F457825

General Info

Members Datasets Scaffolds Average Seq Length
515 237 1030 254

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100164991|Ga0070708_1001649912
Length 268
Sequence VVPGAQNTPAMTVLRNIEAKIESLFEGVFGRAFRTNVQPVELARKLVKEMEDHRVISVSRLYVPNEYTIYLSPADREQFDSYEESLLVELQDYLAENARREKYVLLSPPKVLMETDEDLDVGEFGIATRMAQGGPQLASADEPAPEVAPGATMVYKPKAPVTEAVSAEELGLEREVATLTYNGRKHELDKRRVVIGRSKDSDIQVTDQNVSRRHAEVRQEGAAHWVVDLDSTNGTEVNGRRLKRAKLRPGDTITVGSTDLVFGRETEG

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
148 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
149 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
150 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
151 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
152 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
153 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
154 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
155 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
157 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
158 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
159 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
160 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
161 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
162 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
166 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
167 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
168 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
169 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
173 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
174 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
175 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
176 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
177 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
178 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
179 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
180 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
181 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
182 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
183 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
184 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
185 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
186 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
187 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
188 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
189 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
190 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
191 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
192 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
193 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
194 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
195 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
196 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
197 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
198 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
199 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
200 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
201 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
202 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
203 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
204 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
205 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
206 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
207 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
208 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
209 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
210 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
223 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
224 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
225 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
226 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
227 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
228 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
229 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
230 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
231 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
232 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
233 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
234 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
235 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
236 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
237 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.64
Metatranscriptomes 1.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 14.95
Rhizosphere 84.08
Stem 0
Stem Tuber 0
Unclassified 5.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100164991 3300005445 Bacteria 2066
2 JGI24744J21845_10001793 3300002077 Bacteria 4311
3 Ga0070658_10009850 3300005327 Bacteria 7677
4 Ga0070683_100004556 3300005329 Bacteria 11440
5 Ga0070683_100030628 3300005329 Bacteria 4887
6 Ga0070683_100123900 3300005329 Bacteria 2442
7 Ga0070683_100233391 3300005329 Bacteria 1749
8 Ga0070683_100438744 3300005329 Bacteria 1246
