012685
521 rootH1_10222530
522 Ga0065712_10041646
523 Ga0065715_10123951
524 Ga0065715_10155463
525 Ga0065715_10169462
526 Ga0065707_10366080
527 Ga0070658_10278775
528 Ga0070676_10009563
529 Ga0070676_10113392
530 Ga0070683_100010794
531 Ga0070683_100031752
532 Ga0070690_100003218
533 Ga0070670_100044904
534 Ga0068869_100052729
535 Ga0068869_100432499
536 Ga0068869_100470045
537 Ga0070666_10190875
538 Ga0070682_100026528
539 Ga0070682_100208173
540 Ga0068868_100006770
541 Ga0068868_100009355
542 Ga0068868_100044424
543 Ga0070660_100006538
544 Ga0070660_100372373
545 Ga0070689_100003943
546 Ga0070689_100018883
547 Ga0070687_100101800
548 Ga0070661_100003162
549 Ga0070661_100054692
550 Ga0070661_100073850
551 Ga0070661_101098726
552 Ga0070692_10283336
553 Ga0070668_100190725
554 Ga0070668_100461624
555 Ga0070669_100005834
556 Ga0070669_100159092
557 Ga0070669_100229163
558 Ga0070675_100723858
559 Ga0070675_100790709
560 Ga0070675_101216863
561 Ga0070671_100258212
562 Ga0070674_100003815
563 Ga0070673_100063008
564 Ga0070673_101231332
565 Ga0070688_100004735
566 Ga0070659_100000650
567 Ga0070659_100027940
568 Ga0070659_100055756
569 Ga0070667_100118687
570 Ga0070667_100680873
571 Ga0070709_10000566
572 Ga0070709_10510388
573 Ga0070714_100000188
574 Ga0070714_100847585
575 Ga0070713_100000319
576 Ga0070713_100474228
577 Ga0070713_100908955
578 Ga0070713_101417238
579 Ga0070710_10005651
580 Ga0070710_10055183
581 Ga0070710_10173228
582 Ga0070710_10249206
583 Ga0070701_10177887
584 Ga0070711_100001058
585 Ga0070711_100011286
586 Ga0070711_100081389
587 Ga0070694_100011412
588 Ga0070694_100387852
589 Ga0070708_100003653
590 Ga0070708_100295062
591 Ga0070663_100059797
592 Ga0070663_100333928
593 Ga0070678_100013959
594 Ga0070662_100011699
595 Ga0070662_100029478
596 Ga0070662_100673635
597 Ga0070681_10001262
598 Ga0070681_10201846
599 Ga0068867_100016696
600 Ga0068867_100108904
601 Ga0070685_10013842
602 Ga0070685_10377799
603 Ga0070706_100325977
604 Ga0070707_100413709
605 Ga0070698_100233030
606 Ga0070698_100833968
607 Ga0070699_100005505
608 Ga0070679_100002389
609 Ga0070684_100031454
610 Ga0070684_100044921
611 Ga0070684_100444040
612 Ga0070697_100000724
613 Ga0070697_101223540
614 Ga0068853_100005001
615 Ga0068853_100148370
616 Ga0068853_100150553
617 Ga0070672_100049811
618 Ga0070672_100531878
619 Ga0070686_100013298
620 Ga0070686_100300224
621 Ga0070695_100233443
622 Ga0070696_100128939
623 Ga0070693_100041489
624 Ga0070665_100023982
625 Ga0070665_100479868
626 Ga0070665_101041644
627 Ga0070704_100702471
628 Ga0068855_100068474
629 Ga0068855_100308831
630 Ga0068855_102292771
631 Ga0070664_100000209
632 Ga0070664_100063290
633 Ga0068857_100000200
634 Ga0068857_100001021
635 Ga0068857_100081954
636 Ga0068854_100017237
637 Ga0068854_100175646
638 Ga0068856_100033925
639 Ga0068856_100210060
640 Ga0068856_101096295
641 Ga0070702_100008695
642 Ga0068852_100035312
643 Ga0068852_100578995
644 Ga0068852_102143474
645 Ga0068859_100038823
646 Ga0068859_100056101
647 Ga0068859_101848284
648 Ga0068864_100008050
649 Ga0068864_100011616
650 Ga0068866_10010449
651 Ga0068866_10648391
652 Ga0068861_101262123
653 Ga0068851_10007611
654 Ga0068851_10288386
655 Ga0068870_10000451
656 Ga0068863_100013533
657 Ga0068863_100388775
658 Ga0068858_100038951
659 Ga0068858_100377320
