F457778

General Info

Members Datasets Scaffolds Average Seq Length
514 186 1028 85

Family's Representative Sequence

Representative Sequence 3300047447|Ga0495685_053707|Ga0495685_053707_715_1029
Length 104
Sequence MLDSFAAQLLLQRRHFKEWPMNVPEGWTLEEGGKALTRTLKFKDFSEAFGFLTRVALYAEKADHHPEFTSVWNRVDFRLTSHDAGGVTDRDLKLAQTINELAPH

Samples

Sample ID Description Type Environment
1 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
150 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
151 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
152 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
153 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
154 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
155 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
156 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
157 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
158 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
159 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
160 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
161 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
162 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
163 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
166 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
167 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
168 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
169 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
170 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
171 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
172 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
173 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
182 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
183 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
184 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
185 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
186 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.36
Rhizosphere 98.05
Stem 0
Stem Tuber 0
Unclassified 3.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495685_053707 3300047447 Bacteria 1364
2 JGI24736J21556_1001189 3300001904 Bacteria 4778
3 JGI24736J21556_1007099 3300001904 Bacteria 1887
4 JGI24740J21852_10012406 3300001979 Bacteria 3212
5 JGI24740J21852_10022394 3300001979 Bacteria 2176
6 JGI24740J21852_10022788 3300001979 Bacteria 2149
7 JGI24740J21852_10143801 3300001979 Bacteria 593
8 JGI24739J22299_10049041 3300001989 Bacteria 1370
9 JGI24737J22298_10000636 3300001990 Bacteria 12348
10 JGI24737J22298_10046383 3300001990 Bacteria 1326
11 JGI24737J22298_10062487 3300001990 Unclassified 1119
12 JGI24737J22298_10266151 3300001990 Bacteria 507
13 JGI24735J21928_10223687 3300002067 Bacteria 547
14 JGI24738J21930_10004295 3300002075 Bacteria 3506
15 Ga0065715_10016748 3300005293 Bacteria 2307
16 Ga0070658_10051194 3300005327 Bacteria 3347
17 Ga0070658_10199822 3300005327 Bacteria 1686
18 Ga0070658_10308359 3300005327 Bacteria 1350
19 Ga0070658_10467783 3300005327 Bacteria 1087
20 Ga0070676_10193689 3300005328 Bacteria 1329
21 Ga0070683_100036349 3300005329 Bacteria 4507
22 Ga0070683_100067719 3300005329 Bacteria 3325
23 Ga0070683_102407826 3300005329 Bacteria 505
24 Ga0070690_100041648 3300005330 Unclassified 2908
25 Ga0070670_100051669 3300005331 Bacteria 3529
26 Ga0070670_100063582 3300005331 Bacteria 3167
27 Ga0070670_101873703 3300005331 Bacteria 552
28 Ga0070677_10079455 3300005333 Bacteria 1400
29 Ga0068869_100187315 3300005334 Bacteria 1625
30 Ga0070666_10106918 3300005335 Bacteria 1933
31 Ga0070666_10131331 3300005335 Bacteria 1740
32 Ga0070680_100026458 3300005336 Bacteria 4640
33 Ga0070680_100071469 3300005336 Bacteria 2851
34 Ga0070680_100080684 3300005336 Bacteria 2683
35 Ga0070680_100162935 3300005336 Bacteria 1874
36 Ga0070682_100020530 3300005337 Bacteria 3888
37 Ga0070682_100044956 3300005337 Bacteria 2736
38 Ga0068868_100111310 3300005338 Bacteria 2225
39 Ga0070660_100011671 3300005339 Bacteria 6254
40 Ga0070660_100028930 3300005339 Bacteria 4149
41 Ga0070660_100050134 3300005339 Bacteria 3211
42 Ga0070660_100062576 3300005339 Bacteria 2891
43 Ga0070660_100083565 3300005339 Bacteria 2508
44 Ga0070660_100116913 3300005339 Bacteria 2126
45 Ga0070660_100306875 3300005339 Bacteria 1302
46 Ga0070660_101163306 3300005339 Bacteria 654
47 Ga0070689_100132189 3300005340 Bacteria 2002
48 Ga0070661_100042947 3300005344 Bacteria 3301
49 Ga0070661_100088145 3300005344 Bacteria 2296
50 Ga0070661_100108180 3300005344 Bacteria 2074
51 Ga0070661_100119959 3300005344 Bacteria 1969
52 Ga0070661_100130438 3300005344 Bacteria 1887
53 Ga0070661_100204841 3300005344 Bacteria 1508
54 Ga0070661_100228390 3300005344 Bacteria 1430
55 Ga0070661_100379850 3300005344 Bacteria 1113
56 Ga0070661_100449030 3300005344 Bacteria 1026
57 Ga0070692_10129904 3300005345 Bacteria 1415
58 Ga0070668_100180167 3300005347 Bacteria 1725
59 Ga0070668_100238425 3300005347 Bacteria 1506
60 Ga0070668_100255538 3300005347 Bacteria 1456
61 Ga0070668_100915193 3300005347 Unclassified 784
62 Ga0070669_100044111 3300005353 Bacteria 3249