9 Ga0070666_10117267 3300005335 Bacteria 1844
10 Ga0070680_100140963 3300005336 Bacteria 2021
11 Ga0070680_100694362 3300005336 Unclassified 875
12 Ga0070682_100013219 3300005337 Bacteria 4745
13 Ga0070682_100058761 3300005337 Bacteria 2426
14 Ga0068868_100269706 3300005338 Bacteria 1437
15 Ga0068868_100323925 3300005338 Bacteria 1313
16 Ga0068868_100612606 3300005338 Unclassified 966
17 Ga0070660_100051122 3300005339 Bacteria 3182
18 Ga0070660_100080355 3300005339 Bacteria 2558
19 Ga0070660_100127671 3300005339 Bacteria 2033
20 Ga0070660_100236722 3300005339 Bacteria 1486
21 Ga0070689_100006043 3300005340 Bacteria 8341
22 Ga0070687_100004356 3300005343 Bacteria 5635
23 Ga0070661_100019118 3300005344 Bacteria 4878
24 Ga0070661_100028726 3300005344 Bacteria 4012
25 Ga0070661_100056284 3300005344 Bacteria 2881
26 Ga0070692_10083972 3300005345 Bacteria 1720
27 Ga0070668_100157483 3300005347 Bacteria 1841
28 Ga0070669_100542233 3300005353 Bacteria 969
29 Ga0070675_100047462 3300005354 Bacteria 3519
30 Ga0070675_100217797 3300005354 Bacteria 1661
31 Ga0070671_100019176 3300005355 Bacteria 5564
32 Ga0070671_100507016 3300005355 Bacteria 1038
33 Ga0070659_100068385 3300005366 Bacteria 2817
34 Ga0070703_10026495 3300005406 Unclassified 1724
35 Ga0070709_10125637 3300005434 Bacteria 1745
36 Ga0070709_10203059 3300005434 Bacteria 1405
37 Ga0070714_100800717 3300005435 Bacteria 913
38 Ga0070710_10050895 3300005437 Bacteria 2324
39 Ga0070710_10053544 3300005437 Bacteria 2274
40 Ga0070710_10086348 3300005437 Bacteria 1842
41 Ga0070701_10018821 3300005438 Bacteria 3252
42 Ga0070711_100005669 3300005439 Bacteria 7481
43 Ga0070711_100010551 3300005439 Bacteria 5719
44 Ga0070711_100157366 3300005439 Bacteria 1719
45 Ga0070705_100043004 3300005440 Bacteria 2586
46 Ga0070705_100045533 3300005440 Bacteria 2524
47 Ga0070705_100285997 3300005440 Bacteria 1174
48 Ga0070700_100028378 3300005441 Bacteria 3328
49 Ga0070694_100045311 3300005444 Bacteria 2947
50 Ga0070694_100130982 3300005444 Bacteria 1811
51 Ga0070708_100075738 3300005445 Unclassified 3038
52 Ga0070708_100186490 3300005445 Bacteria 1940
53 Ga0070663_100301221 3300005455 Unclassified 1283
54 Ga0070678_100036447 3300005456 Bacteria 3443
55 Ga0070662_100701667 3300005457 Unclassified 856
56 Ga0070681_10006134 3300005458 Bacteria 11669
57 Ga0070681_10020014 3300005458 Bacteria 6705
58 Ga0070681_10080357 3300005458 Bacteria 3216
59 Ga0070681_10137283 3300005458 Bacteria 2375
60 Ga0068867_100122045 3300005459 Bacteria 2015
61 Ga0068867_100231220 3300005459 Bacteria 1495
62 Ga0070706_100048225 3300005467 Bacteria 3932
63 Ga0070706_100109151 3300005467 Bacteria 2574
64 Ga0070706_100188664 3300005467 Unclassified 1926
65 Ga0070706_100195308 3300005467 Bacteria 1890
66 Ga0070707_100063966 3300005468 Bacteria 3531
67 Ga0070707_100213313 3300005468 Bacteria 1881
68 Ga0070707_100361265 3300005468 Bacteria 1411
69 Ga0070698_100011138 3300005471 Bacteria 9554
70 Ga0070698_100071380 3300005471 Bacteria 3482
71 Ga0070698_100075828 3300005471 Unclassified 3366
72 Ga0070698_100276857 3300005471 Bacteria 1610
73 Ga0070699_100008351 3300005518 Bacteria 8974
74 Ga0070699_100104967 3300005518 Bacteria 2478
75 Ga0070699_100232554 3300005518 Bacteria 1644
76 Ga0070679_100011750 3300005530 Bacteria 8346
77 Ga0070679_100014876 3300005530 Bacteria 7475
78 Ga0070679_100048995 3300005530 Bacteria 4208
79 Ga0070679_100150174 3300005530 Bacteria 2307
80 Ga0070679_100196535 3300005530 Bacteria 1984
81 Ga0070679_100288541 3300005530 Bacteria 1592
82 Ga0070679_100431027 3300005530 Bacteria 1264
83 Ga0070684_100007414 3300005535 Bacteria 8525
84 Ga0070684_100028626 3300005535 Bacteria 4714
85 Ga0070684_100057311 3300005535 Bacteria 3401
86 Ga0070684_100090224 3300005535 Bacteria 2725
87 Ga0070697_100110353 3300005536 Bacteria 2291
88 Ga0070697_100137877 3300005536 Bacteria 2050
89 Ga0070697_100207005 3300005536 Unclassified 1669
90 Ga0070672_100029402 3300005543 Bacteria 4120
91 Ga0070686_100000882 3300005544 Bacteria 17415
92 Ga0070695_100035766 3300005545 Bacteria 3121
93 Ga0070695_100163986 3300005545 Bacteria 1562
94 Ga0070695_100187930 3300005545 Unclassified 1468
95 Ga0070696_100022108 3300005546 Bacteria 4319
96 Ga0070696_100126969 3300005546 Bacteria 1852
97 Ga0070696_100193463 3300005546 Bacteria 1515
98 Ga0070693_100065769 3300005547 Bacteria 2120
99 Ga0070693_100070633 3300005547 Bacteria 2055
100 Ga0070665_100010320 3300005548 Bacteria 9447
101 Ga0070665_100012722 3300005548 Bacteria 8476
102 Ga0070704_100010856 3300005549 Bacteria 5556
103 Ga0070704_100113183 3300005549 Unclassified 2069
104 Ga0070704_100334344 3300005549 Bacteria 1273
105 Ga0070704_100353421 3300005549 Bacteria 1241
106 Ga0068855_100134582 3300005563 Bacteria 2820
107 Ga0068855_100143322 3300005563 Bacteria 2721
108 Ga0068855_100150698 3300005563 Bacteria 2645
109 Ga0068855_100163857 3300005563 Bacteria 2521
110 Ga0068855_100217481 3300005563 Bacteria 2144
111 Ga0068857_100239007 3300005577 Bacteria 1662
112 Ga0068857_100279201 3300005577 Bacteria 1536
113 Ga0068856_100014727 3300005614 Bacteria 7548
114 Ga0070702_100043159 3300005615 Bacteria 2539
115 Ga0070702_100132640 3300005615 Bacteria 1575
116 Ga0068852_100008917 3300005616 Bacteria 7420
