F457705

General Info

Members Datasets Scaffolds Average Seq Length
514 200 1028 194

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100082272|Ga0075428_1000822721
Length 235
Sequence VRVFGIDPGSERTGYGCVETDGSRHRIVVCGAITTPALAAFPDKLHLIHSGLAAILRECRPQAVAIENLFHAVNVRSALKLGHARGVAMLAAVESGVGVYEYTPAEIKKAVVGYGRAEKSQVQHMIKLLLGLAAVPSPHDAADALAVAICHLHSQMPARAVGTAMPVGSKATSWRQYRPASAPTALPPARLERSGPSTLREPQGRPEQRRGATSSGLSRASSRDGGTGRRAKPLS

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
143 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
149 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
150 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
151 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
152 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
153 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
154 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
155 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
156 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
157 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
158 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
159 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
160 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
161 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
162 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
163 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
164 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
165 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
166 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
167 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
168 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
169 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
170 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
171 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
172 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
173 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
174 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
175 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
176 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
188 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
191 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
192 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
196 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
198 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
199 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
200 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.97
Nodule 0
Rhizoplane 1.95
Rhizosphere 96.89
Stem 0
Stem Tuber 0
Unclassified 2.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100082272 3300006844 Bacteria 3513
2 Ga0070690_100047784 3300005330 Bacteria 2723
3 Ga0070690_100475550 3300005330 Bacteria 930
4 Ga0070670_100005693 3300005331 Bacteria 10524
5 Ga0070677_10052307 3300005333 Bacteria 1657
6 Ga0070677_10060289 3300005333 Unclassified 1563
7 Ga0070677_10132383 3300005333 Bacteria 1140
8 Ga0070677_10197791 3300005333 Bacteria 968
9 Ga0068869_100001962 3300005334 Bacteria 12329
10 Ga0068869_100937686 3300005334 Bacteria 751
11 Ga0070680_100150895 3300005336 Bacteria 1951
12 Ga0070680_100539135 3300005336 Bacteria 1000
13 Ga0070682_100353167 3300005337 Bacteria 1097
14 Ga0070682_100471596 3300005337 Bacteria 966
15 Ga0068868_100155831 3300005338 Bacteria 1884
16 Ga0068868_100164382 3300005338 Bacteria 1835
17 Ga0068868_100357828 3300005338 Bacteria 1252
18 Ga0070689_100124881 3300005340 Bacteria 2058
19 Ga0070689_100611578 3300005340 Bacteria 945
20 Ga0070691_10005391 3300005341 Bacteria 5817
21 Ga0070687_100064466 3300005343 Bacteria 1946
22 Ga0070687_100388496 3300005343 Bacteria 911
23 Ga0070661_100143998 3300005344 Bacteria 1798
24 Ga0070692_10036489 3300005345 Bacteria 2495
25 Ga0070668_100061615 3300005347 Bacteria 2906
26 Ga0070668_100884137 3300005347 Bacteria 798
27 Ga0070668_101180869 3300005347 Bacteria 693
28 Ga0070669_100016560 3300005353 Bacteria 5261
29 Ga0070669_100086927 3300005353 Bacteria 2337
30 Ga0070669_100090140 3300005353 Bacteria 2298
31 Ga0070669_100119977 3300005353 Bacteria 2005
32 Ga0070669_100126817 3300005353 Bacteria 1954
33 Ga0070669_100203880 3300005353 Bacteria 1557
34 Ga0070669_100336289 3300005353 Bacteria 1222
35 Ga0070669_100347354 3300005353 Bacteria 1203
36 Ga0070669_100692721 3300005353 Bacteria 860