63 Ga0070669_100052547 3300005353 Bacteria 2982
64 Ga0070669_100554323 3300005353 Bacteria 959
65 Ga0070669_101027010 3300005353 Bacteria 708
66 Ga0070675_100149565 3300005354 Bacteria 2001
67 Ga0070671_100025495 3300005355 Bacteria 4852
68 Ga0070671_100054189 3300005355 Bacteria 3334
69 Ga0070671_100075610 3300005355 Bacteria 2814
70 Ga0070671_100096409 3300005355 Bacteria 2480
71 Ga0070671_101829295 3300005355 Bacteria 540
72 Ga0070674_100118013 3300005356 Bacteria 1960
73 Ga0070674_100467037 3300005356 Bacteria 1045
74 Ga0070674_100868340 3300005356 Bacteria 784
75 Ga0070673_100086124 3300005364 Bacteria 2559
76 Ga0070673_100427964 3300005364 Bacteria 1188
77 Ga0070673_100952242 3300005364 Bacteria 798
78 Ga0070673_101117000 3300005364 Bacteria 737
79 Ga0070673_101476939 3300005364 Unclassified 641
80 Ga0070673_101524091 3300005364 Bacteria 631
81 Ga0070659_100017184 3300005366 Bacteria 5438
82 Ga0070659_100045351 3300005366 Bacteria 3443
83 Ga0070659_100137647 3300005366 Bacteria 1986
84 Ga0070659_100226808 3300005366 Bacteria 1543
85 Ga0070659_100404073 3300005366 Bacteria 1153
86 Ga0070659_101881399 3300005366 Bacteria 536
87 Ga0070667_100006173 3300005367 Bacteria 9961
88 Ga0070667_100046959 3300005367 Bacteria 3633
89 Ga0070667_101053075 3300005367 Bacteria 760
90 Ga0070663_100017373 3300005455 Bacteria 4694
91 Ga0070663_100021677 3300005455 Bacteria 4278
92 Ga0070663_100032144 3300005455 Bacteria 3614
93 Ga0070663_100051901 3300005455 Bacteria 2923
94 Ga0070663_100271075 3300005455 Bacteria 1349
95 Ga0070663_100349009 3300005455 Unclassified 1198
96 Ga0070663_101042172 3300005455 Bacteria 713
97 Ga0070663_101229507 3300005455 Bacteria 659
98 Ga0070678_100057492 3300005456 Bacteria 2850
99 Ga0070678_100176052 3300005456 Bacteria 1747
100 Ga0070662_100010637 3300005457 Bacteria 6050
101 Ga0070662_100056965 3300005457 Bacteria 2838
102 Ga0070662_100248195 3300005457 Unclassified 1430
103 Ga0070662_100506132 3300005457 Bacteria 1008
104 Ga0070681_10087681 3300005458 Bacteria 3065
105 Ga0070681_10121410 3300005458 Bacteria 2547
106 Ga0070681_10772041 3300005458 Bacteria 878
107 Ga0070681_10965488 3300005458 Bacteria 771
108 Ga0070679_100291023 3300005530 Bacteria 1585
109 Ga0070679_100526097 3300005530 Bacteria 1126
110 Ga0070679_100977476 3300005530 Bacteria 790
111 Ga0070684_100025006 3300005535 Bacteria 5014
112 Ga0070684_100153624 3300005535 Bacteria 2086
113 Ga0070684_100384381 3300005535 Bacteria 1293
114 Ga0070684_100677362 3300005535 Bacteria 961
115 Ga0068853_100051542 3300005539 Bacteria 3542
116 Ga0068853_100054561 3300005539 Bacteria 3444
117 Ga0068853_100119979 3300005539 Bacteria 2344
118 Ga0068853_100260381 3300005539 Bacteria 1594
119 Ga0070672_100136073 3300005543 Bacteria 2024
120 Ga0070672_100893541 3300005543 Bacteria 784
121 Ga0070695_100376796 3300005545 Bacteria 1070
122 Ga0070696_100220094 3300005546 Bacteria 1424
123 Ga0070693_100013265 3300005547 Bacteria 4194
124 Ga0070665_100054307 3300005548 Bacteria 4018
125 Ga0070665_100207543 3300005548 Bacteria 1960
126 Ga0070665_100375089 3300005548 Bacteria 1430
127 Ga0070665_100500749 3300005548 Bacteria 1226
128 Ga0068855_100001613 3300005563 Bacteria 28302
129 Ga0068855_100009002 3300005563 Bacteria 12062
130 Ga0068855_100347496 3300005563 Bacteria 1634
131 Ga0068855_100439305 3300005563 Bacteria 1425
132 Ga0068855_100487202 3300005563 Bacteria 1341
133 Ga0070664_100008740 3300005564 Bacteria 8202
134 Ga0070664_100010024 3300005564 Bacteria 7679
135 Ga0070664_100033467 3300005564 Bacteria 4305
136 Ga0070664_100058212 3300005564 Bacteria 3286
137 Ga0070664_100117107 3300005564 Bacteria 2330
138 Ga0070664_100484404 3300005564 Bacteria 1139
139 Ga0068857_100120054 3300005577 Bacteria 2366
140 Ga0068857_100234638 3300005577 Bacteria 1678
141 Ga0068857_101384115 3300005577 Unclassified 684
142 Ga0068854_100016489 3300005578 Bacteria 4927
143 Ga0068854_100081220 3300005578 Bacteria 2394
144 Ga0068854_100204701 3300005578 Bacteria 1553
145 Ga0068854_100507190 3300005578 Bacteria 1017
146 Ga0068856_100008781 3300005614 Bacteria 9830
147 Ga0068856_100017430 3300005614 Bacteria 6959
148 Ga0068856_100055013 3300005614 Bacteria 3927
149 Ga0068856_100225513 3300005614 Bacteria 1889
150 Ga0068856_100423814 3300005614 Bacteria 1351
151 Ga0068856_101131860 3300005614 Bacteria 800
152 Ga0068852_100008341 3300005616 Bacteria 7630
153 Ga0068852_100014847 3300005616 Bacteria 6018
154 Ga0068852_100038343 3300005616 Bacteria 4026
155 Ga0068852_100040329 3300005616 Bacteria 3938
156 Ga0068852_100053095 3300005616 Bacteria 3487
157 Ga0068852_101043263 3300005616 Bacteria 837
158 Ga0068852_101822071 3300005616 Bacteria 631
159 Ga0068859_100134598 3300005617 Bacteria 2543
160 Ga0068859_100986682 3300005617 Bacteria 925
161 Ga0068864_100012818 3300005618 Bacteria 6932
162 Ga0068864_100230670 3300005618 Bacteria 1712
163 Ga0068864_100777707 3300005618 Bacteria 939
164 Ga0068864_100933821 3300005618 Bacteria 858
165 Ga0068851_10093487 3300005834 Unclassified 1586
166 Ga0068851_10249398 3300005834 Bacteria 1007