117 Ga0068852_100018779 3300005616 Bacteria 5454
118 Ga0068861_100054456 3300005719 Bacteria 3047
119 Ga0068851_10184506 3300005834 Bacteria 1157
120 Ga0068860_100250805 3300005843 Unclassified 1724
121 Ga0068862_100171088 3300005844 Bacteria 1945
122 Ga0068862_100267246 3300005844 Bacteria 1563
123 Ga0081455_10115901 3300005937 Bacteria 2120
124 Ga0081455_10246360 3300005937 Bacteria 1310
125 Ga0081539_10001337 3300005985 Bacteria 42952
126 Ga0081539_10002381 3300005985 Bacteria 26854
127 Ga0075432_10009092 3300006058 Bacteria 3385
128 Ga0075432_10058008 3300006058 Bacteria 1374
129 Ga0070715_10006295 3300006163 Bacteria 4025
130 Ga0070715_10025042 3300006163 Bacteria 2360
131 Ga0070716_100028391 3300006173 Bacteria 3014
132 Ga0070716_100133332 3300006173 Bacteria 1573
133 Ga0070712_100072653 3300006175 Bacteria 2465
134 Ga0070712_100077928 3300006175 Bacteria 2390
135 Ga0070712_100140193 3300006175 Bacteria 1844
136 Ga0097621_100212774 3300006237 Bacteria 1682
137 Ga0068871_100126921 3300006358 Bacteria 2160
138 Ga0075428_100268290 3300006844 Bacteria 1837
139 Ga0075433_10028254 3300006852 Bacteria 4767
140 Ga0075434_100255937 3300006871 Bacteria 1769
141 Ga0075434_100708483 3300006871 Unclassified 1024
142 Ga0068865_100066904 3300006881 Bacteria 2536
143 Ga0075435_100003250 3300007076 Bacteria 11007
144 Ga0105240_10056141 3300009093 Bacteria 4928
145 Ga0111539_10008604 3300009094 Bacteria 12962
146 Ga0111539_10028822 3300009094 Bacteria 6771
147 Ga0111539_10232378 3300009094 Bacteria 2147
148 Ga0111539_10582852 3300009094 Bacteria 1303
149 Ga0105245_10014338 3300009098 Bacteria 6906
150 Ga0105245_10018421 3300009098 Bacteria 6105
151 Ga0105247_10045980 3300009101 Bacteria 2679
152 Ga0114129_10157167 3300009147 Bacteria 3108
153 Ga0114129_10176459 3300009147 Bacteria 2910
154 Ga0114129_10468557 3300009147 Bacteria 1650
155 Ga0114129_10538482 3300009147 Bacteria 1520
156 Ga0105243_10256292 3300009148 Bacteria 1564
157 Ga0105243_10891642 3300009148 Bacteria 884
158 Ga0105241_10036189 3300009174 Bacteria 3715
159 Ga0105241_10091299 3300009174 Bacteria 2402
160 Ga0105241_10240445 3300009174 Bacteria 1530
161 Ga0105241_10296901 3300009174 Bacteria 1385
162 Ga0105242_10100939 3300009176 Bacteria 2445
163 Ga0105242_10151768 3300009176 Bacteria 2020
164 Ga0105248_10012896 3300009177 Bacteria 9217
165 Ga0105248_10335436 3300009177 Bacteria 1703
166 Ga0105248_10581861 3300009177 Bacteria 1263
167 Ga0105237_10014709 3300009545 Bacteria 8171
168 Ga0105237_10036688 3300009545 Bacteria 4960
169 Ga0105238_10140086 3300009551 Bacteria 2396
170 Ga0105238_10158418 3300009551 Bacteria 2239
171 Ga0105238_10493146 3300009551 Bacteria 1225
172 Ga0105239_10041352 3300010375 Bacteria 5052
173 Ga0105239_10106137 3300010375 Bacteria 3111
174 Ga0105239_10265134 3300010375 Bacteria 1931
175 Ga0105239_10299370 3300010375 Bacteria 1811
176 Ga0157371_10289190 3300013102 Bacteria 1185
177 Ga0157370_10024363 3300013104 Bacteria 5993
178 Ga0157370_10075451 3300013104 Bacteria 3178
179 Ga0157369_10041940 3300013105 Bacteria 4994
180 Ga0157369_10160247 3300013105 Bacteria 2375
181 Ga0157369_10171665 3300013105 Bacteria 2285
182 Ga0157374_10007613 3300013296 Bacteria 9243
183 Ga0157374_10094031 3300013296 Unclassified 2864
184 Ga0157374_10131967 3300013296 Bacteria 2418
185 Ga0157374_10460045 3300013296 Bacteria 1274
186 Ga0157374_10629637 3300013296 Bacteria 1084
187 Ga0163162_10035104 3300013306 Bacteria 4994
188 Ga0157372_10031241 3300013307 Bacteria 5831
189 Ga0157372_10073647 3300013307 Bacteria 3850
190 Ga0157372_10174932 3300013307 Bacteria 2484
191 Ga0157372_10347660 3300013307 Bacteria 1727
192 Ga0157372_10489550 3300013307 Bacteria 1434
193 Ga0157375_10054945 3300013308 Bacteria 3924
194 Ga0157375_10251851 3300013308 Bacteria 1927
195 Ga0163163_10222989 3300014325 Bacteria 1934
196 Ga0157380_10057318 3300014326 Bacteria 3102
197 Ga0182008_10026573 3300014497 Bacteria 2936
198 Ga0157377_10002098 3300014745 Bacteria 8763
199 Ga0157376_10007389 3300014969 Bacteria 7838
200 Ga0157376_10099407 3300014969 Bacteria 2538
201 Ga0157376_10268776 3300014969 Bacteria 1601
202 Ga0163161_10176369 3300017792 Bacteria 1636
203 Ga0197907_10679802 3300020069 Bacteria 1697
204 Ga0206356_10398049 3300020070 Bacteria 2074
205 Ga0206354_11313656 3300020081 Bacteria 1647
206 Ga0206353_10325612 3300020082 Bacteria 1063
207 Ga0206353_10396433 3300020082 Bacteria 1078
208 Ga0206353_10853590 3300020082 Bacteria 3249
209 Ga0206353_10901412 3300020082 Bacteria 3408
210 Ga0207653_10050528 3300025885 Bacteria 1382
211 Ga0207692_10085007 3300025898 Bacteria 1701
212 Ga0207692_10098203 3300025898 Bacteria 1602
213 Ga0207692_10290180 3300025898 Bacteria 992
214 Ga0207710_10026422 3300025900 Bacteria 2509
215 Ga0207680_10088134 3300025903 Bacteria 1967
216 Ga0207685_10014685 3300025905 Bacteria 2458
217 Ga0207699_10102579 3300025906 Bacteria 1818
218 Ga0207699_10174879 3300025906 Unclassified 1439
219 Ga0207684_10051099 3300025910 Bacteria 3507
220 Ga0207684_10131079 3300025910 Unclassified 2151
221 Ga0207684_10346741 3300025910 Bacteria 1278
222 Ga0207654_10072370 3300025911 Bacteria 2052
223 Ga0207707_10005223 3300025912 Bacteria 11380
224 Ga0207707_10017355 3300025912 Bacteria 6276