37 Ga0070669_101194990 3300005353 Bacteria 657
38 Ga0070675_100000442 3300005354 Bacteria 28196
39 Ga0070675_100001024 3300005354 Bacteria 20115
40 Ga0070675_100012826 3300005354 Bacteria 6576
41 Ga0070675_100024303 3300005354 Bacteria 4852
42 Ga0070675_100144836 3300005354 Bacteria 2033
43 Ga0070675_100163925 3300005354 Bacteria 1913
44 Ga0070675_100260839 3300005354 Bacteria 1518
45 Ga0070671_100001353 3300005355 Bacteria 18364
46 Ga0070671_100124916 3300005355 Bacteria 2166
47 Ga0070671_100145860 3300005355 Bacteria 1998
48 Ga0070671_100532148 3300005355 Bacteria 1012
49 Ga0070674_100029214 3300005356 Bacteria 3628
50 Ga0070673_100027661 3300005364 Bacteria 4206
51 Ga0070673_101389877 3300005364 Bacteria 660
52 Ga0070688_100021012 3300005365 Bacteria 3806
53 Ga0070688_100181133 3300005365 Bacteria 1461
54 Ga0070688_100370702 3300005365 Bacteria 1053
55 Ga0070688_100654027 3300005365 Bacteria 810
56 Ga0070659_100137923 3300005366 Bacteria 1984
57 Ga0070667_100161522 3300005367 Bacteria 1974
58 Ga0070667_100296187 3300005367 Bacteria 1456
59 Ga0070667_100967812 3300005367 Bacteria 793
60 Ga0070701_10044991 3300005438 Bacteria 2263
61 Ga0070701_10640312 3300005438 Bacteria 708
62 Ga0070705_100000288 3300005440 Bacteria 30044
63 Ga0070705_100002798 3300005440 Bacteria 8692
64 Ga0070705_100056266 3300005440 Bacteria 2316
65 Ga0070705_100057794 3300005440 Bacteria 2289
66 Ga0070700_100011740 3300005441 Bacteria 4862
67 Ga0070700_100147457 3300005441 Bacteria 1605
68 Ga0070694_100028490 3300005444 Bacteria 3635
69 Ga0070694_100097473 3300005444 Bacteria 2074
70 Ga0070694_100283657 3300005444 Bacteria 1263
71 Ga0070708_100308710 3300005445 Bacteria 1490
72 Ga0070663_100483380 3300005455 Bacteria 1026
73 Ga0070678_100201315 3300005456 Bacteria 1644
74 Ga0070678_100296254 3300005456 Bacteria 1373
75 Ga0070678_100334051 3300005456 Bacteria 1298
76 Ga0070678_100553222 3300005456 Bacteria 1022
77 Ga0070678_100875995 3300005456 Bacteria 819
78 Ga0070662_100139858 3300005457 Bacteria 1875
79 Ga0070662_100181561 3300005457 Bacteria 1659
80 Ga0070662_100259740 3300005457 Bacteria 1399
81 Ga0068867_100007110 3300005459 Bacteria 7911
82 Ga0068867_100012153 3300005459 Bacteria 6083
83 Ga0068867_100079634 3300005459 Bacteria 2466
84 Ga0070685_10144478 3300005466 Bacteria 1501
85 Ga0070706_100247188 3300005467 Bacteria 1666
86 Ga0070698_100002474 3300005471 Bacteria 20388
87 Ga0070699_100063016 3300005518 Bacteria 3214
88 Ga0070699_100104888 3300005518 Bacteria 2479
89 Ga0070697_100004983 3300005536 Bacteria 10194
90 Ga0070672_100037705 3300005543 Bacteria 3689
91 Ga0070672_100112438 3300005543 Bacteria 2221
92 Ga0070672_100130398 3300005543 Bacteria 2065
93 Ga0070672_100288553 3300005543 Bacteria 1389
94 Ga0070672_100546264 3300005543 Bacteria 1006
95 Ga0070672_100679047 3300005543 Bacteria 901
96 Ga0070695_100005834 3300005545 Bacteria 7262
97 Ga0070695_100033314 3300005545 Bacteria 3223
98 Ga0070696_100001518 3300005546 Bacteria 15229
99 Ga0070696_100001520 3300005546 Bacteria 15227
100 Ga0070696_100033671 3300005546 Bacteria 3522
101 Ga0070696_100612718 3300005546 Bacteria 879
102 Ga0070665_100002711 3300005548 Bacteria 19198
103 Ga0070665_100995012 3300005548 Unclassified 851
104 Ga0070704_100000802 3300005549 Bacteria 15581
105 Ga0070704_100023092 3300005549 Bacteria 4055
106 Ga0070664_100042225 3300005564 Bacteria 3849
107 Ga0070664_100102202 3300005564 Bacteria 2494
108 Ga0070664_100148019 3300005564 Bacteria 2072
109 Ga0070664_100249076 3300005564 Bacteria 1596
110 Ga0070664_100290693 3300005564 Bacteria 1475
111 Ga0070664_100728941 3300005564 Bacteria 924
112 Ga0068857_100124417 3300005577 Bacteria 2323
113 Ga0068857_100445647 3300005577 Bacteria 1210
114 Ga0068854_100242937 3300005578 Bacteria 1435
115 Ga0068854_100511510 3300005578 Bacteria 1013
116 Ga0068854_100710420 3300005578 Bacteria 868
117 Ga0068856_100323747 3300005614 Bacteria 1559
118 Ga0070702_100002550 3300005615 Bacteria 7914
119 Ga0070702_100022961 3300005615 Bacteria 3308
120 Ga0070702_100071919 3300005615 Bacteria 2046
121 Ga0070702_100133440 3300005615 Bacteria 1572
122 Ga0068859_100121318 3300005617 Bacteria 2680
123 Ga0068859_100129679 3300005617 Bacteria 2593
124 Ga0068859_100159471 3300005617 Bacteria 2335
125 Ga0068859_100184231 3300005617 Bacteria 2171
126 Ga0068859_100232132 3300005617 Bacteria 1933
127 Ga0068859_100262381 3300005617 Bacteria 1819
128 Ga0068859_100309739 3300005617 Bacteria 1673