167 Ga0068851_10478621 3300005834 Bacteria 744
168 Ga0068863_100290562 3300005841 Bacteria 1585
169 Ga0068863_100753025 3300005841 Bacteria 970
170 Ga0068858_100103202 3300005842 Bacteria 2660
171 Ga0068858_100152572 3300005842 Bacteria 2172
172 Ga0068858_100899686 3300005842 Bacteria 865
173 Ga0068862_100083631 3300005844 Bacteria 2771
174 Ga0097621_101073576 3300006237 Bacteria 755
175 Ga0068871_100632921 3300006358 Bacteria 975
176 Ga0075428_100755243 3300006844 Bacteria 1035
177 Ga0075433_10214454 3300006852 Bacteria 1710
178 Ga0075434_100581083 3300006871 Bacteria 1139
179 Ga0068865_100297361 3300006881 Bacteria 1291
180 Ga0075436_100954096 3300006914 Bacteria 643
181 Ga0097620_100134607 3300006931 Bacteria 2543
182 Ga0097620_100986709 3300006931 Bacteria 925
183 Ga0105240_10051295 3300009093 Bacteria 5193
184 Ga0105240_10072531 3300009093 Bacteria 4255
185 Ga0105245_11282309 3300009098 Bacteria 781
186 Ga0105241_10028204 3300009174 Bacteria 4183
187 Ga0105241_10143674 3300009174 Bacteria 1946
188 Ga0105248_10000516 3300009177 Bacteria 43895
189 Ga0105248_10022750 3300009177 Bacteria 6955
190 Ga0105248_10023976 3300009177 Bacteria 6783
191 Ga0105248_10391156 3300009177 Bacteria 1565
192 Ga0105238_10089598 3300009551 Bacteria 3063
193 Ga0105238_10161081 3300009551 Bacteria 2219
194 Ga0105238_10937245 3300009551 Bacteria 885
195 Ga0105249_11430435 3300009553 Unclassified 763
196 Ga0105239_13172696 3300010375 Bacteria 535
197 Ga0105246_10183731 3300011119 Bacteria 1612
198 Ga0157373_10042381 3300013100 Unclassified 3253
199 Ga0157373_10062749 3300013100 Bacteria 2632
200 Ga0157373_10260089 3300013100 Bacteria 1228
201 Ga0157373_10615410 3300013100 Bacteria 791
202 Ga0157371_10017279 3300013102 Bacteria 5365
203 Ga0157371_10101165 3300013102 Bacteria 2045
204 Ga0157371_10117740 3300013102 Bacteria 1888
205 Ga0157371_10150906 3300013102 Bacteria 1657
206 Ga0157371_10161600 3300013102 Bacteria 1600
207 Ga0157371_10229530 3300013102 Bacteria 1334
208 Ga0157371_10407761 3300013102 Bacteria 995
209 Ga0157371_10954505 3300013102 Bacteria 652
210 Ga0157371_11060265 3300013102 Bacteria 620
211 Ga0157370_10056182 3300013104 Bacteria 3746
212 Ga0157370_10098929 3300013104 Bacteria 2734
213 Ga0157370_10224077 3300013104 Bacteria 1741
214 Ga0157370_10379558 3300013104 Bacteria 1302
215 Ga0157369_10000385 3300013105 Bacteria 58590
216 Ga0157369_10121134 3300013105 Bacteria 2776
217 Ga0157369_10206322 3300013105 Bacteria 2061
218 Ga0157369_10336086 3300013105 Bacteria 1569
219 Ga0157369_10422006 3300013105 Bacteria 1383
220 Ga0157369_10444864 3300013105 Bacteria 1342
221 Ga0157369_10675353 3300013105 Bacteria 1064
222 Ga0157374_10006752 3300013296 Bacteria 9754
223 Ga0157374_10096662 3300013296 Bacteria 2825
224 Ga0157374_10978382 3300013296 Bacteria 865
225 Ga0157378_10169374 3300013297 Bacteria 2047
226 Ga0163162_12251976 3300013306 Bacteria 626
227 Ga0157372_10338321 3300013307 Bacteria 1753
228 Ga0157372_10459393 3300013307 Bacteria 1484
229 Ga0157372_10673750 3300013307 Bacteria 1204
230 Ga0157372_10756211 3300013307 Bacteria 1130
231 Ga0157372_12902890 3300013307 Bacteria 549
232 Ga0157375_10337632 3300013308 Bacteria 1672
233 Ga0157375_10475933 3300013308 Bacteria 1414
234 Ga0157375_10597467 3300013308 Bacteria 1263
235 Ga0157375_10671341 3300013308 Bacteria 1191
236 Ga0163163_10013300 3300014325 Bacteria 7530
237 Ga0163163_10321634 3300014325 Bacteria 1601
238 Ga0157380_11543130 3300014326 Bacteria 718
239 Ga0157380_13238450 3300014326 Unclassified 520
240 Ga0157377_10023595 3300014745 Bacteria 3262
241 Ga0157379_10120624 3300014968 Unclassified 2358
242 Ga0224712_10612992 3300022467 Bacteria 532
243 Ga0207697_10197511 3300025315 Bacteria 884
244 Ga0207656_10139602 3300025321 Bacteria 1141
245 Ga0207682_10184742 3300025893 Bacteria 953
246 Ga0207710_10046389 3300025900 Bacteria 1940
247 Ga0207688_10020909 3300025901 Bacteria 3572
248 Ga0207680_10578051 3300025903 Bacteria 803
249 Ga0207647_10007590 3300025904 Bacteria 7816
250 Ga0207647_10033358 3300025904 Bacteria 3297
251 Ga0207647_10068892 3300025904 Bacteria 2140
252 Ga0207705_10000059 3300025909 Bacteria 155683
253 Ga0207705_10001692 3300025909 Bacteria 17538
254 Ga0207705_10031663 3300025909 Bacteria 3776
255 Ga0207705_10082959 3300025909 Bacteria 2338
256 Ga0207705_10494066 3300025909 Bacteria 950
257 Ga0207705_10641590 3300025909 Bacteria 826
258 Ga0207654_10909050 3300025911 Bacteria 638
259 Ga0207707_10090918 3300025912 Bacteria 2667
260 Ga0207707_10152410 3300025912 Bacteria 2021
261 Ga0207707_10221095 3300025912 Bacteria 1648
262 Ga0207707_10252336 3300025912 Bacteria 1532
263 Ga0207695_10006706 3300025913 Bacteria 14858
264 Ga0207695_10126505 3300025913 Bacteria 2517
265 Ga0207695_10213824 3300025913 Bacteria 1838
266 Ga0207660_10028730 3300025917 Bacteria 3807
267 Ga0207660_10605796 3300025917 Bacteria 892
268 Ga0207660_11493349 3300025917 Bacteria 546
269 Ga0207657_10011122 3300025919 Bacteria 8946
270 Ga0207657_10059003 3300025919 Bacteria 3300
271 Ga0207657_10096242 3300025919 Bacteria 2463
272 Ga0207657_10107785 3300025919 Bacteria 2304