225 Ga0207707_10051494 3300025912 Bacteria 3585
226 Ga0207707_10052544 3300025912 Bacteria 3547
227 Ga0207707_10110544 3300025912 Bacteria 2402
228 Ga0207707_10391220 3300025912 Bacteria 1194
229 Ga0207695_10135086 3300025913 Bacteria 2420
230 Ga0207693_10002384 3300025915 Bacteria 16305
231 Ga0207693_10008168 3300025915 Bacteria 8577
232 Ga0207693_10009077 3300025915 Bacteria 8115
233 Ga0207693_10010783 3300025915 Bacteria 7419
234 Ga0207693_10141592 3300025915 Bacteria 1891
235 Ga0207663_10102020 3300025916 Bacteria 1929
236 Ga0207663_10134153 3300025916 Bacteria 1715
237 Ga0207660_10015483 3300025917 Bacteria 5034
238 Ga0207660_10152885 3300025917 Bacteria 1775
239 Ga0207660_10513508 3300025917 Bacteria 973
240 Ga0207662_10150731 3300025918 Bacteria 1479
241 Ga0207662_10395106 3300025918 Bacteria 936
242 Ga0207657_10002384 3300025919 Bacteria 20331
243 Ga0207657_10060001 3300025919 Bacteria 3266
244 Ga0207657_10062690 3300025919 Bacteria 3182
245 Ga0207657_10116500 3300025919 Bacteria 2201
246 Ga0207657_10257510 3300025919 Bacteria 1389
247 Ga0207649_10084344 3300025920 Bacteria 2065
248 Ga0207652_10001617 3300025921 Bacteria 19799
249 Ga0207652_10056552 3300025921 Bacteria 3377
250 Ga0207652_10069050 3300025921 Bacteria 3067
251 Ga0207652_10193131 3300025921 Bacteria 1831
252 Ga0207646_10046338 3300025922 Bacteria 3900
253 Ga0207646_10048041 3300025922 Bacteria 3826
254 Ga0207646_10631514 3300025922 Bacteria 960
255 Ga0207694_10071260 3300025924 Bacteria 2715
256 Ga0207694_10139698 3300025924 Bacteria 1947
257 Ga0207694_10466164 3300025924 Bacteria 1056
258 Ga0207659_10144831 3300025926 Bacteria 1849
259 Ga0207659_10239689 3300025926 Unclassified 1466
260 Ga0207687_10005301 3300025927 Bacteria 8544
261 Ga0207687_10038296 3300025927 Bacteria 3276
262 Ga0207664_10060976 3300025929 Bacteria 3008
263 Ga0207664_10525312 3300025929 Bacteria 1061
264 Ga0207644_10152980 3300025931 Bacteria 1787
265 Ga0207644_10504774 3300025931 Bacteria 998
266 Ga0207690_10047357 3300025932 Bacteria 2852
267 Ga0207690_10062548 3300025932 Bacteria 2535
268 Ga0207706_10130561 3300025933 Bacteria 2210
269 Ga0207706_10655301 3300025933 Unclassified 899
270 Ga0207686_10027905 3300025934 Bacteria 3311
271 Ga0207686_10037627 3300025934 Bacteria 2921
272 Ga0207709_10039167 3300025935 Bacteria 2830
273 Ga0207709_10080641 3300025935 Bacteria 2096
274 Ga0207709_10105822 3300025935 Bacteria 1870
275 Ga0207704_10021559 3300025938 Bacteria 3434
276 Ga0207704_10063828 3300025938 Bacteria 2298
277 Ga0207665_10017757 3300025939 Bacteria 4675
278 Ga0207665_10020439 3300025939 Bacteria 4351
279 Ga0207665_10045178 3300025939 Bacteria 2949
280 Ga0207691_10012724 3300025940 Bacteria 8060
281 Ga0207691_10294452 3300025940 Bacteria 1395
282 Ga0207711_10243864 3300025941 Bacteria 1648
283 Ga0207661_10002185 3300025944 Bacteria 13496
284 Ga0207661_10010650 3300025944 Bacteria 6626
285 Ga0207667_10042610 3300025949 Bacteria 4823
286 Ga0207667_10126682 3300025949 Bacteria 2630
287 Ga0207667_10146776 3300025949 Bacteria 2428
288 Ga0207677_10054669 3300026023 Bacteria 2726
289 Ga0207678_10014906 3300026067 Bacteria 6837
290 Ga0207678_10166544 3300026067 Bacteria 1882
291 Ga0207708_10000175 3300026075 Bacteria 51009
292 Ga0207702_10045220 3300026078 Bacteria 3704
293 Ga0207702_10089817 3300026078 Bacteria 2687
294 Ga0207648_10003615 3300026089 Bacteria 16166
295 Ga0207648_10151898 3300026089 Bacteria 2043
296 Ga0207674_10041908 3300026116 Bacteria 4732
297 Ga0207674_10043639 3300026116 Bacteria 4622
298 Ga0207675_100011403 3300026118 Bacteria 8318
299 Ga0207675_100050894 3300026118 Bacteria 3866
300 Ga0207675_100088617 3300026118 Bacteria 2907
301 Ga0207683_10000262 3300026121 Bacteria 47039
302 Ga0207683_10003823 3300026121 Bacteria 13039
303 Ga0207683_10214023 3300026121 Bacteria 1754
304 Ga0207698_10009280 3300026142 Bacteria 6262
305 Ga0207698_10055068 3300026142 Bacteria 3063
306 Ga0207698_10387593 3300026142 Bacteria 1331
307 Ga0207428_10009593 3300027907 Bacteria 8670
308 Ga0207428_10254432 3300027907 Bacteria 1309
309 Ga0268266_10076075 3300028379 Bacteria 2917
310 Ga0268266_10117744 3300028379 Bacteria 2361
311 Ga0268266_10710367 3300028379 Bacteria 969
312 Ga0268265_10137394 3300028380 Bacteria 2041
313 Ga0268264_10068014 3300028381 Bacteria 3009
314 Ga0307408_100136197 3300031548 Unclassified 1922
315 Ga0307416_100202534 3300032002 Unclassified 1885
316 Ga0307415_100165476 3300032126 Unclassified 1719
317 Ga0373930_0001100 3300034816 Bacteria 3921
318 Ga0373948_0007922 3300034817 Bacteria 1798
319 Ga0373938_0014874 3300034957 Bacteria 1499
320 Ga0373940_0022966 3300035088 Bacteria 1606
321 Ga0373949_0002994 3300035090 Bacteria 4152
322 Ga0373951_0010140 3300035091 Bacteria 2114
323 Ga0373952_0035824 3300035092 Unclassified 1124
324 Ga0373932_0023457 3300035112 Bacteria 1650
325 Ga0373936_0030138 3300035113 Bacteria 2140
326 Ga0373939_0004734 3300035114 Bacteria 3227
327 Ga0373941_0013100 3300035115 Bacteria 2185
328 Ga0373960_0020918 3300035121 Bacteria 1734
329 Ga0373943_0063677 3300035170 Bacteria 1849
330 Ga0373942_0006862 3300035207 Bacteria 2631
331 Ga0373961_0007988 3300035241 Bacteria 2569
332 Ga0373962_0001785 3300035242 Bacteria 5122