129 Ga0068859_100414797 3300005617 Bacteria 1443
130 Ga0068859_100423429 3300005617 Bacteria 1428
131 Ga0068864_100002331 3300005618 Bacteria 15700
132 Ga0068864_100008459 3300005618 Bacteria 8492
133 Ga0068864_100022414 3300005618 Bacteria 5296
134 Ga0068864_100088744 3300005618 Bacteria 2724
135 Ga0068864_100257717 3300005618 Bacteria 1621
136 Ga0068864_100278329 3300005618 Bacteria 1561
137 Ga0068866_10010430 3300005718 Bacteria 3982
138 Ga0068866_10210929 3300005718 Bacteria 1166
139 Ga0068861_100242451 3300005719 Bacteria 1534
140 Ga0068861_100445985 3300005719 Bacteria 1158
141 Ga0068861_100980343 3300005719 Bacteria 805
142 Ga0068861_101282573 3300005719 Bacteria 711
143 Ga0068851_10014946 3300005834 Bacteria 3693
144 Ga0068870_10182881 3300005840 Bacteria 1260
145 Ga0068863_100154907 3300005841 Bacteria 2194
146 Ga0068863_100455672 3300005841 Bacteria 1256
147 Ga0068863_100577190 3300005841 Bacteria 1112
148 Ga0068863_100657705 3300005841 Bacteria 1039
149 Ga0068858_100010084 3300005842 Bacteria 8969
150 Ga0068858_100035521 3300005842 Bacteria 4623
151 Ga0068858_100098207 3300005842 Bacteria 2730
152 Ga0068858_100114672 3300005842 Bacteria 2518
153 Ga0068858_100255375 3300005842 Bacteria 1665
154 Ga0068858_100474728 3300005842 Bacteria 1207
155 Ga0068858_100651221 3300005842 Bacteria 1024
156 Ga0068858_100849294 3300005842 Bacteria 892
157 Ga0068860_100015275 3300005843 Bacteria 7498
158 Ga0068860_100015659 3300005843 Bacteria 7403
159 Ga0068860_100726702 3300005843 Unclassified 1004
160 Ga0068862_100347347 3300005844 Bacteria 1375
161 Ga0068862_100434898 3300005844 Bacteria 1234
162 Ga0068862_100950409 3300005844 Bacteria 847
163 Ga0081455_10015599 3300005937 Bacteria 7373
164 Ga0075365_10057847 3300006038 Bacteria 2580
165 Ga0075364_10454056 3300006051 Bacteria 875
166 Ga0075369_10172046 3300006186 Bacteria 995
167 Ga0097621_100009984 3300006237 Bacteria 6919
168 Ga0097621_100043964 3300006237 Bacteria 3602
169 Ga0097621_100067074 3300006237 Bacteria 2957
170 Ga0097621_100182536 3300006237 Bacteria 1813
171 Ga0097621_101044520 3300006237 Bacteria 765
172 Ga0068871_100009037 3300006358 Bacteria 7197
173 Ga0068871_100060151 3300006358 Bacteria 3098
174 Ga0068871_100219000 3300006358 Bacteria 1648
175 Ga0068871_100396654 3300006358 Bacteria 1228
176 Ga0075428_100422679 3300006844 Bacteria 1428
177 Ga0075430_100265436 3300006846 Bacteria 1421
178 Ga0075431_100032234 3300006847 Bacteria 5400
179 Ga0075433_10241517 3300006852 Bacteria 1603
180 Ga0075434_100110857 3300006871 Bacteria 2755
181 Ga0075434_100384370 3300006871 Bacteria 1425
182 Ga0075434_100434560 3300006871 Bacteria 1334
183 Ga0075434_101293890 3300006871 Bacteria 740
184 Ga0075429_100003923 3300006880 Bacteria 12713
185 Ga0075429_100288621 3300006880 Bacteria 1436
186 Ga0075429_100314564 3300006880 Bacteria 1370
187 Ga0068865_100003815 3300006881 Bacteria 9050
188 Ga0068865_100230502 3300006881 Bacteria 1453
189 Ga0075436_100008937 3300006914 Bacteria 6860
190 Ga0075436_100305085 3300006914 Bacteria 1142
191 Ga0097620_100121315 3300006931 Bacteria 2680
192 Ga0097620_100129684 3300006931 Bacteria 2593
193 Ga0097620_100159473 3300006931 Bacteria 2335
194 Ga0097620_100184211 3300006931 Bacteria 2171
195 Ga0097620_100232144 3300006931 Bacteria 1933
196 Ga0097620_100262391 3300006931 Bacteria 1819
197 Ga0097620_100309745 3300006931 Bacteria 1673
198 Ga0097620_100414802 3300006931 Bacteria 1443
199 Ga0097620_100423407 3300006931 Bacteria 1428
200 Ga0097620_101151766 3300006931 Bacteria 854
201 Ga0075435_100003692 3300007076 Bacteria 10429
202 Ga0075435_100385279 3300007076 Bacteria 1204
203 Ga0111539_10002468 3300009094 Bacteria 24543
204 Ga0111539_10110764 3300009094 Bacteria 3222
205 Ga0111539_10226060 3300009094 Bacteria 2180
206 Ga0111539_10259251 3300009094 Bacteria 2024
207 Ga0111539_10274210 3300009094 Bacteria 1963
208 Ga0105245_10878968 3300009098 Bacteria 937
209 Ga0105247_10068619 3300009101 Bacteria 2211
210 Ga0114129_10001790 3300009147 Bacteria 29271
211 Ga0114129_10103084 3300009147 Bacteria 3945
212 Ga0114129_10349630 3300009147 Bacteria 1959
213 Ga0114129_10384099 3300009147 Bacteria 1854
214 Ga0114129_11096472 3300009147 Bacteria 997
215 Ga0105243_10027395 3300009148 Bacteria 4366
216 Ga0105243_10077158 3300009148 Bacteria 2709
217 Ga0105243_10105388 3300009148 Bacteria 2348
218 Ga0105243_10712453 3300009148 Bacteria 980
219 Ga0105242_10007676 3300009176 Bacteria 8301