273 Ga0207657_10193174 3300025919 Bacteria 1641
274 Ga0207657_10845809 3300025919 Bacteria 706
275 Ga0207649_10010690 3300025920 Bacteria 5046
276 Ga0207649_10014810 3300025920 Bacteria 4374
277 Ga0207649_10092605 3300025920 Bacteria 1982
278 Ga0207649_10133589 3300025920 Bacteria 1689
279 Ga0207649_10136018 3300025920 Bacteria 1675
280 Ga0207649_10267266 3300025920 Bacteria 1238
281 Ga0207649_10344710 3300025920 Bacteria 1101
282 Ga0207649_10349169 3300025920 Bacteria 1094
283 Ga0207649_10361407 3300025920 Bacteria 1077
284 Ga0207652_10030193 3300025921 Bacteria 4536
285 Ga0207652_10033611 3300025921 Bacteria 4319
286 Ga0207652_10066916 3300025921 Bacteria 3115
287 Ga0207652_10424067 3300025921 Bacteria 1200
288 Ga0207652_11515356 3300025921 Bacteria 575
289 Ga0207681_10042703 3300025923 Bacteria 3030
290 Ga0207681_10705017 3300025923 Bacteria 839
291 Ga0207694_10167385 3300025924 Bacteria 1778
292 Ga0207694_10590959 3300025924 Bacteria 933
293 Ga0207650_10004442 3300025925 Bacteria 9580
294 Ga0207650_10123768 3300025925 Bacteria 2016
295 Ga0207659_10035674 3300025926 Bacteria 3440
296 Ga0207687_10104607 3300025927 Bacteria 2090
297 Ga0207644_10002867 3300025931 Bacteria 11114
298 Ga0207644_10111928 3300025931 Bacteria 2065
299 Ga0207644_11139928 3300025931 Bacteria 655
300 Ga0207690_10002543 3300025932 Bacteria 11026
301 Ga0207690_10003550 3300025932 Bacteria 9290
302 Ga0207690_10064763 3300025932 Bacteria 2497
303 Ga0207690_10113515 3300025932 Bacteria 1955
304 Ga0207690_10331788 3300025932 Bacteria 1198
305 Ga0207706_10026411 3300025933 Bacteria 5198
306 Ga0207706_10044853 3300025933 Bacteria 3917
307 Ga0207706_10051085 3300025933 Bacteria 3652
308 Ga0207706_10083283 3300025933 Bacteria 2812
309 Ga0207669_10236914 3300025937 Bacteria 1350
310 Ga0207669_10258203 3300025937 Bacteria 1302
311 Ga0207704_10252222 3300025938 Bacteria 1325
312 Ga0207691_10029081 3300025940 Bacteria 5169
313 Ga0207711_10264122 3300025941 Bacteria 1583
314 Ga0207689_10099503 3300025942 Bacteria 2389
315 Ga0207661_10072094 3300025944 Bacteria 2825
316 Ga0207661_10652534 3300025944 Bacteria 967
317 Ga0207679_10005285 3300025945 Bacteria 8098
318 Ga0207679_10007146 3300025945 Bacteria 7071
319 Ga0207679_10079136 3300025945 Bacteria 2506
320 Ga0207679_10446427 3300025945 Bacteria 1146
321 Ga0207667_10041974 3300025949 Bacteria 4864
322 Ga0207667_10070757 3300025949 Bacteria 3630
323 Ga0207667_10140403 3300025949 Bacteria 2487
324 Ga0207667_10206811 3300025949 Bacteria 2012
325 Ga0207667_10222811 3300025949 Bacteria 1932
326 Ga0207667_11441611 3300025949 Unclassified 661
327 Ga0207651_10123114 3300025960 Bacteria 1971
328 Ga0207651_10199802 3300025960 Bacteria 1601
329 Ga0207651_10710513 3300025960 Bacteria 886
330 Ga0207668_10510240 3300025972 Bacteria 1036
331 Ga0207668_10637317 3300025972 Bacteria 932
332 Ga0207668_11212660 3300025972 Bacteria 678
333 Ga0207640_10000423 3300025981 Bacteria 26221
334 Ga0207640_10029533 3300025981 Bacteria 3366
335 Ga0207640_10507684 3300025981 Bacteria 1005
336 Ga0207640_10533171 3300025981 Bacteria 983
337 Ga0207640_10731836 3300025981 Bacteria 851
338 Ga0207677_10170187 3300026023 Bacteria 1702
339 Ga0207703_10022556 3300026035 Bacteria 4939
340 Ga0207703_10208459 3300026035 Bacteria 1741
341 Ga0207703_11720929 3300026035 Unclassified 603
342 Ga0207639_10526302 3300026041 Bacteria 1083
343 Ga0207639_10608444 3300026041 Bacteria 1008
344 Ga0207639_11461043 3300026041 Bacteria 642
345 Ga0207678_10077304 3300026067 Bacteria 2851
346 Ga0207678_10078016 3300026067 Bacteria 2837
347 Ga0207678_10141268 3300026067 Bacteria 2055
348 Ga0207678_10159084 3300026067 Bacteria 1929
349 Ga0207678_10174518 3300026067 Bacteria 1835
350 Ga0207678_10630307 3300026067 Bacteria 941
351 Ga0207678_12018848 3300026067 Bacteria 502
352 Ga0207702_10147410 3300026078 Bacteria 2137
353 Ga0207702_10153119 3300026078 Bacteria 2099
354 Ga0207702_10239259 3300026078 Bacteria 1700
355 Ga0207702_10273514 3300026078 Bacteria 1594
356 Ga0207702_10469899 3300026078 Bacteria 1223
357 Ga0207641_10828147 3300026088 Bacteria 916
358 Ga0207641_11683927 3300026088 Bacteria 636
359 Ga0207676_10007170 3300026095 Bacteria 7890
360 Ga0207676_10183333 3300026095 Bacteria 1835
361 Ga0207676_10868795 3300026095 Bacteria 883
362 Ga0207674_11044377 3300026116 Bacteria 786
363 Ga0207674_11163145 3300026116 Bacteria 741
364 Ga0207683_10095648 3300026121 Bacteria 2648
365 Ga0207683_10155005 3300026121 Bacteria 2069
366 Ga0207698_10005828 3300026142 Bacteria 7652
367 Ga0207698_10025187 3300026142 Bacteria 4186
368 Ga0207698_10040747 3300026142 Bacteria 3455
369 Ga0207698_10361896 3300026142 Bacteria 1374
370 Ga0207698_10508149 3300026142 Bacteria 1174
371 Ga0207698_11045724 3300026142 Bacteria 828
372 Ga0268266_10263002 3300028379 Bacteria 1599
373 Ga0268265_10024930 3300028380 Bacteria 4239
374 Ga0268265_10132271 3300028380 Bacteria 2075
375 Ga0307408_100083965 3300031548 Bacteria 2387
376 Ga0307408_101704811 3300031548 Bacteria 600
377 Ga0307405_10188573 3300031731 Bacteria 1487
378 Ga0307405_10582443 3300031731 Bacteria 910