660 Ga0068860_100059753
661 Ga0068860_100123839
662 Ga0068860_100202430
663 Ga0068862_100010533
664 Ga0070717_10000586
665 Ga0070717_10100292
666 Ga0070717_11394737
667 Ga0070715_10021620
668 Ga0070715_10278846
669 Ga0070716_100006446
670 Ga0070716_100105447
671 Ga0070716_101244461
672 Ga0070712_100001025
673 Ga0070712_100543732
674 Ga0070712_100612855
675 Ga0097621_100234510
676 Ga0097621_100324369
677 Ga0097621_100838521
678 Ga0068871_100009272
679 Ga0068871_100016139
680 Ga0068871_100056126
681 Ga0068871_100142600
682 Ga0068871_100250601
683 Ga0075430_100297942
684 Ga0075431_100497208
685 Ga0075431_100581151
686 Ga0068865_100008456
687 Ga0068865_100227068
688 Ga0097620_100038823
689 Ga0097620_100056102
690 Ga0097620_101847465
691 Ga0105251_10093111
692 Ga0105250_10024892
693 Ga0105240_10015555
694 Ga0105240_10123645
695 Ga0105240_11470407
696 Ga0111539_10031413
697 Ga0111539_10882291
698 Ga0105245_10002296
699 Ga0105245_10054457
700 Ga0105245_10056289
701 Ga0105245_10285436
702 Ga0105245_11916530
703 Ga0105247_10006775
704 Ga0105247_10025396
705 Ga0105247_10496949
706 Ga0105247_10840625
707 Ga0105243_10022032
708 Ga0105241_10009790
709 Ga0105241_10012953
710 Ga0105241_10812309
711 Ga0105242_10004255
712 Ga0105242_10070347
713 Ga0105242_12578805
714 Ga0105248_10796626
715 Ga0105248_11629416
716 Ga0105237_10065550
717 Ga0105237_10070280
718 Ga0105237_10096843
719 Ga0105237_11561687
720 Ga0105238_10046843
721 Ga0105238_10192129
722 Ga0105238_10399590
723 Ga0105249_10041140
724 Ga0105249_10092428
725 Ga0105249_10128800
726 Ga0105249_12015146
727 Ga0105239_10113336
728 Ga0105239_10115924
729 Ga0105246_10016118
730 Ga0105246_10025387
731 Ga0105246_10215067
732 Ga0105246_10375302
733 Ga0157325_1006378
734 Ga0157315_1017165
735 Ga0157373_10006583
736 Ga0157373_10734361
737 Ga0157371_10015345
738 Ga0157371_10217977
739 Ga0157370_11176597
740 Ga0157369_10034820
741 Ga0157374_10242431
742 Ga0157374_10991002
743 Ga0157374_12336587
744 Ga0157378_10016191
745 Ga0157378_11579709
746 Ga0163162_10000147
747 Ga0163162_10039094
748 Ga0163162_10074084
749 Ga0163162_10152914
750 Ga0157372_10011135
751 Ga0157372_10064442
752 Ga0157372_10229687
753 Ga0157375_10093140
754 Ga0157375_11225452
755 Ga0157375_11964804
756 Ga0163163_10004219
757 Ga0163163_10008091
758 Ga0163163_10020294
759 Ga0163163_10031517
760 Ga0163163_10371672
761 Ga0157380_10038064
762 Ga0182008_10012259
763 Ga0157377_10000329
764 Ga0157379_10008240
765 Ga0157379_10033987
766 Ga0157379_10049642
767 Ga0157376_10028675
768 Ga0157376_10078122
769 Ga0157376_10128313
770 Ga0157376_10377846
771 Ga0157376_10414185
772 Ga0157376_12711296
773 Ga0182007_10015381
774 Ga0163161_10007103
775 Ga0224569_100937
776 Ga0224572_1030574
777 Ga0228598_1000580
778 Ga0228598_1002328
779 Ga0207697_10243895
780 Ga0207656_10027627
781 Ga0207692_10041330
782 Ga0207692_10087235
783 Ga0207692_10285509
784 Ga0207642_10083303
785 Ga0207642_10729170
786 Ga0207710_10098551
787 Ga0207710_10139449
788 Ga0207680_10138508
789 Ga0207685_10039906
790 Ga0207685_10158147
791 Ga0207685_10478436
792 Ga0207699_10001295
793 Ga0207699_10017321
794 Ga0207699_10359648
795 Ga0207699_10729720
796 Ga0207645_10004246
797 Ga0207643_10007912
798 Ga0207684_10707534
799 Ga0207654_10278462
800 Ga0207707_10000923
801 Ga0207695_10111353
802 Ga0207695_10294433
803 Ga0207695_11361598