220 Ga0105242_10072616 3300009176 Bacteria 2858
221 Ga0105242_10300640 3300009176 Bacteria 1465
222 Ga0105242_10457594 3300009176 Bacteria 1204
223 Ga0105242_10519105 3300009176 Bacteria 1136
224 Ga0105248_10008967 3300009177 Bacteria 10999
225 Ga0105248_10080722 3300009177 Bacteria 3656
226 Ga0105248_10121634 3300009177 Bacteria 2945
227 Ga0105248_10165875 3300009177 Bacteria 2490
228 Ga0105248_10271741 3300009177 Bacteria 1909
229 Ga0105248_10312123 3300009177 Bacteria 1771
230 Ga0105248_10441679 3300009177 Bacteria 1466
231 Ga0105238_10014720 3300009551 Bacteria 7910
232 Ga0105238_10773737 3300009551 Bacteria 975
233 Ga0105249_10464308 3300009553 Bacteria 1306
234 Ga0105249_10675962 3300009553 Bacteria 1091
235 Ga0105246_10151150 3300011119 Bacteria 1758
236 Ga0105246_10204850 3300011119 Bacteria 1536
237 Ga0157378_10318632 3300013297 Bacteria 1510
238 Ga0157378_10694677 3300013297 Unclassified 1036
239 Ga0157378_10820099 3300013297 Bacteria 957
240 Ga0163162_10045801 3300013306 Bacteria 4382
241 Ga0163162_10554472 3300013306 Bacteria 1277
242 Ga0157375_10145957 3300013308 Bacteria 2497
243 Ga0157375_10265649 3300013308 Bacteria 1878
244 Ga0157375_10331045 3300013308 Bacteria 1688
245 Ga0157375_10769001 3300013308 Unclassified 1113
246 Ga0157375_11275303 3300013308 Bacteria 863
247 Ga0163163_10012986 3300014325 Bacteria 7608
248 Ga0163163_10039033 3300014325 Bacteria 4632
249 Ga0163163_10054081 3300014325 Bacteria 3965
250 Ga0163163_10074644 3300014325 Bacteria 3383
251 Ga0163163_10176512 3300014325 Bacteria 2183
252 Ga0163163_10252618 3300014325 Bacteria 1814
253 Ga0163163_10348751 3300014325 Bacteria 1536
254 Ga0163163_10422908 3300014325 Bacteria 1391
255 Ga0163163_10838105 3300014325 Bacteria 983
256 Ga0157380_10011997 3300014326 Bacteria 6270
257 Ga0157380_10173195 3300014326 Bacteria 1888
258 Ga0157380_10615468 3300014326 Bacteria 1077
259 Ga0157380_10948983 3300014326 Bacteria 890
260 Ga0157380_11308549 3300014326 Bacteria 772
261 Ga0157380_11574597 3300014326 Bacteria 712
262 Ga0157377_10046405 3300014745 Bacteria 2430
263 Ga0157377_10244236 3300014745 Unclassified 1160
264 Ga0157377_10469044 3300014745 Bacteria 873
265 Ga0157379_10015268 3300014968 Bacteria 6736
266 Ga0157379_10019035 3300014968 Bacteria 6061
267 Ga0157376_10139153 3300014969 Bacteria 2175
268 Ga0157376_10302453 3300014969 Bacteria 1515
269 Ga0207656_10010009 3300025321 Bacteria 3535
270 Ga0207682_10033772 3300025893 Bacteria 2060
271 Ga0207682_10055286 3300025893 Bacteria 1650
272 Ga0207682_10120748 3300025893 Bacteria 1162
273 Ga0207642_10124348 3300025899 Bacteria 1336
274 Ga0207642_10233204 3300025899 Bacteria 1035
275 Ga0207710_10004508 3300025900 Bacteria 6063
276 Ga0207688_10038338 3300025901 Bacteria 2659
277 Ga0207688_10041962 3300025901 Bacteria 2546
278 Ga0207688_10070223 3300025901 Bacteria 1986
279 Ga0207680_10164350 3300025903 Bacteria 1491
280 Ga0207680_10785155 3300025903 Bacteria 683
281 Ga0207645_10010985 3300025907 Bacteria 6195
282 Ga0207643_10038016 3300025908 Bacteria 2702
283 Ga0207643_10092830 3300025908 Bacteria 1761
284 Ga0207705_10219813 3300025909 Bacteria 1443
285 Ga0207684_10118177 3300025910 Bacteria 2272
286 Ga0207662_10347216 3300025918 Bacteria 996
287 Ga0207662_10395649 3300025918 Bacteria 936
288 Ga0207649_10192049 3300025920 Bacteria 1437
289 Ga0207649_10255673 3300025920 Bacteria 1264
290 Ga0207649_10854869 3300025920 Bacteria 712
291 Ga0207646_10101750 3300025922 Bacteria 2576
292 Ga0207681_10035629 3300025923 Bacteria 3280
293 Ga0207681_10044057 3300025923 Bacteria 2989
294 Ga0207681_10055414 3300025923 Bacteria 2700
295 Ga0207681_10070953 3300025923 Bacteria 2428
296 Ga0207681_10118295 3300025923 Bacteria 1939
297 Ga0207681_10150739 3300025923 Bacteria 1742
298 Ga0207681_10379724 3300025923 Bacteria 1137
299 Ga0207681_10493609 3300025923 Bacteria 1001
300 Ga0207681_11210322 3300025923 Bacteria 634
301 Ga0207694_10030545 3300025924 Bacteria 4115
302 Ga0207694_10727355 3300025924 Bacteria 837
303 Ga0207650_10017612 3300025925 Bacteria 5003
304 Ga0207650_10061598 3300025925 Bacteria 2802
305 Ga0207650_10157401 3300025925 Bacteria 1797
306 Ga0207650_10183452 3300025925 Bacteria 1669
307 Ga0207659_10000501 3300025926 Bacteria 23548
308 Ga0207659_10014754 3300025926 Bacteria 5049
309 Ga0207659_10020760 3300025926 Bacteria 4348
310 Ga0207659_10429373 3300025926 Bacteria 1109
311 Ga0207659_10543349 3300025926 Bacteria 987