379 Ga0307413_10107170 3300031824 Bacteria 1861
380 Ga0307413_10277850 3300031824 Bacteria 1258
381 Ga0307413_10765204 3300031824 Bacteria 808
382 Ga0307413_11005242 3300031824 Bacteria 715
383 Ga0307410_10105133 3300031852 Bacteria 2031
384 Ga0307410_10143338 3300031852 Bacteria 1770
385 Ga0307410_10231216 3300031852 Bacteria 1428
386 Ga0307410_10946133 3300031852 Bacteria 740
387 Ga0307410_10957226 3300031852 Bacteria 736
388 Ga0307410_11481331 3300031852 Bacteria 597
389 Ga0307406_10178290 3300031901 Bacteria 1544
390 Ga0307406_10190050 3300031901 Bacteria 1502
391 Ga0307406_10332051 3300031901 Bacteria 1181
392 Ga0307406_11849860 3300031901 Bacteria 537
393 Ga0307407_10055358 3300031903 Bacteria 2291
394 Ga0307407_10283392 3300031903 Bacteria 1149
395 Ga0307407_10889499 3300031903 Bacteria 683
396 Ga0307412_10095657 3300031911 Bacteria 2088
397 Ga0307412_11236098 3300031911 Bacteria 670
398 Ga0307409_100329059 3300031995 Bacteria 1433
399 Ga0307409_100760455 3300031995 Bacteria 973
400 Ga0307409_102690138 3300031995 Bacteria 526
401 Ga0307416_100006793 3300032002 Bacteria 7195
402 Ga0307416_100163898 3300032002 Bacteria 2059
403 Ga0307416_101121292 3300032002 Bacteria 891
404 Ga0307414_10249054 3300032004 Bacteria 1475
405 Ga0307414_10349049 3300032004 Bacteria 1269
406 Ga0307414_10504874 3300032004 Bacteria 1071
407 Ga0307414_11220797 3300032004 Bacteria 696
408 Ga0307414_11221344 3300032004 Bacteria 696
409 Ga0307414_11530125 3300032004 Unclassified 621
410 Ga0307411_10066627 3300032005 Bacteria 2420
411 Ga0307411_10127528 3300032005 Bacteria 1853
412 Ga0307411_10409217 3300032005 Bacteria 1123
413 Ga0307411_10433199 3300032005 Bacteria 1095
414 Ga0307411_11119575 3300032005 Unclassified 710
415 Ga0307415_100025803 3300032126 Bacteria 3696
416 Ga0307415_100104498 3300032126 Bacteria 2086
417 Ga0307415_100917498 3300032126 Bacteria 808
418 Ga0307415_100942575 3300032126 Bacteria 798
419 Ga0395899_0010253 3300037312 Bacteria 7182
420 Ga0395899_0114827 3300037312 Bacteria 1933
421 Ga0395899_0279962 3300037312 Unclassified 1135
422 Ga0395899_0556327 3300037312 Bacteria 736
423 Ga0395899_0665464 3300037312 Bacteria 656
424 Ga0395900_0000564 3300037418 Bacteria 51387
425 Ga0395900_0029417 3300037418 Bacteria 5635
426 Ga0395900_0050105 3300037418 Bacteria 4301
427 Ga0395900_0067290 3300037418 Bacteria 3680
428 Ga0395900_0067719 3300037418 Bacteria 3668
429 Ga0395900_0368632 3300037418 Bacteria 1406
430 Ga0395900_0558540 3300037418 Bacteria 1088
431 Ga0395900_1440407 3300037418 Bacteria 601
432 Ga0395900_1839064 3300037418 Bacteria 516
433 Ga0395898_0000941 3300037466 Bacteria 46344
434 Ga0395898_0016800 3300037466 Bacteria 7478
435 Ga0395898_0072812 3300037466 Bacteria 3319
436 Ga0395898_0073073 3300037466 Bacteria 3312
437 Ga0395898_0137221 3300037466 Bacteria 2342
438 Ga0395898_0744749 3300037466 Bacteria 921
439 Ga0395905_0058580 3300037471 Bacteria 3601
440 Ga0395905_0080119 3300037471 Bacteria 3060
441 Ga0395905_0186530 3300037471 Bacteria 1946
442 Ga0395905_0260637 3300037471 Bacteria 1619
443 Ga0395905_0331824 3300037471 Bacteria 1412
444 Ga0395905_0347097 3300037471 Bacteria 1376
445 Ga0395905_0433038 3300037471 Bacteria 1212
446 Ga0395905_0518390 3300037471 Bacteria 1093
447 Ga0395905_0576331 3300037471 Bacteria 1027
448 Ga0395905_0752658 3300037471 Bacteria 877
449 Ga0395905_0866016 3300037471 Bacteria 806
450 Ga0395905_1014591 3300037471 Bacteria 733
451 Ga0395901_0042757 3300038443 Bacteria 4699
452 Ga0395901_0102263 3300038443 Bacteria 3007
453 Ga0395901_0108848 3300038443 Bacteria 2909
454 Ga0395901_0193763 3300038443 Bacteria 2131
455 Ga0395901_0195729 3300038443 Bacteria 2119
456 Ga0395901_1971563 3300038443 Bacteria 530
457 Ga0436365_0324202 3300039437 Bacteria 10090
458 Ga0436363_0070737 3300039450 Bacteria 1477
459 Ga0439439_0087781 3300041406 Bacteria 847
460 Ga0451853_0183747 3300041512 Bacteria 606
461 Ga0466972_0456354 3300044658 Bacteria 600
462 Ga0466965_0489557 3300044683 Bacteria 689
463 Ga0466965_0890606 3300044683 Bacteria 519
464 Ga0466966_0000052 3300044684 Bacteria 88472
465 Ga0466966_0471492 3300044684 Bacteria 755
466 Ga0466961_0328671 3300044693 Bacteria 932
467 Ga0466961_0496082 3300044693 Bacteria 737
468 Ga0466963_0054003 3300044694 Bacteria 2669
469 Ga0466963_0138958 3300044694 Bacteria 1682
470 Ga0466963_0141917 3300044694 Bacteria 1664
471 Ga0466964_0171144 3300044706 Bacteria 1023
472 Ga0466964_0254841 3300044706 Bacteria 867
473 Ga0466971_0071053 3300044719 Bacteria 1581
474 Ga0466957_0150528 3300044842 Bacteria 1505
475 Ga0466957_0325831 3300044842 Bacteria 1037
476 Ga0466960_0130821 3300044901 Bacteria 1324
477 Ga0466959_0560668 3300045049 Bacteria 770
478 Ga0466958_0105941 3300045836 Bacteria 1753
479 Ga0466967_0099604 3300045976 Bacteria 2655
480 Ga0466967_0576552 3300045976 Bacteria 1109
481 Ga0466967_0640599 3300045976 Bacteria 1050
482 Ga0495663_0138423 3300046525 Bacteria 825
483 Ga0495642_0041984 3300046528 Bacteria 1862
484 Ga0495598_0029692 3300046537 Bacteria 1526
485 Ga0495621_0000065 3300046539 Bacteria 20486
486 Ga0495621_0008845 3300046539 Bacteria 3034