333 Ga0373931_0043680 3300035691 Bacteria 2361
334 Ga0373925_0337235 3300037068 Bacteria 1222
335 Ga0395899_0004138 3300037312 Bacteria 11406
336 Ga0395899_0156266 3300037312 Bacteria 1614
337 Ga0395899_0162835 3300037312 Bacteria 1575
338 Ga0395899_0165672 3300037312 Bacteria 1559
339 Ga0395899_0240762 3300037312 Bacteria 1245
340 Ga0395900_0012690 3300037418 Bacteria 8612
341 Ga0395900_0016674 3300037418 Bacteria 7493
342 Ga0395900_0126143 3300037418 Bacteria 2625
343 Ga0395900_0209591 3300037418 Bacteria 1968
344 Ga0395900_0278629 3300037418 Bacteria 1665
345 Ga0395900_0519122 3300037418 Bacteria 1139
346 Ga0395898_0003392 3300037466 Bacteria 17843
347 Ga0395898_0031353 3300037466 Bacteria 5312
348 Ga0395898_0135963 3300037466 Bacteria 2353
349 Ga0395898_0180608 3300037466 Bacteria 2017
350 Ga0395898_0308973 3300037466 Bacteria 1508
351 Ga0395898_0316625 3300037466 Bacteria 1488
352 Ga0395905_0057533 3300037471 Bacteria 3637
353 Ga0395905_0425537 3300037471 Bacteria 1224
354 Ga0436364_0306756 3300037853 Bacteria 1187
355 Ga0395901_0007240 3300038443 Bacteria 11192
356 Ga0395901_0008512 3300038443 Bacteria 10367
357 Ga0395901_0028546 3300038443 Bacteria 5738
358 Ga0395901_0068438 3300038443 Bacteria 3698
359 Ga0395901_0111186 3300038443 Bacteria 2877
360 Ga0395901_0176864 3300038443 Bacteria 2238
361 Ga0395901_0220713 3300038443 Unclassified 1981
362 Ga0395901_0240949 3300038443 Bacteria 1886
363 Ga0395901_0703324 3300038443 Bacteria 1008
364 Ga0436365_1235221 3300039437 Bacteria 5345
365 Ga0436363_0693216 3300039450 Bacteria 1941
366 Ga0451789_0538288 3300041443 Bacteria 934
367 Ga0451793_0727483 3300041452 Bacteria 5847
368 Ga0451847_0764421 3300041503 Bacteria 2545
369 Ga0451851_0356037 3300041507 Bacteria 1975
370 Ga0439451_001076 3300042009 Bacteria 5330
371 Ga0439434_0015964 3300042435 Bacteria 2241
372 Ga0466969_0045215 3300044656 Bacteria 2187
373 Ga0466969_0087268 3300044656 Bacteria 1482
374 Ga0466966_0008383 3300044684 Bacteria 6845
375 Ga0466963_0001990 3300044694 Bacteria 11210
376 Ga0466963_0005726 3300044694 Bacteria 7307
377 Ga0466963_0006122 3300044694 Bacteria 7096
378 Ga0466963_0106740 3300044694 Bacteria 1920
379 Ga0466963_0326020 3300044694 Bacteria 1081
380 Ga0466964_0002308 3300044706 Bacteria 6760
381 Ga0466971_0120518 3300044719 Bacteria 1214
382 Ga0466968_0006214 3300044735 Bacteria 4490
383 Ga0466957_0043540 3300044842 Bacteria 2719
384 Ga0466960_0003672 3300044901 Bacteria 5921
385 Ga0466959_0001383 3300045049 Bacteria 14823
386 Ga0466959_0005306 3300045049 Bacteria 8811
387 Ga0466958_0247094 3300045836 Bacteria 1141
388 Ga0466967_0000346 3300045976 Bacteria 21412
389 Ga0466967_0021834 3300045976 Bacteria 5208
390 Ga0466967_0059737 3300045976 Bacteria 3376
391 Ga0466967_0075399 3300045976 Bacteria 3031
392 Ga0466967_0199355 3300045976 Bacteria 1895
393 Ga0466967_0259814 3300045976 Bacteria 1661
394 Ga0466967_0488730 3300045976 Bacteria 1207
395 Ga0495641_0066769 3300046461 Bacteria 1618
396 Ga0495582_0035069 3300046473 Bacteria 2758
397 Ga0495584_0019988 3300046491 Bacteria 3402
398 Ga0495594_0029836 3300046499 Bacteria 2949
399 Ga0495630_0011017 3300046517 Bacteria 6538
400 Ga0495630_0203246 3300046517 Bacteria 1512
401 Ga0495630_0629900 3300046517 Bacteria 822
402 Ga0495644_0126021 3300046523 Bacteria 975
403 Ga0495642_0002088 3300046528 Bacteria 8279
404 Ga0495642_0058931 3300046528 Bacteria 1591
405 Ga0495609_0113930 3300046538 Bacteria 1166
406 Ga0495634_0306405 3300046642 Bacteria 959
407 Ga0495659_0042899 3300046664 Bacteria 1621
408 Ga0495659_0071964 3300046664 Bacteria 1297
409 Ga0495589_0198295 3300046794 Bacteria 948
410 Ga0495676_0060410 3300047321 Bacteria 2971
411 Ga0495676_0177536 3300047321 Bacteria 1495
412 Ga0495685_013145 3300047447 Bacteria 2808
413 Ga0496100_0282239 3300048903 Bacteria 1238
414 Ga0496100_0352194 3300048903 Bacteria 1112
415 Ga0496101_0013584 3300048904 Bacteria 5460
416 Ga0496101_0017929 3300048904 Bacteria 4805
417 Ga0496101_0025568 3300048904 Bacteria 4098
418 Ga0496101_0039432 3300048904 Bacteria 3359
419 Ga0496101_0225244 3300048904 Bacteria 1456
420 Ga0496101_0325028 3300048904 Bacteria 1207
421 Ga0496102_0022821 3300048905 Bacteria 5548
422 Ga0496102_0052344 3300048905 Bacteria 3720
423 Ga0496102_0066458 3300048905 Bacteria 3304
424 Ga0496102_0124193 3300048905 Bacteria 2412
425 Ga0496102_0396039 3300048905 Unclassified 1298
426 Ga0496103_0034717 3300048906 Bacteria 3085
427 Ga0496103_0051435 3300048906 Bacteria 2550
428 Ga0496103_0080133 3300048906 Unclassified 2053
429 Ga0496103_0193175 3300048906 Bacteria 1309
430 Ga0496104_0000403 3300048907 Bacteria 37862
431 Ga0496104_0034978 3300048907 Bacteria 4688
432 Ga0496104_0097587 3300048907 Bacteria 2813
433 Ga0496104_0176674 3300048907 Bacteria 2045
434 Ga0496104_0291739 3300048907 Unclassified 1544
435 Ga0496105_0000102 3300048908 Bacteria 57870
436 Ga0496105_0019071 3300048908 Bacteria 5528
437 Ga0496105_0038565 3300048908 Bacteria 3936
438 Ga0496105_0038801 3300048908 Bacteria 3924
439 Ga0496105_0081667 3300048908 Bacteria 2670
440 Ga0496106_0015274 3300048909 Bacteria 5681
441 Ga0496106_0038036 3300048909 Bacteria 3600
442 Ga0496106_0140231 3300048909 Bacteria 1901