804 Ga0207671_10153807
805 Ga0207671_10600464
806 Ga0207693_10000446
807 Ga0207693_10426911
808 Ga0207693_10657743
809 Ga0207693_11055198
810 Ga0207663_10008308
811 Ga0207663_10026418
812 Ga0207663_10065578
813 Ga0207660_10140145
814 Ga0207662_10025091
815 Ga0207657_10007479
816 Ga0207649_10001946
817 Ga0207649_10042781
818 Ga0207649_10987649
819 Ga0207652_10089411
820 Ga0207681_10030313
821 Ga0207681_10167654
822 Ga0207694_10198587
823 Ga0207694_10531788
824 Ga0207650_10000169
825 Ga0207650_10645826
826 Ga0207659_10002981
827 Ga0207659_10654049
828 Ga0207687_10015336
829 Ga0207687_10069194
830 Ga0207687_10122989
831 Ga0207687_10183750
832 Ga0207700_10000252
833 Ga0207700_10414897
834 Ga0207700_10433821
835 Ga0207700_10907719
836 Ga0207664_10001212
837 Ga0207664_10066704
838 Ga0207664_10116698
839 Ga0207664_10308430
840 Ga0207664_10713647
841 Ga0207644_10003698
842 Ga0207644_10754600
843 Ga0207690_10007097
844 Ga0207706_10002044
845 Ga0207706_10007761
846 Ga0207706_10726061
847 Ga0207686_10491959
848 Ga0207709_10446628
849 Ga0207670_10003007
850 Ga0207669_10100269
851 Ga0207669_10607319
852 Ga0207665_10003611
853 Ga0207665_10012413
854 Ga0207691_10000729
855 Ga0207711_10003642
856 Ga0207711_10153538
857 Ga0207689_10000588
858 Ga0207689_10510022
859 Ga0207661_10000716
860 Ga0207679_10000668
861 Ga0207679_10070572
862 Ga0207667_10178955
863 Ga0207651_10313171
864 Ga0207651_10941238
865 Ga0207712_10107053
866 Ga0207668_10012117
867 Ga0207640_10004142
868 Ga0207640_10087427
869 Ga0207658_10016483
870 Ga0207658_10890542
871 Ga0207677_10037101
872 Ga0207677_10149497
873 Ga0207677_11176713
874 Ga0207703_10108447
875 Ga0207703_11315026
876 Ga0207639_10012667
877 Ga0207639_10356231
878 Ga0207639_10421876
879 Ga0207678_10000037
880 Ga0207702_10057095
881 Ga0207702_10293974
882 Ga0207702_11098540
883 Ga0207641_10000086
884 Ga0207648_10000295
885 Ga0207648_10043811
886 Ga0207676_10014272
887 Ga0207676_10015871
888 Ga0207674_10000070
889 Ga0207674_10000124
890 Ga0207674_10040375
891 Ga0207675_100265194
892 Ga0207675_100575539
893 Ga0207683_10000062
894 Ga0207683_10710370
895 Ga0207428_10127934
896 Ga0207428_10293130
897 Ga0268266_10014047
898 Ga0268266_10749055
899 Ga0268266_12095570
900 Ga0268265_10723263
901 Ga0268264_10155091
902 Ga0268264_10907928
903 Ga0265338_10084837
904 Ga0265760_10000966
905 Ga0265325_10010518
906 Ga0265340_10261788
907 Ga0265339_10230967
908 Ga0307415_102121713
909 Ga0373938_0052772
910 Ga0373926_0412084
911 Ga0373934_0319093
912 Ga0373923_0068511
913 Ga0373936_0003142
914 Ga0373939_0458559
915 Ga0373945_0001964
916 Ga0373954_0157000
917 Ga0373957_0030375
918 Ga0373943_0001585
919 Ga0373946_0001567
920 Ga0373955_0020136
921 Ga0373942_0274384
922 Ga0373924_0119214
923 Ga0373931_0015843
924 Ga0373935_0015149
925 Ga0373935_0251150
926 Ga0373927_0000705
927 Ga0373927_0628512
928 Ga0373933_0216722
929 Ga0373947_0000098
930 Ga0373937_0087263
931 Ga0373937_0270384
932 Ga0373937_0419905
933 Ga0373925_0040038
934 Ga0373925_0068570
935 Ga0395905_0095725
936 Ga0436363_0244877
937 Ga0436363_0423020
938 Ga0439432_239734
939 Ga0450912_025459
940 Ga0466966_0676007
941 Ga0466964_0355813
942 Ga0453684_1547139
943 Ga0466968_0588582
944 Ga0466959_0009893
945 Ga0466958_1053648
946 Ga0466967_0085057
947 Ga0495653_0115157
948 Ga0495580_0010980
949 Ga0495580_0217151