312 Ga0207659_10778997 3300025926 Bacteria 821
313 Ga0207687_10744688 3300025927 Bacteria 834
314 Ga0207644_10085382 3300025931 Bacteria 2341
315 Ga0207644_10119773 3300025931 Bacteria 2002
316 Ga0207644_10238098 3300025931 Bacteria 1448
317 Ga0207690_10128797 3300025932 Bacteria 1849
318 Ga0207690_10348211 3300025932 Bacteria 1171
319 Ga0207706_10042267 3300025933 Bacteria 4040
320 Ga0207706_10050254 3300025933 Bacteria 3685
321 Ga0207706_10054366 3300025933 Bacteria 3534
322 Ga0207706_10059061 3300025933 Bacteria 3378
323 Ga0207686_10050486 3300025934 Bacteria 2587
324 Ga0207686_10243605 3300025934 Bacteria 1310
325 Ga0207686_10246954 3300025934 Bacteria 1302
326 Ga0207709_10007327 3300025935 Bacteria 6151
327 Ga0207709_10291939 3300025935 Bacteria 1209
328 Ga0207670_10092069 3300025936 Bacteria 2145
329 Ga0207670_10200756 3300025936 Bacteria 1515
330 Ga0207670_10211196 3300025936 Bacteria 1480
331 Ga0207669_10283443 3300025937 Bacteria 1251
332 Ga0207669_10519495 3300025937 Bacteria 956
333 Ga0207669_10650215 3300025937 Bacteria 862
334 Ga0207704_10011415 3300025938 Bacteria 4374
335 Ga0207704_10022939 3300025938 Bacteria 3355
336 Ga0207704_10038266 3300025938 Bacteria 2780
337 Ga0207691_10040373 3300025940 Bacteria 4312
338 Ga0207691_10043122 3300025940 Bacteria 4158
339 Ga0207691_10072170 3300025940 Bacteria 3114
340 Ga0207691_10074726 3300025940 Bacteria 3056
341 Ga0207691_10080538 3300025940 Bacteria 2929
342 Ga0207691_10238176 3300025940 Unclassified 1574
343 Ga0207691_10623972 3300025940 Bacteria 912
344 Ga0207711_10041791 3300025941 Bacteria 3905
345 Ga0207711_10049002 3300025941 Bacteria 3615
346 Ga0207711_10293256 3300025941 Bacteria 1499
347 Ga0207711_10437026 3300025941 Bacteria 1218
348 Ga0207711_10930881 3300025941 Bacteria 808
349 Ga0207689_10004769 3300025942 Bacteria 12231
350 Ga0207689_10497839 3300025942 Bacteria 1021
351 Ga0207689_10584640 3300025942 Bacteria 939
352 Ga0207689_11069946 3300025942 Bacteria 680
353 Ga0207661_10027026 3300025944 Bacteria 4380
354 Ga0207679_10038680 3300025945 Bacteria 3401
355 Ga0207679_10154294 3300025945 Bacteria 1873
356 Ga0207679_10231015 3300025945 Bacteria 1562
357 Ga0207679_10720029 3300025945 Bacteria 906
358 Ga0207679_10830788 3300025945 Bacteria 843
359 Ga0207679_11194357 3300025945 Bacteria 698
360 Ga0207667_10187506 3300025949 Bacteria 2123
361 Ga0207651_10113781 3300025960 Bacteria 2037
362 Ga0207651_10213930 3300025960 Bacteria 1554
363 Ga0207651_10264596 3300025960 Bacteria 1413
364 Ga0207651_10900200 3300025960 Bacteria 788
365 Ga0207668_10398823 3300025972 Bacteria 1162
366 Ga0207640_10018088 3300025981 Bacteria 4134
367 Ga0207640_10053034 3300025981 Bacteria 2645
368 Ga0207640_10349826 3300025981 Bacteria 1187
369 Ga0207658_10062531 3300025986 Bacteria 2786
370 Ga0207658_10239001 3300025986 Bacteria 1538
371 Ga0207677_10202166 3300026023 Bacteria 1580
372 Ga0207677_10346482 3300026023 Bacteria 1243
373 Ga0207677_10346847 3300026023 Bacteria 1243
374 Ga0207703_10018422 3300026035 Bacteria 5453
375 Ga0207703_10395367 3300026035 Bacteria 1281
376 Ga0207703_10397237 3300026035 Bacteria 1279
377 Ga0207678_10222519 3300026067 Bacteria 1616
378 Ga0207708_10015634 3300026075 Bacteria 5692
379 Ga0207708_10083007 3300026075 Bacteria 2463
380 Ga0207708_10114038 3300026075 Bacteria 2100
381 Ga0207708_10531914 3300026075 Bacteria 989
382 Ga0207641_10003428 3300026088 Bacteria 14048
383 Ga0207641_10068952 3300026088 Bacteria 3034
384 Ga0207641_10085539 3300026088 Bacteria 2748
385 Ga0207641_10547259 3300026088 Bacteria 1128
386 Ga0207641_10587730 3300026088 Bacteria 1089
387 Ga0207648_10026662 3300026089 Bacteria 5133
388 Ga0207648_10126004 3300026089 Bacteria 2253
389 Ga0207676_10035454 3300026095 Bacteria 3786
390 Ga0207676_10036130 3300026095 Bacteria 3756
391 Ga0207676_10247074 3300026095 Bacteria 1604
392 Ga0207674_10137541 3300026116 Bacteria 2404
393 Ga0207674_10302095 3300026116 Bacteria 1549
394 Ga0207674_10331875 3300026116 Bacteria 1471
395 Ga0207674_10430241 3300026116 Bacteria 1275
396 Ga0207675_100001961 3300026118 Bacteria 20530
397 Ga0207675_100053359 3300026118 Bacteria 3772
398 Ga0207675_100076709 3300026118 Bacteria 3130
399 Ga0207675_100125120 3300026118 Bacteria 2435
400 Ga0207675_100152050 3300026118 Bacteria 2203
401 Ga0207675_100206786 3300026118 Bacteria 1886
402 Ga0207675_100345165 3300026118 Bacteria 1458
403 Ga0207675_100388510 3300026118 Bacteria 1373