443 Ga0496106_0242469 3300048909 Bacteria 1440
444 Ga0496107_0014544 3300048910 Bacteria 5508
445 Ga0496107_0027528 3300048910 Bacteria 4036
446 Ga0496107_0311248 3300048910 Bacteria 1172
447 Ga0496108_0003291 3300048911 Bacteria 12982
448 Ga0496108_0009169 3300048911 Bacteria 8008
449 Ga0496108_0030315 3300048911 Bacteria 4483
450 Ga0496108_0296275 3300048911 Bacteria 1409
451 Ga0496108_0615326 3300048911 Unclassified 946
452 Ga0496109_0000779 3300048912 Bacteria 26493
453 Ga0496109_0001163 3300048912 Bacteria 21902
454 Ga0496109_0005496 3300048912 Bacteria 10610
455 Ga0496109_0019622 3300048912 Bacteria 5964
456 Ga0496109_0030508 3300048912 Bacteria 4832
457 Ga0496109_0070412 3300048912 Bacteria 3209
458 Ga0496110_0000129 3300048913 Bacteria 43131
459 Ga0496110_0000764 3300048913 Bacteria 22274
460 Ga0496110_0013468 3300048913 Bacteria 6763
461 Ga0496111_0002240 3300048914 Bacteria 11613
462 Ga0496111_0002496 3300048914 Bacteria 11096
463 Ga0496111_0005689 3300048914 Bacteria 8032
464 Ga0496111_0062509 3300048914 Bacteria 2700
465 Ga0496111_0113543 3300048914 Bacteria 1996
466 Ga0496111_0198111 3300048914 Bacteria 1493
467 Ga0496112_0079039 3300048915 Bacteria 3253
468 Ga0496112_0094279 3300048915 Bacteria 2964
469 Ga0496112_0117650 3300048915 Bacteria 2628
470 Ga0496112_0134762 3300048915 Bacteria 2440
471 Ga0496112_0471180 3300048915 Bacteria 1193
472 Ga0496113_0009965 3300048916 Bacteria 6262
473 Ga0496113_0083354 3300048916 Bacteria 2453
474 Ga0496113_0114113 3300048916 Bacteria 2106
475 Ga0496113_0127558 3300048916 Bacteria 1993
476 Ga0496113_0398352 3300048916 Bacteria 1105
477 Ga0496114_0003720 3300048917 Bacteria 11746
478 Ga0496114_0009165 3300048917 Bacteria 7846
479 Ga0496114_0040841 3300048917 Bacteria 3842
480 Ga0496114_0050322 3300048917 Bacteria 3468
481 Ga0496114_0079301 3300048917 Bacteria 2771
482 Ga0496114_0229001 3300048917 Unclassified 1632
483 Ga0496114_0529302 3300048917 Bacteria 1042
484 Ga0496114_0549359 3300048917 Bacteria 1020
485 Ga0496115_0072508 3300048918 Bacteria 2794
486 Ga0496115_0091926 3300048918 Bacteria 2480
487 Ga0496115_0112157 3300048918 Bacteria 2240
488 Ga0501039_0891192 3300049575 Bacteria 693
489 Ga0501040_0038928 3300049576 Bacteria 3234
490 Ga0501041_0158168 3300049577 Bacteria 1416
491 Ga0501067_0002988 3300049583 Bacteria 9331
492 Ga0501068_0057807 3300049584 Bacteria 2352
493 Ga0501069_0001301 3300049585 Bacteria 12241
494 Ga0501071_0127093 3300049587 Bacteria 1893
495 Ga0501071_0414041 3300049587 Bacteria 1030
496 Ga0501079_0017145 3300049741 Bacteria 5531
497 Ga0501081_0037887 3300049743 Bacteria 3291
498 nmdc:mga05p37_416960_c1 3300050507 Bacteria 1564
499 nmdc:mga06r32_331888_c1 3300050510 Bacteria 1506
500 nmdc:mga08y16_106732_c1 3300050511 Bacteria 2915
501 nmdc:mga08y16_252202_c1 3300050511 Bacteria 1823
502 nmdc:mga08y16_35476_c1 3300050511 Bacteria 5237
503 nmdc:mga0n895_35418_c1 3300050512 Bacteria 4813
504 nmdc:mga0n895_88490_c1 3300050512 Bacteria 3097
505 nmdc:mga0rr50_10544_c1 3300050513 Bacteria 5870
506 nmdc:mga0rr50_250957_c1 3300050513 Bacteria 1470
507 nmdc:mga0rr50_304111_c1 3300050513 Bacteria 1334
508 nmdc:mga08x19_23218_c1 3300050514 Bacteria 3847
509 nmdc:mga08x19_2896_c1 3300050514 Bacteria 10329
510 nmdc:mga0a205_73644_c1 3300050515 Bacteria 3299
511 Ga0495619_0069688 3300053085 Bacteria 2351
512 Ga0501084_0229372 3300054114 Bacteria 1567
513 Ga0530510_0035317 3300061734 Bacteria 3603
514 Ga0530510_0170971 3300061734 Bacteria 1609
515 Ga0530510_0546583 3300061734 Bacteria 879
516 Ga0070708_100164991
517 JGI24744J21845_10001793
518 Ga0070658_10009850
519 Ga0070683_100004556
520 Ga0070683_100030628
521 Ga0070683_100123900
522 Ga0070683_100233391
523 Ga0070683_100438744
524 Ga0070666_10117267
525 Ga0070680_100140963
526 Ga0070680_100694362
527 Ga0070682_100013219
528 Ga0070682_100058761
529 Ga0068868_100269706
530 Ga0068868_100323925
531 Ga0068868_100612606
532 Ga0070660_100051122
533 Ga0070660_100080355
534 Ga0070660_100127671
535 Ga0070660_100236722
536 Ga0070689_100006043
537 Ga0070687_100004356
538 Ga0070661_100019118
539 Ga0070661_100028726
540 Ga0070661_100056284
541 Ga0070692_10083972
542 Ga0070668_100157483
543 Ga0070669_100542233
544 Ga0070675_100047462
545 Ga0070675_100217797
546 Ga0070671_100019176
547 Ga0070671_100507016
548 Ga0070659_100068385
549 Ga0070703_10026495
550 Ga0070709_10125637
551 Ga0070709_10203059
552 Ga0070714_100800717
553 Ga0070710_10050895
554 Ga0070710_10053544
555 Ga0070710_10086348
556 Ga0070701_10018821
557 Ga0070711_100005669
558 Ga0070711_100010551
559 Ga0070711_100157366
560 Ga0070705_100043004
561 Ga0070705_100045533
562 Ga0070705_100285997
563 Ga0070700_100028378
564 Ga0070694_100045311
565 Ga0070694_100130982
566 Ga0070708_100075738
567 Ga0070708_100186490
568 Ga0070663_100301221
569 Ga0070678_100036447
570 Ga0070662_100701667
571 Ga0070681_10006134
572 Ga0070681_10020014
573 Ga0070681_10080357
574 Ga0070681_10137283
575 Ga0068867_100122045
576 Ga0068867_100231220
577 Ga0070706_100048225
578 Ga0070706_100109151
579 Ga0070706_100188664
580 Ga0070706_100195308
581 Ga0070707_100063966
582 Ga0070707_100213313
583 Ga0070707_100361265
584 Ga0070698_100011138
585 Ga0070698_100071380
586 Ga0070698_100075828