950 Ga0495580_1063040
951 Ga0495664_0063643
952 Ga0495608_0131566
953 Ga0495618_0917993
954 Ga0495645_0830610
955 Ga0495657_0241166
956 Ga0495646_0281654
957 Ga0495604_0297876
958 Ga0495674_0199281
959 Ga0495674_0727445
960 Ga0495684_0627366
961 Ga0495602_0204015
962 Ga0496100_0068961
963 Ga0496100_0788201
964 Ga0496101_0023109
965 Ga0496101_0401817
966 Ga0496101_1030615
967 Ga0496102_0170629
968 Ga0496102_0659543
969 Ga0496103_0087150
970 Ga0496103_0247958
971 Ga0496103_0576613
972 Ga0496104_0868250
973 Ga0496105_0128480
974 Ga0496105_0198235
975 Ga0496105_0780286
976 Ga0496106_0117945
977 Ga0496107_0021579
978 Ga0496108_0003263
979 Ga0496108_0365417
980 Ga0496109_0002672
981 Ga0496109_0028608
982 Ga0496109_0759867
983 Ga0496109_0925868
984 Ga0496110_0186165
985 Ga0496110_1512889
986 Ga0496111_0108861
987 Ga0496112_0000049
988 Ga0496112_0367048
989 Ga0496113_0000994
990 Ga0496114_0057136
991 Ga0496114_0540731
992 Ga0496114_0582296
993 Ga0496115_0007191
994 Ga0496115_0012807
995 Ga0501031_0408413
996 Ga0501034_1698815
997 Ga0501036_0178317
998 Ga0501036_0385110
999 Ga0501037_0712479
1000 Ga0501038_0313660
1001 Ga0501039_0155220
1002 Ga0501041_0028490
1003 Ga0501046_1106362
1004 Ga0501048_0107761
1005 Ga0501068_0373109
1006 Ga0501071_0211406
1007 Ga0501072_0334292
1008 Ga0501072_0837340
1009 Ga0501074_1204029
1010 Ga0501075_0206761
1011 Ga0501075_0596677
1012 Ga0501076_0063499
1013 Ga0501076_0249311
1014 Ga0501081_0247851
1015 Ga0501035_1476173
1016 Ga0501045_0133138
1017 Ga0501045_0361609
1018 Ga0501045_0589887
1019 nmdc:mga0qj67_173259_c1
1020 nmdc:mga06r32_360819_c1
1021 nmdc:mga08y16_281007_c1
1022 nmdc:mga08y16_880831_c1
1023 nmdc:mga08x19_914999_c1
1024 Ga0495601_0673687
1025 Ga0495601_1080418
1026 Ga0495619_0016847
1027 Ga0495619_1158476
1028 Ga0501082_1346942
1029 Ga0530510_0015549
1030 Ga0530510_0157561

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5abr-assembly1.cif.gz_B structure of fesi protein from azotobacter vinelandii 0.9328 5 106
1m2d-assembly1.cif.gz_B crystal structure at 1.05 angstroms resolution of the cys59ser variant of the thioredoxin-like [2fe-2s] ferredoxin from aquifex aeolicus 0.9274 6 103
1m2b-assembly1.cif.gz_B crystal structure at 1.25 angstroms resolution of the cys55ser variant of the thioredoxin-like [2fe-2s] ferredoxin from aquifex aeolicus 0.9262 6 103
1f37-assembly1.cif.gz_B structure of a thioredoxin-like [2fe-2s] ferredoxin from aquifex aeolicus 0.9185 3 103
5abr-assembly1.cif.gz_B structure of fesi protein from azotobacter vinelandii 0.9073 5 106
ID Description Score Start End Superfamily
5abrB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9328 5 106 3.40.30.10
1m2dB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9274 6 103 3.40.30.10
5abrB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9073 5 106 3.40.30.10
1m2dB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8925 6 103 3.40.30.10
af_Q55BP2_216_308_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8432 6 103 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2E8AY04-F1-model_v4 Ferredoxin 0.9797 1 109
AF-A0A5C5VLH8-F1-model_v4 Ferredoxin, 2Fe-2S 0.9792 1 108
AF-A0A098LAE7-F1-model_v4 Sucraseferredoxin family protein 0.9759 31 103
AF-A0A1U7GPV2-F1-model_v4 Ferredoxin 0.9732 1 114
AF-A0A2E0AR93-F1-model_v4 deleted 0.9731 1 110

Map