487 Ga0495633_0024149 3300046558 Bacteria 3006
488 Ga0495668_0050159 3300046616 Bacteria 2313
489 Ga0495669_0026244 3300046684 Bacteria 2545
490 Ga0495669_0060341 3300046684 Bacteria 1714
491 Ga0495669_0076543 3300046684 Bacteria 1531
492 Ga0495669_0085879 3300046684 Bacteria 1448
493 Ga0495669_0156989 3300046684 Bacteria 1078
494 Ga0495670_0000467 3300046691 Bacteria 19301
495 Ga0495670_0368091 3300046691 Bacteria 774
496 Ga0495670_0650105 3300046691 Bacteria 575
497 Ga0495670_0749773 3300046691 Bacteria 532
498 Ga0495677_0016171 3300047445 Bacteria 2708
499 Ga0495677_0037561 3300047445 Bacteria 1769
500 Ga0495677_0067772 3300047445 Bacteria 1328
501 Ga0495677_0395191 3300047445 Bacteria 547
502 Ga0496100_1270292 3300048903 Bacteria 581
503 Ga0496101_0388103 3300048904 Bacteria 1099
504 Ga0496109_0304046 3300048912 Bacteria 1504
505 Ga0496110_0029386 3300048913 Bacteria 4730
506 Ga0496111_0044338 3300048914 Bacteria 3197
507 Ga0496112_0025925 3300048915 Bacteria 5634
508 Ga0496114_0030935 3300048917 Bacteria 4404
509 Ga0501225_0169792 3300049705 Bacteria 676
510 nmdc:mga0n895_858806_c1 3300050512 Bacteria 895
511 nmdc:mga0rr50_253428_c1 3300050513 Bacteria 1462
512 nmdc:mga08x19_159254_c1 3300050514 Bacteria 1532
513 nmdc:mga0a205_101691_c1 3300050515 Bacteria 2773
514 Ga0590075_131216 3300059424 Bacteria 658
515 Ga0495685_053707
516 JGI24736J21556_1001189
517 JGI24736J21556_1007099
518 JGI24740J21852_10012406
519 JGI24740J21852_10022394
520 JGI24740J21852_10022788
521 JGI24740J21852_10143801
522 JGI24739J22299_10049041
523 JGI24737J22298_10000636
524 JGI24737J22298_10046383
525 JGI24737J22298_10062487
526 JGI24737J22298_10266151
527 JGI24735J21928_10223687
528 JGI24738J21930_10004295
529 Ga0065715_10016748
530 Ga0070658_10051194
531 Ga0070658_10199822
532 Ga0070658_10308359
533 Ga0070658_10467783
534 Ga0070676_10193689
535 Ga0070683_100036349
536 Ga0070683_100067719
537 Ga0070683_102407826
538 Ga0070690_100041648
539 Ga0070670_100051669
540 Ga0070670_100063582
541 Ga0070670_101873703
542 Ga0070677_10079455
543 Ga0068869_100187315
544 Ga0070666_10106918
545 Ga0070666_10131331
546 Ga0070680_100026458
547 Ga0070680_100071469
548 Ga0070680_100080684
549 Ga0070680_100162935
550 Ga0070682_100020530
551 Ga0070682_100044956
552 Ga0068868_100111310
553 Ga0070660_100011671
554 Ga0070660_100028930
555 Ga0070660_100050134
556 Ga0070660_100062576
557 Ga0070660_100083565
558 Ga0070660_100116913
559 Ga0070660_100306875
560 Ga0070660_101163306
561 Ga0070689_100132189
562 Ga0070661_100042947
563 Ga0070661_100088145
564 Ga0070661_100108180
565 Ga0070661_100119959
566 Ga0070661_100130438
567 Ga0070661_100204841
568 Ga0070661_100228390
569 Ga0070661_100379850
570 Ga0070661_100449030
571 Ga0070692_10129904
572 Ga0070668_100180167
573 Ga0070668_100238425
574 Ga0070668_100255538
575 Ga0070668_100915193
576 Ga0070669_100044111
577 Ga0070669_100052547
578 Ga0070669_100554323
579 Ga0070669_101027010
580 Ga0070675_100149565
581 Ga0070671_100025495
582 Ga0070671_100054189
583 Ga0070671_100075610
584 Ga0070671_100096409
585 Ga0070671_101829295
586 Ga0070674_100118013
587 Ga0070674_100467037
588 Ga0070674_100868340
589 Ga0070673_100086124
590 Ga0070673_100427964
591 Ga0070673_100952242
592 Ga0070673_101117000
593 Ga0070673_101476939
594 Ga0070673_101524091
595 Ga0070659_100017184
596 Ga0070659_100045351
597 Ga0070659_100137647
598 Ga0070659_100226808
599 Ga0070659_100404073
600 Ga0070659_101881399
601 Ga0070667_100006173
602 Ga0070667_100046959
603 Ga0070667_101053075
604 Ga0070663_100017373
605 Ga0070663_100021677
606 Ga0070663_100032144
607 Ga0070663_100051901
608 Ga0070663_100271075
609 Ga0070663_100349009
610 Ga0070663_101042172
611 Ga0070663_101229507
612 Ga0070678_100057492
613 Ga0070678_100176052
614 Ga0070662_100010637
615 Ga0070662_100056965
616 Ga0070662_100248195
617 Ga0070662_100506132
618 Ga0070681_10087681
619 Ga0070681_10121410
620 Ga0070681_10772041
621 Ga0070681_10965488
622 Ga0070679_100291023
623 Ga0070679_100526097
624 Ga0070679_100977476
625 Ga0070684_100025006
626 Ga0070684_100153624
627 Ga0070684_100384381
628 Ga0070684_100677362
629 Ga0068853_100051542
630 Ga0068853_100054561
631 Ga0068853_100119979
632 Ga0068853_100260381
633 Ga0070672_100136073
634 Ga0070672_100893541
635 Ga0070695_100376796
636 Ga0070696_100220094
637 Ga0070693_100013265
638 Ga0070665_100054307
639 Ga0070665_100207543
640 Ga0070665_100375089
641 Ga0070665_100500749
642 Ga0068855_100001613
643 Ga0068855_100009002
644 Ga0068855_100347496
645 Ga0068855_100439305
646 Ga0068855_100487202
647 Ga0070664_100008740
648 Ga0070664_100010024
649 Ga0070664_100033467
650 Ga0070664_100058212
651 Ga0070664_100117107
652 Ga0070664_100484404
653 Ga0068857_100120054
654 Ga0068857_100234638
655 Ga0068857_101384115
656 Ga0068854_100016489
657 Ga0068854_100081220
658 Ga0068854_100204701
659 Ga0068854_100507190
660 Ga0068856_100008781
661 Ga0068856_100017430
662 Ga0068856_100055013
663 Ga0068856_100225513
664 Ga0068856_100423814
665 Ga0068856_101131860
666 Ga0068852_100008341
667 Ga0068852_100014847
668 Ga0068852_100038343