587 Ga0070698_100276857
588 Ga0070699_100008351
589 Ga0070699_100104967
590 Ga0070699_100232554
591 Ga0070679_100011750
592 Ga0070679_100014876
593 Ga0070679_100048995
594 Ga0070679_100150174
595 Ga0070679_100196535
596 Ga0070679_100288541
597 Ga0070679_100431027
598 Ga0070684_100007414
599 Ga0070684_100028626
600 Ga0070684_100057311
601 Ga0070684_100090224
602 Ga0070697_100110353
603 Ga0070697_100137877
604 Ga0070697_100207005
605 Ga0070672_100029402
606 Ga0070686_100000882
607 Ga0070695_100035766
608 Ga0070695_100163986
609 Ga0070695_100187930
610 Ga0070696_100022108
611 Ga0070696_100126969
612 Ga0070696_100193463
613 Ga0070693_100065769
614 Ga0070693_100070633
615 Ga0070665_100010320
616 Ga0070665_100012722
617 Ga0070704_100010856
618 Ga0070704_100113183
619 Ga0070704_100334344
620 Ga0070704_100353421
621 Ga0068855_100134582
622 Ga0068855_100143322
623 Ga0068855_100150698
624 Ga0068855_100163857
625 Ga0068855_100217481
626 Ga0068857_100239007
627 Ga0068857_100279201
628 Ga0068856_100014727
629 Ga0070702_100043159
630 Ga0070702_100132640
631 Ga0068852_100008917
632 Ga0068852_100018779
633 Ga0068861_100054456
634 Ga0068851_10184506
635 Ga0068860_100250805
636 Ga0068862_100171088
637 Ga0068862_100267246
638 Ga0081455_10115901
639 Ga0081455_10246360
640 Ga0081539_10001337
641 Ga0081539_10002381
642 Ga0075432_10009092
643 Ga0075432_10058008
644 Ga0070715_10006295
645 Ga0070715_10025042
646 Ga0070716_100028391
647 Ga0070716_100133332
648 Ga0070712_100072653
649 Ga0070712_100077928
650 Ga0070712_100140193
651 Ga0097621_100212774
652 Ga0068871_100126921
653 Ga0075428_100268290
654 Ga0075433_10028254
655 Ga0075434_100255937
656 Ga0075434_100708483
657 Ga0068865_100066904
658 Ga0075435_100003250
659 Ga0105240_10056141
660 Ga0111539_10008604
661 Ga0111539_10028822
662 Ga0111539_10232378
663 Ga0111539_10582852
664 Ga0105245_10014338
665 Ga0105245_10018421
666 Ga0105247_10045980
667 Ga0114129_10157167
668 Ga0114129_10176459
669 Ga0114129_10468557
670 Ga0114129_10538482
671 Ga0105243_10256292
672 Ga0105243_10891642
673 Ga0105241_10036189
674 Ga0105241_10091299
675 Ga0105241_10240445
676 Ga0105241_10296901
677 Ga0105242_10100939
678 Ga0105242_10151768
679 Ga0105248_10012896
680 Ga0105248_10335436
681 Ga0105248_10581861
682 Ga0105237_10014709
683 Ga0105237_10036688
684 Ga0105238_10140086
685 Ga0105238_10158418
686 Ga0105238_10493146
687 Ga0105239_10041352
688 Ga0105239_10106137
689 Ga0105239_10265134
690 Ga0105239_10299370
691 Ga0157371_10289190
692 Ga0157370_10024363
693 Ga0157370_10075451
694 Ga0157369_10041940
695 Ga0157369_10160247
696 Ga0157369_10171665
697 Ga0157374_10007613
698 Ga0157374_10094031
699 Ga0157374_10131967
700 Ga0157374_10460045
701 Ga0157374_10629637
702 Ga0163162_10035104
703 Ga0157372_10031241
704 Ga0157372_10073647
705 Ga0157372_10174932
706 Ga0157372_10347660
707 Ga0157372_10489550
708 Ga0157375_10054945
709 Ga0157375_10251851
710 Ga0163163_10222989
711 Ga0157380_10057318
712 Ga0182008_10026573
713 Ga0157377_10002098
714 Ga0157376_10007389
715 Ga0157376_10099407
716 Ga0157376_10268776
717 Ga0163161_10176369
718 Ga0197907_10679802
719 Ga0206356_10398049
720 Ga0206354_11313656
721 Ga0206353_10325612
722 Ga0206353_10396433
723 Ga0206353_10853590
724 Ga0206353_10901412
725 Ga0207653_10050528
726 Ga0207692_10085007
727 Ga0207692_10098203
728 Ga0207692_10290180
729 Ga0207710_10026422
730 Ga0207680_10088134
731 Ga0207685_10014685
732 Ga0207699_10102579
733 Ga0207699_10174879
734 Ga0207684_10051099
735 Ga0207684_10131079
736 Ga0207684_10346741
737 Ga0207654_10072370
738 Ga0207707_10005223
739 Ga0207707_10017355
740 Ga0207707_10051494
741 Ga0207707_10052544
742 Ga0207707_10110544
743 Ga0207707_10391220
744 Ga0207695_10135086
745 Ga0207693_10002384
746 Ga0207693_10008168
747 Ga0207693_10009077
748 Ga0207693_10010783
749 Ga0207693_10141592
750 Ga0207663_10102020
751 Ga0207663_10134153
752 Ga0207660_10015483
753 Ga0207660_10152885
754 Ga0207660_10513508
755 Ga0207662_10150731
756 Ga0207662_10395106
757 Ga0207657_10002384
758 Ga0207657_10060001
759 Ga0207657_10062690
760 Ga0207657_10116500
761 Ga0207657_10257510
762 Ga0207649_10084344
763 Ga0207652_10001617
764 Ga0207652_10056552
765 Ga0207652_10069050
766 Ga0207652_10193131
767 Ga0207646_10046338
768 Ga0207646_10048041
769 Ga0207646_10631514
770 Ga0207694_10071260
771 Ga0207694_10139698
772 Ga0207694_10466164
773 Ga0207659_10144831
774 Ga0207659_10239689
775 Ga0207687_10005301
776 Ga0207687_10038296
777 Ga0207664_10060976
778 Ga0207664_10525312
779 Ga0207644_10152980
780 Ga0207644_10504774
781 Ga0207690_10047357
782 Ga0207690_10062548
783 Ga0207706_10130561
784 Ga0207706_10655301
785 Ga0207686_10027905
786 Ga0207686_10037627
787 Ga0207709_10039167
788 Ga0207709_10080641
789 Ga0207709_10105822
790 Ga0207704_10021559
791 Ga0207704_10063828
792 Ga0207665_10017757
793 Ga0207665_10020439
794 Ga0207665_10045178
795 Ga0207691_10012724
796 Ga0207691_10294452
797 Ga0207711_10243864
798 Ga0207661_10002185
799 Ga0207661_10010650
800 Ga0207667_10042610
801 Ga0207667_10126682
802 Ga0207667_10146776
803 Ga0207677_10054669
804 Ga0207678_10014906
805 Ga0207678_10166544
806 Ga0207708_10000175
807 Ga0207702_10045220
808 Ga0207702_10089817
809 Ga0207648_10003615
810 Ga0207648_10151898