404 Ga0207683_10104508 3300026121 Bacteria 2531
405 Ga0207683_10141624 3300026121 Bacteria 2167
406 Ga0207683_10170588 3300026121 Bacteria 1970
407 Ga0207683_10187583 3300026121 Bacteria 1876
408 Ga0207683_10237443 3300026121 Bacteria 1662
409 Ga0207683_11034543 3300026121 Bacteria 762
410 Ga0207428_10022376 3300027907 Bacteria 5336
411 Ga0207428_10059452 3300027907 Bacteria 3031
412 Ga0268266_10189191 3300028379 Bacteria 1878
413 Ga0268266_10428441 3300028379 Unclassified 1255
414 Ga0268265_10074816 3300028380 Bacteria 2651
415 Ga0268265_10275070 3300028380 Bacteria 1504
416 Ga0268265_10335021 3300028380 Bacteria 1375
417 Ga0268265_10357284 3300028380 Bacteria 1336
418 Ga0268265_10500840 3300028380 Bacteria 1144
419 Ga0268264_10044786 3300028381 Bacteria 3671
420 Ga0268264_10241125 3300028381 Bacteria 1674
421 Ga0268264_10312834 3300028381 Bacteria 1482
422 Ga0307509_10391803 3300031507 Bacteria 1099
423 Ga0307410_10236216 3300031852 Bacteria 1414
424 Ga0307406_10358853 3300031901 Bacteria 1142
425 Ga0307407_10167686 3300031903 Bacteria 1443
426 Ga0307409_100080729 3300031995 Bacteria 2626
427 Ga0307416_100124115 3300032002 Bacteria 2309
428 Ga0307416_100145696 3300032002 Bacteria 2162
429 Ga0307414_10123076 3300032004 Bacteria 1998
430 Ga0307411_10181406 3300032005 Bacteria 1598
431 Ga0307411_10750364 3300032005 Bacteria 855
432 Ga0373948_0100118 3300034817 Bacteria 682
433 Ga0373938_0000206 3300034957 Bacteria 8908
434 Ga0373929_0014557 3300035085 Bacteria 1521
435 Ga0373940_0004281 3300035088 Bacteria 3005
436 Ga0373951_0000641 3300035091 Bacteria 9649
437 Ga0373952_0001452 3300035092 Bacteria 4312
438 Ga0373932_0000234 3300035112 Bacteria 16783
439 Ga0373939_0010538 3300035114 Bacteria 2314
440 Ga0373941_0000681 3300035115 Bacteria 6910
441 Ga0373941_0170103 3300035115 Unclassified 812
442 Ga0373942_0001609 3300035207 Bacteria 5780
443 Ga0373961_0002109 3300035241 Bacteria 5278
444 Ga0373962_0001193 3300035242 Bacteria 6081
445 Ga0373962_0013954 3300035242 Bacteria 2042
446 Ga0373931_0037709 3300035691 Bacteria 2524
447 Ga0373931_0061124 3300035691 Bacteria 2030
448 Ga0373927_0339873 3300035695 Bacteria 989
449 Ga0451791_1371515 3300041451 Bacteria 727
450 Ga0439442_032919 3300042002 Bacteria 1083
451 Ga0439446_0049312 3300042156 Bacteria 1255
452 Ga0439434_0012216 3300042435 Bacteria 2541
453 Ga0439434_0080364 3300042435 Bacteria 1034
454 Ga0466964_0149695 3300044706 Bacteria 1081
455 Ga0451576_0215493 3300045051 Bacteria 2005
456 Ga0451576_0268525 3300045051 Bacteria 1783
457 Ga0495629_0125039 3300046459 Bacteria 1792
458 Ga0495630_0273256 3300046517 Bacteria 1291
459 Ga0495643_0378844 3300046522 Bacteria 628
460 Ga0495640_0129118 3300046533 Bacteria 1637
461 Ga0495659_0042645 3300046664 Bacteria 1625
462 Ga0495659_0116094 3300046664 Unclassified 1050
463 Ga0495658_0150517 3300046683 Bacteria 1429
464 Ga0495669_0025398 3300046684 Bacteria 2584
465 Ga0495670_0043836 3300046691 Bacteria 2233
466 Ga0495680_0301947 3300047322 Bacteria 1124
467 Ga0496104_0010445 3300048907 Bacteria 8292
468 Ga0496104_0343877 3300048907 Unclassified 1405
469 Ga0496106_0054761 3300048909 Bacteria 3014
470 Ga0496108_0009031 3300048911 Bacteria 8077
471 Ga0496109_0108907 3300048912 Bacteria 2575
472 Ga0496111_0242222 3300048914 Bacteria 1339
473 Ga0496112_0042253 3300048915 Bacteria 4459
474 Ga0496113_0009126 3300048916 Bacteria 6498
475 Ga0496113_0011834 3300048916 Bacteria 5845
476 Ga0501034_0015307 3300049571 Bacteria 7884
477 Ga0501034_0174155 3300049571 Bacteria 2118
478 Ga0501046_0372409 3300049580 Bacteria 1035
479 Ga0501047_0006564 3300049581 Bacteria 10952
480 Ga0501067_0041572 3300049583 Bacteria 2553
481 Ga0501068_0078182 3300049584 Bacteria 2027
482 Ga0501044_0063277 3300049823 Bacteria 3780
483 nmdc:mga05p37_10862_c1 3300050507 Bacteria 10811
484 nmdc:mga05p37_109613_c1 3300050507 Bacteria 3396
485 nmdc:mga05p37_273921_c1 3300050507 Bacteria 2016
486 nmdc:mga05p37_2888_c1 3300050507 Bacteria 19926
487 nmdc:mga05p37_517811_c1 3300050507 Bacteria 1365
488 nmdc:mga05p37_90897_c1 3300050507 Bacteria 3762
489 nmdc:mga09592_1848_c1 3300050508 Bacteria 17028
490 nmdc:mga0qj67_242610_c1 3300050509 Bacteria 1462
491 nmdc:mga0qj67_319980_c1 3300050509 Bacteria 1256
492 nmdc:mga08y16_12654_c1 3300050511 Bacteria 8875
493 nmdc:mga08y16_148914_c1 3300050511 Bacteria 2433
494 nmdc:mga08y16_24741_c1 3300050511 Bacteria 6337
495 nmdc:mga08y16_266762_c1 3300050511 Bacteria 1768