669 Ga0068852_100040329
670 Ga0068852_100053095
671 Ga0068852_101043263
672 Ga0068852_101822071
673 Ga0068859_100134598
674 Ga0068859_100986682
675 Ga0068864_100012818
676 Ga0068864_100230670
677 Ga0068864_100777707
678 Ga0068864_100933821
679 Ga0068851_10093487
680 Ga0068851_10249398
681 Ga0068851_10478621
682 Ga0068863_100290562
683 Ga0068863_100753025
684 Ga0068858_100103202
685 Ga0068858_100152572
686 Ga0068858_100899686
687 Ga0068862_100083631
688 Ga0097621_101073576
689 Ga0068871_100632921
690 Ga0075428_100755243
691 Ga0075433_10214454
692 Ga0075434_100581083
693 Ga0068865_100297361
694 Ga0075436_100954096
695 Ga0097620_100134607
696 Ga0097620_100986709
697 Ga0105240_10051295
698 Ga0105240_10072531
699 Ga0105245_11282309
700 Ga0105241_10028204
701 Ga0105241_10143674
702 Ga0105248_10000516
703 Ga0105248_10022750
704 Ga0105248_10023976
705 Ga0105248_10391156
706 Ga0105238_10089598
707 Ga0105238_10161081
708 Ga0105238_10937245
709 Ga0105249_11430435
710 Ga0105239_13172696
711 Ga0105246_10183731
712 Ga0157373_10042381
713 Ga0157373_10062749
714 Ga0157373_10260089
715 Ga0157373_10615410
716 Ga0157371_10017279
717 Ga0157371_10101165
718 Ga0157371_10117740
719 Ga0157371_10150906
720 Ga0157371_10161600
721 Ga0157371_10229530
722 Ga0157371_10407761
723 Ga0157371_10954505
724 Ga0157371_11060265
725 Ga0157370_10056182
726 Ga0157370_10098929
727 Ga0157370_10224077
728 Ga0157370_10379558
729 Ga0157369_10000385
730 Ga0157369_10121134
731 Ga0157369_10206322
732 Ga0157369_10336086
733 Ga0157369_10422006
734 Ga0157369_10444864
735 Ga0157369_10675353
736 Ga0157374_10006752
737 Ga0157374_10096662
738 Ga0157374_10978382
739 Ga0157378_10169374
740 Ga0163162_12251976
741 Ga0157372_10338321
742 Ga0157372_10459393
743 Ga0157372_10673750
744 Ga0157372_10756211
745 Ga0157372_12902890
746 Ga0157375_10337632
747 Ga0157375_10475933
748 Ga0157375_10597467
749 Ga0157375_10671341
750 Ga0163163_10013300
751 Ga0163163_10321634
752 Ga0157380_11543130
753 Ga0157380_13238450
754 Ga0157377_10023595
755 Ga0157379_10120624
756 Ga0224712_10612992
757 Ga0207697_10197511
758 Ga0207656_10139602
759 Ga0207682_10184742
760 Ga0207710_10046389
761 Ga0207688_10020909
762 Ga0207680_10578051
763 Ga0207647_10007590
764 Ga0207647_10033358
765 Ga0207647_10068892
766 Ga0207705_10000059
767 Ga0207705_10001692
768 Ga0207705_10031663
769 Ga0207705_10082959
770 Ga0207705_10494066
771 Ga0207705_10641590
772 Ga0207654_10909050
773 Ga0207707_10090918
774 Ga0207707_10152410
775 Ga0207707_10221095
776 Ga0207707_10252336
777 Ga0207695_10006706
778 Ga0207695_10126505
779 Ga0207695_10213824
780 Ga0207660_10028730
781 Ga0207660_10605796
782 Ga0207660_11493349
783 Ga0207657_10011122
784 Ga0207657_10059003
785 Ga0207657_10096242
786 Ga0207657_10107785
787 Ga0207657_10193174
788 Ga0207657_10845809
789 Ga0207649_10010690
790 Ga0207649_10014810
791 Ga0207649_10092605
792 Ga0207649_10133589
793 Ga0207649_10136018
794 Ga0207649_10267266
795 Ga0207649_10344710
796 Ga0207649_10349169
797 Ga0207649_10361407
798 Ga0207652_10030193
799 Ga0207652_10033611
800 Ga0207652_10066916
801 Ga0207652_10424067
802 Ga0207652_11515356
803 Ga0207681_10042703
804 Ga0207681_10705017
805 Ga0207694_10167385
806 Ga0207694_10590959
807 Ga0207650_10004442
808 Ga0207650_10123768
809 Ga0207659_10035674
810 Ga0207687_10104607
811 Ga0207644_10002867
812 Ga0207644_10111928
813 Ga0207644_11139928
814 Ga0207690_10002543
815 Ga0207690_10003550
816 Ga0207690_10064763
817 Ga0207690_10113515
818 Ga0207690_10331788
819 Ga0207706_10026411
820 Ga0207706_10044853
821 Ga0207706_10051085
822 Ga0207706_10083283
823 Ga0207669_10236914
824 Ga0207669_10258203
825 Ga0207704_10252222
826 Ga0207691_10029081
827 Ga0207711_10264122
828 Ga0207689_10099503
829 Ga0207661_10072094
830 Ga0207661_10652534
831 Ga0207679_10005285
832 Ga0207679_10007146
833 Ga0207679_10079136
834 Ga0207679_10446427
835 Ga0207667_10041974
836 Ga0207667_10070757
837 Ga0207667_10140403
838 Ga0207667_10206811
839 Ga0207667_10222811
840 Ga0207667_11441611
841 Ga0207651_10123114
842 Ga0207651_10199802
843 Ga0207651_10710513
844 Ga0207668_10510240
845 Ga0207668_10637317
846 Ga0207668_11212660
847 Ga0207640_10000423
848 Ga0207640_10029533
849 Ga0207640_10507684
850 Ga0207640_10533171
851 Ga0207640_10731836
852 Ga0207677_10170187
853 Ga0207703_10022556
854 Ga0207703_10208459
855 Ga0207703_11720929
856 Ga0207639_10526302
857 Ga0207639_10608444
858 Ga0207639_11461043
859 Ga0207678_10077304
860 Ga0207678_10078016
861 Ga0207678_10141268
862 Ga0207678_10159084
863 Ga0207678_10174518
864 Ga0207678_10630307
865 Ga0207678_12018848
866 Ga0207702_10147410
867 Ga0207702_10153119
868 Ga0207702_10239259
869 Ga0207702_10273514
870 Ga0207702_10469899
871 Ga0207641_10828147
872 Ga0207641_11683927
873 Ga0207676_10007170
874 Ga0207676_10183333
875 Ga0207676_10868795
876 Ga0207674_11044377
877 Ga0207674_11163145
878 Ga0207683_10095648
879 Ga0207683_10155005
880 Ga0207698_10005828
881 Ga0207698_10025187
882 Ga0207698_10040747
883 Ga0207698_10361896
884 Ga0207698_10508149
885 Ga0207698_11045724
886 Ga0268266_10263002
887 Ga0268265_10024930
888 Ga0268265_10132271