811 Ga0207674_10041908
812 Ga0207674_10043639
813 Ga0207675_100011403
814 Ga0207675_100050894
815 Ga0207675_100088617
816 Ga0207683_10000262
817 Ga0207683_10003823
818 Ga0207683_10214023
819 Ga0207698_10009280
820 Ga0207698_10055068
821 Ga0207698_10387593
822 Ga0207428_10009593
823 Ga0207428_10254432
824 Ga0268266_10076075
825 Ga0268266_10117744
826 Ga0268266_10710367
827 Ga0268265_10137394
828 Ga0268264_10068014
829 Ga0307408_100136197
830 Ga0307416_100202534
831 Ga0307415_100165476
832 Ga0373930_0001100
833 Ga0373948_0007922
834 Ga0373938_0014874
835 Ga0373940_0022966
836 Ga0373949_0002994
837 Ga0373951_0010140
838 Ga0373952_0035824
839 Ga0373932_0023457
840 Ga0373936_0030138
841 Ga0373939_0004734
842 Ga0373941_0013100
843 Ga0373960_0020918
844 Ga0373943_0063677
845 Ga0373942_0006862
846 Ga0373961_0007988
847 Ga0373962_0001785
848 Ga0373931_0043680
849 Ga0373925_0337235
850 Ga0395899_0004138
851 Ga0395899_0156266
852 Ga0395899_0162835
853 Ga0395899_0165672
854 Ga0395899_0240762
855 Ga0395900_0012690
856 Ga0395900_0016674
857 Ga0395900_0126143
858 Ga0395900_0209591
859 Ga0395900_0278629
860 Ga0395900_0519122
861 Ga0395898_0003392
862 Ga0395898_0031353
863 Ga0395898_0135963
864 Ga0395898_0180608
865 Ga0395898_0308973
866 Ga0395898_0316625
867 Ga0395905_0057533
868 Ga0395905_0425537
869 Ga0436364_0306756
870 Ga0395901_0007240
871 Ga0395901_0008512
872 Ga0395901_0028546
873 Ga0395901_0068438
874 Ga0395901_0111186
875 Ga0395901_0176864
876 Ga0395901_0220713
877 Ga0395901_0240949
878 Ga0395901_0703324
879 Ga0436365_1235221
880 Ga0436363_0693216
881 Ga0451789_0538288
882 Ga0451793_0727483
883 Ga0451847_0764421
884 Ga0451851_0356037
885 Ga0439451_001076
886 Ga0439434_0015964
887 Ga0466969_0045215
888 Ga0466969_0087268
889 Ga0466966_0008383
890 Ga0466963_0001990
891 Ga0466963_0005726
892 Ga0466963_0006122
893 Ga0466963_0106740
894 Ga0466963_0326020
895 Ga0466964_0002308
896 Ga0466971_0120518
897 Ga0466968_0006214
898 Ga0466957_0043540
899 Ga0466960_0003672
900 Ga0466959_0001383
901 Ga0466959_0005306
902 Ga0466958_0247094
903 Ga0466967_0000346
904 Ga0466967_0021834
905 Ga0466967_0059737
906 Ga0466967_0075399
907 Ga0466967_0199355
908 Ga0466967_0259814
909 Ga0466967_0488730
910 Ga0495641_0066769
911 Ga0495582_0035069
912 Ga0495584_0019988
913 Ga0495594_0029836
914 Ga0495630_0011017
915 Ga0495630_0203246
916 Ga0495630_0629900
917 Ga0495644_0126021
918 Ga0495642_0002088
919 Ga0495642_0058931
920 Ga0495609_0113930
921 Ga0495634_0306405
922 Ga0495659_0042899
923 Ga0495659_0071964
924 Ga0495589_0198295
925 Ga0495676_0060410
926 Ga0495676_0177536
927 Ga0495685_013145
928 Ga0496100_0282239
929 Ga0496100_0352194
930 Ga0496101_0013584
931 Ga0496101_0017929
932 Ga0496101_0025568
933 Ga0496101_0039432
934 Ga0496101_0225244
935 Ga0496101_0325028
936 Ga0496102_0022821
937 Ga0496102_0052344
938 Ga0496102_0066458
939 Ga0496102_0124193
940 Ga0496102_0396039
941 Ga0496103_0034717
942 Ga0496103_0051435
943 Ga0496103_0080133
944 Ga0496103_0193175
945 Ga0496104_0000403
946 Ga0496104_0034978
947 Ga0496104_0097587
948 Ga0496104_0176674
949 Ga0496104_0291739
950 Ga0496105_0000102
951 Ga0496105_0019071
952 Ga0496105_0038565
953 Ga0496105_0038801
954 Ga0496105_0081667
955 Ga0496106_0015274
956 Ga0496106_0038036
957 Ga0496106_0140231
958 Ga0496106_0242469
959 Ga0496107_0014544
960 Ga0496107_0027528
961 Ga0496107_0311248
962 Ga0496108_0003291
963 Ga0496108_0009169
964 Ga0496108_0030315
965 Ga0496108_0296275
966 Ga0496108_0615326
967 Ga0496109_0000779
968 Ga0496109_0001163
969 Ga0496109_0005496
970 Ga0496109_0019622
971 Ga0496109_0030508
972 Ga0496109_0070412
973 Ga0496110_0000129
974 Ga0496110_0000764
975 Ga0496110_0013468
976 Ga0496111_0002240
977 Ga0496111_0002496
978 Ga0496111_0005689
979 Ga0496111_0062509
980 Ga0496111_0113543
981 Ga0496111_0198111
982 Ga0496112_0079039
983 Ga0496112_0094279
984 Ga0496112_0117650
985 Ga0496112_0134762
986 Ga0496112_0471180
987 Ga0496113_0009965
988 Ga0496113_0083354
989 Ga0496113_0114113
990 Ga0496113_0127558
991 Ga0496113_0398352
992 Ga0496114_0003720
993 Ga0496114_0009165
994 Ga0496114_0040841
995 Ga0496114_0050322
996 Ga0496114_0079301
997 Ga0496114_0229001
998 Ga0496114_0529302
999 Ga0496114_0549359
1000 Ga0496115_0072508
1001 Ga0496115_0091926
1002 Ga0496115_0112157
1003 Ga0501039_0891192
1004 Ga0501040_0038928
1005 Ga0501041_0158168
1006 Ga0501067_0002988
1007 Ga0501068_0057807
1008 Ga0501069_0001301
1009 Ga0501071_0127093
1010 Ga0501071_0414041
1011 Ga0501079_0017145
1012 Ga0501081_0037887
1013 nmdc:mga05p37_416960_c1
1014 nmdc:mga06r32_331888_c1
1015 nmdc:mga08y16_106732_c1
1016 nmdc:mga08y16_252202_c1
1017 nmdc:mga08y16_35476_c1
1018 nmdc:mga0n895_35418_c1
1019 nmdc:mga0n895_88490_c1
1020 nmdc:mga0rr50_10544_c1
1021 nmdc:mga0rr50_250957_c1
1022 nmdc:mga0rr50_304111_c1
1023 nmdc:mga08x19_23218_c1
1024 nmdc:mga08x19_2896_c1
1025 nmdc:mga0a205_73644_c1
1026 Ga0495619_0069688
1027 Ga0501084_0229372
1028 Ga0530510_0035317
1029 Ga0530510_0170971
1030 Ga0530510_0546583

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00498

FHA

FHA domain

193

256

0.98

PF12401

FhaA_N

FhaA, N-terminal domain

14

127

0.98

PF16697

Yop-YscD_cpl

Inner membrane component of T3SS, cytoplasmic domain

180

266

0.93

Map