496 nmdc:mga08y16_33260_c1 3300050511 Bacteria 5416
497 nmdc:mga0n895_123651_c1 3300050512 Bacteria 2610
498 nmdc:mga0n895_191386_c1 3300050512 Bacteria 2077
499 nmdc:mga0n895_370943_c1 3300050512 Bacteria 1449
500 nmdc:mga0n895_48448_c1 3300050512 Bacteria 4159
501 nmdc:mga0n895_496279_c1 3300050512 Bacteria 1230
502 nmdc:mga0n895_530899_c1 3300050512 Bacteria 1184
503 nmdc:mga0n895_84092_c1 3300050512 Bacteria 3175
504 nmdc:mga0n895_979083_c1 3300050512 Bacteria 828
505 nmdc:mga0rr50_3354_c1 3300050513 Bacteria 9199
506 nmdc:mga0rr50_336569_c1 3300050513 Bacteria 1268
507 nmdc:mga0rr50_374437_c1 3300050513 Bacteria 1200
508 nmdc:mga08x19_96791_c1 3300050514 Bacteria 1954
509 nmdc:mga0a205_195506_c1 3300050515 Bacteria 1914
510 nmdc:mga0a205_2103_c1 3300050515 Bacteria 17454
511 nmdc:mga0a205_63329_c1 3300050515 Bacteria 3573
512 Ga0500556_0028697 3300053104 Bacteria 1869
513 Ga0500658_0073455 3300053134 Bacteria 1448
514 Ga0590077_000704 3300059426 Bacteria 8838
515 Ga0075428_100082272
516 Ga0070690_100047784
517 Ga0070690_100475550
518 Ga0070670_100005693
519 Ga0070677_10052307
520 Ga0070677_10060289
521 Ga0070677_10132383
522 Ga0070677_10197791
523 Ga0068869_100001962
524 Ga0068869_100937686
525 Ga0070680_100150895
526 Ga0070680_100539135
527 Ga0070682_100353167
528 Ga0070682_100471596
529 Ga0068868_100155831
530 Ga0068868_100164382
531 Ga0068868_100357828
532 Ga0070689_100124881
533 Ga0070689_100611578
534 Ga0070691_10005391
535 Ga0070687_100064466
536 Ga0070687_100388496
537 Ga0070661_100143998
538 Ga0070692_10036489
539 Ga0070668_100061615
540 Ga0070668_100884137
541 Ga0070668_101180869
542 Ga0070669_100016560
543 Ga0070669_100086927
544 Ga0070669_100090140
545 Ga0070669_100119977
546 Ga0070669_100126817
547 Ga0070669_100203880
548 Ga0070669_100336289
549 Ga0070669_100347354
550 Ga0070669_100692721
551 Ga0070669_101194990
552 Ga0070675_100000442
553 Ga0070675_100001024
554 Ga0070675_100012826
555 Ga0070675_100024303
556 Ga0070675_100144836
557 Ga0070675_100163925
558 Ga0070675_100260839
559 Ga0070671_100001353
560 Ga0070671_100124916
561 Ga0070671_100145860
562 Ga0070671_100532148
563 Ga0070674_100029214
564 Ga0070673_100027661
565 Ga0070673_101389877
566 Ga0070688_100021012
567 Ga0070688_100181133
568 Ga0070688_100370702
569 Ga0070688_100654027
570 Ga0070659_100137923
571 Ga0070667_100161522
572 Ga0070667_100296187
573 Ga0070667_100967812
574 Ga0070701_10044991
575 Ga0070701_10640312
576 Ga0070705_100000288
577 Ga0070705_100002798
578 Ga0070705_100056266
579 Ga0070705_100057794
580 Ga0070700_100011740
581 Ga0070700_100147457
582 Ga0070694_100028490
583 Ga0070694_100097473
584 Ga0070694_100283657
585 Ga0070708_100308710
586 Ga0070663_100483380
587 Ga0070678_100201315
588 Ga0070678_100296254
589 Ga0070678_100334051
590 Ga0070678_100553222
591 Ga0070678_100875995
592 Ga0070662_100139858
593 Ga0070662_100181561
594 Ga0070662_100259740
595 Ga0068867_100007110
596 Ga0068867_100012153
597 Ga0068867_100079634
598 Ga0070685_10144478
599 Ga0070706_100247188
600 Ga0070698_100002474
601 Ga0070699_100063016
602 Ga0070699_100104888
603 Ga0070697_100004983
604 Ga0070672_100037705
605 Ga0070672_100112438
606 Ga0070672_100130398
607 Ga0070672_100288553
608 Ga0070672_100546264
609 Ga0070672_100679047
610 Ga0070695_100005834
611 Ga0070695_100033314
612 Ga0070696_100001518
613 Ga0070696_100001520
614 Ga0070696_100033671
615 Ga0070696_100612718
616 Ga0070665_100002711
617 Ga0070665_100995012
618 Ga0070704_100000802
619 Ga0070704_100023092
620 Ga0070664_100042225
621 Ga0070664_100102202
622 Ga0070664_100148019
623 Ga0070664_100249076
624 Ga0070664_100290693
625 Ga0070664_100728941
626 Ga0068857_100124417
627 Ga0068857_100445647
628 Ga0068854_100242937
629 Ga0068854_100511510
630 Ga0068854_100710420
631 Ga0068856_100323747
632 Ga0070702_100002550
633 Ga0070702_100022961
634 Ga0070702_100071919
635 Ga0070702_100133440
636 Ga0068859_100121318
637 Ga0068859_100129679
638 Ga0068859_100159471
639 Ga0068859_100184231
640 Ga0068859_100232132
641 Ga0068859_100262381
642 Ga0068859_100309739
643 Ga0068859_100414797
644 Ga0068859_100423429
645 Ga0068864_100002331
646 Ga0068864_100008459
647 Ga0068864_100022414
648 Ga0068864_100088744
649 Ga0068864_100257717
650 Ga0068864_100278329
651 Ga0068866_10010430
652 Ga0068866_10210929
653 Ga0068861_100242451
654 Ga0068861_100445985
655 Ga0068861_100980343
656 Ga0068861_101282573
657 Ga0068851_10014946
658 Ga0068870_10182881