889 Ga0307408_100083965
890 Ga0307408_101704811
891 Ga0307405_10188573
892 Ga0307405_10582443
893 Ga0307413_10107170
894 Ga0307413_10277850
895 Ga0307413_10765204
896 Ga0307413_11005242
897 Ga0307410_10105133
898 Ga0307410_10143338
899 Ga0307410_10231216
900 Ga0307410_10946133
901 Ga0307410_10957226
902 Ga0307410_11481331
903 Ga0307406_10178290
904 Ga0307406_10190050
905 Ga0307406_10332051
906 Ga0307406_11849860
907 Ga0307407_10055358
908 Ga0307407_10283392
909 Ga0307407_10889499
910 Ga0307412_10095657
911 Ga0307412_11236098
912 Ga0307409_100329059
913 Ga0307409_100760455
914 Ga0307409_102690138
915 Ga0307416_100006793
916 Ga0307416_100163898
917 Ga0307416_101121292
918 Ga0307414_10249054
919 Ga0307414_10349049
920 Ga0307414_10504874
921 Ga0307414_11220797
922 Ga0307414_11221344
923 Ga0307414_11530125
924 Ga0307411_10066627
925 Ga0307411_10127528
926 Ga0307411_10409217
927 Ga0307411_10433199
928 Ga0307411_11119575
929 Ga0307415_100025803
930 Ga0307415_100104498
931 Ga0307415_100917498
932 Ga0307415_100942575
933 Ga0395899_0010253
934 Ga0395899_0114827
935 Ga0395899_0279962
936 Ga0395899_0556327
937 Ga0395899_0665464
938 Ga0395900_0000564
939 Ga0395900_0029417
940 Ga0395900_0050105
941 Ga0395900_0067290
942 Ga0395900_0067719
943 Ga0395900_0368632
944 Ga0395900_0558540
945 Ga0395900_1440407
946 Ga0395900_1839064
947 Ga0395898_0000941
948 Ga0395898_0016800
949 Ga0395898_0072812
950 Ga0395898_0073073
951 Ga0395898_0137221
952 Ga0395898_0744749
953 Ga0395905_0058580
954 Ga0395905_0080119
955 Ga0395905_0186530
956 Ga0395905_0260637
957 Ga0395905_0331824
958 Ga0395905_0347097
959 Ga0395905_0433038
960 Ga0395905_0518390
961 Ga0395905_0576331
962 Ga0395905_0752658
963 Ga0395905_0866016
964 Ga0395905_1014591
965 Ga0395901_0042757
966 Ga0395901_0102263
967 Ga0395901_0108848
968 Ga0395901_0193763
969 Ga0395901_0195729
970 Ga0395901_1971563
971 Ga0436365_0324202
972 Ga0436363_0070737
973 Ga0439439_0087781
974 Ga0451853_0183747
975 Ga0466972_0456354
976 Ga0466965_0489557
977 Ga0466965_0890606
978 Ga0466966_0000052
979 Ga0466966_0471492
980 Ga0466961_0328671
981 Ga0466961_0496082
982 Ga0466963_0054003
983 Ga0466963_0138958
984 Ga0466963_0141917
985 Ga0466964_0171144
986 Ga0466964_0254841
987 Ga0466971_0071053
988 Ga0466957_0150528
989 Ga0466957_0325831
990 Ga0466960_0130821
991 Ga0466959_0560668
992 Ga0466958_0105941
993 Ga0466967_0099604
994 Ga0466967_0576552
995 Ga0466967_0640599
996 Ga0495663_0138423
997 Ga0495642_0041984
998 Ga0495598_0029692
999 Ga0495621_0000065
1000 Ga0495621_0008845
1001 Ga0495633_0024149
1002 Ga0495668_0050159
1003 Ga0495669_0026244
1004 Ga0495669_0060341
1005 Ga0495669_0076543
1006 Ga0495669_0085879
1007 Ga0495669_0156989
1008 Ga0495670_0000467
1009 Ga0495670_0368091
1010 Ga0495670_0650105
1011 Ga0495670_0749773
1012 Ga0495677_0016171
1013 Ga0495677_0037561
1014 Ga0495677_0067772
1015 Ga0495677_0395191
1016 Ga0496100_1270292
1017 Ga0496101_0388103
1018 Ga0496109_0304046
1019 Ga0496110_0029386
1020 Ga0496111_0044338
1021 Ga0496112_0025925
1022 Ga0496114_0030935
1023 Ga0501225_0169792
1024 nmdc:mga0n895_858806_c1
1025 nmdc:mga0rr50_253428_c1
1026 nmdc:mga08x19_159254_c1
1027 nmdc:mga0a205_101691_c1
1028 Ga0590075_131216

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01329

Pterin_4a

Pterin 4 alpha carbinolamine dehydratase

9

101

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2v6u-assembly1.cif.gz_A high resolution crystal structure of pterin-4a-carbinolamine dehydratase from toxoplasma gondii 0.9777 8 86
1ru0-assembly1.cif.gz_A crystal structure of dcoh2, a paralog of dcoh, the dimerization cofactor of hnf-1 0.9615 8 86
4wil-assembly1.cif.gz_A crystal structure of dcoh2 s51t 0.9607 8 86
3hxa-assembly1.cif.gz_D crystal structure of dcoh1thr51ser 0.955 8 86
4c45-assembly1.cif.gz_A crystal structure of human pterin-4-alpha-carbinolamine dehydratase 2 (pcbd2) 0.9524 8 86
ID Description Score Start End Superfamily
2v6uA00 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9777 8 86 3.30.1360.20
af_O42658_1_95_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9679 9 84 3.30.1360.20
af_Q4CYK3_54_151_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9616 7 83 3.30.1360.20
af_Q54RY8_2_96_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9486 6 83 3.30.1360.20
2ebbA00 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9462 7 88 3.30.1360.20
ID Description Score Start End GO Terms
AF-A0A5C4JLD0-F1-model_v4 Putative pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Pterin carbinolamine dehydratase) (PCD) 0.9864 8 86 GO:0006729
GO:0008124
AF-A0A516IUK0-F1-model_v4 Putative pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Pterin carbinolamine dehydratase) (PCD) 0.9854 6 85 GO:0006729
GO:0008124
AF-A0A2P6FU96-F1-model_v4 deleted 0.9851 8 83
AF-A0A011VBW2-F1-model_v4 Putative pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Pterin carbinolamine dehydratase) (PCD) 0.9848 8 86 GO:0006729
GO:0008124
AF-A0A4R6YCN0-F1-model_v4 Putative pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Pterin carbinolamine dehydratase) (PCD) 0.9844 8 86 GO:0006729
GO:0008124

Map