659 Ga0068863_100154907
660 Ga0068863_100455672
661 Ga0068863_100577190
662 Ga0068863_100657705
663 Ga0068858_100010084
664 Ga0068858_100035521
665 Ga0068858_100098207
666 Ga0068858_100114672
667 Ga0068858_100255375
668 Ga0068858_100474728
669 Ga0068858_100651221
670 Ga0068858_100849294
671 Ga0068860_100015275
672 Ga0068860_100015659
673 Ga0068860_100726702
674 Ga0068862_100347347
675 Ga0068862_100434898
676 Ga0068862_100950409
677 Ga0081455_10015599
678 Ga0075365_10057847
679 Ga0075364_10454056
680 Ga0075369_10172046
681 Ga0097621_100009984
682 Ga0097621_100043964
683 Ga0097621_100067074
684 Ga0097621_100182536
685 Ga0097621_101044520
686 Ga0068871_100009037
687 Ga0068871_100060151
688 Ga0068871_100219000
689 Ga0068871_100396654
690 Ga0075428_100422679
691 Ga0075430_100265436
692 Ga0075431_100032234
693 Ga0075433_10241517
694 Ga0075434_100110857
695 Ga0075434_100384370
696 Ga0075434_100434560
697 Ga0075434_101293890
698 Ga0075429_100003923
699 Ga0075429_100288621
700 Ga0075429_100314564
701 Ga0068865_100003815
702 Ga0068865_100230502
703 Ga0075436_100008937
704 Ga0075436_100305085
705 Ga0097620_100121315
706 Ga0097620_100129684
707 Ga0097620_100159473
708 Ga0097620_100184211
709 Ga0097620_100232144
710 Ga0097620_100262391
711 Ga0097620_100309745
712 Ga0097620_100414802
713 Ga0097620_100423407
714 Ga0097620_101151766
715 Ga0075435_100003692
716 Ga0075435_100385279
717 Ga0111539_10002468
718 Ga0111539_10110764
719 Ga0111539_10226060
720 Ga0111539_10259251
721 Ga0111539_10274210
722 Ga0105245_10878968
723 Ga0105247_10068619
724 Ga0114129_10001790
725 Ga0114129_10103084
726 Ga0114129_10349630
727 Ga0114129_10384099
728 Ga0114129_11096472
729 Ga0105243_10027395
730 Ga0105243_10077158
731 Ga0105243_10105388
732 Ga0105243_10712453
733 Ga0105242_10007676
734 Ga0105242_10072616
735 Ga0105242_10300640
736 Ga0105242_10457594
737 Ga0105242_10519105
738 Ga0105248_10008967
739 Ga0105248_10080722
740 Ga0105248_10121634
741 Ga0105248_10165875
742 Ga0105248_10271741
743 Ga0105248_10312123
744 Ga0105248_10441679
745 Ga0105238_10014720
746 Ga0105238_10773737
747 Ga0105249_10464308
748 Ga0105249_10675962
749 Ga0105246_10151150
750 Ga0105246_10204850
751 Ga0157378_10318632
752 Ga0157378_10694677
753 Ga0157378_10820099
754 Ga0163162_10045801
755 Ga0163162_10554472
756 Ga0157375_10145957
757 Ga0157375_10265649
758 Ga0157375_10331045
759 Ga0157375_10769001
760 Ga0157375_11275303
761 Ga0163163_10012986
762 Ga0163163_10039033
763 Ga0163163_10054081
764 Ga0163163_10074644
765 Ga0163163_10176512
766 Ga0163163_10252618
767 Ga0163163_10348751
768 Ga0163163_10422908
769 Ga0163163_10838105
770 Ga0157380_10011997
771 Ga0157380_10173195
772 Ga0157380_10615468
773 Ga0157380_10948983
774 Ga0157380_11308549
775 Ga0157380_11574597
776 Ga0157377_10046405
777 Ga0157377_10244236
778 Ga0157377_10469044
779 Ga0157379_10015268
780 Ga0157379_10019035
781 Ga0157376_10139153
782 Ga0157376_10302453
783 Ga0207656_10010009
784 Ga0207682_10033772
785 Ga0207682_10055286
786 Ga0207682_10120748
787 Ga0207642_10124348
788 Ga0207642_10233204
789 Ga0207710_10004508
790 Ga0207688_10038338
791 Ga0207688_10041962
792 Ga0207688_10070223
793 Ga0207680_10164350
794 Ga0207680_10785155
795 Ga0207645_10010985
796 Ga0207643_10038016
797 Ga0207643_10092830
798 Ga0207705_10219813
799 Ga0207684_10118177
800 Ga0207662_10347216
801 Ga0207662_10395649
802 Ga0207649_10192049
803 Ga0207649_10255673
804 Ga0207649_10854869
805 Ga0207646_10101750
806 Ga0207681_10035629
807 Ga0207681_10044057
808 Ga0207681_10055414
809 Ga0207681_10070953
810 Ga0207681_10118295
811 Ga0207681_10150739
812 Ga0207681_10379724
813 Ga0207681_10493609
814 Ga0207681_11210322
815 Ga0207694_10030545
816 Ga0207694_10727355
817 Ga0207650_10017612
818 Ga0207650_10061598
819 Ga0207650_10157401
820 Ga0207650_10183452
821 Ga0207659_10000501
822 Ga0207659_10014754
823 Ga0207659_10020760
824 Ga0207659_10429373
825 Ga0207659_10543349
826 Ga0207659_10778997
827 Ga0207687_10744688
828 Ga0207644_10085382
829 Ga0207644_10119773
830 Ga0207644_10238098
831 Ga0207690_10128797
832 Ga0207690_10348211
833 Ga0207706_10042267
834 Ga0207706_10050254
835 Ga0207706_10054366
836 Ga0207706_10059061
837 Ga0207686_10050486
838 Ga0207686_10243605
839 Ga0207686_10246954
840 Ga0207709_10007327
841 Ga0207709_10291939
842 Ga0207670_10092069
843 Ga0207670_10200756
844 Ga0207670_10211196
845 Ga0207669_10283443
846 Ga0207669_10519495
847 Ga0207669_10650215
848 Ga0207704_10011415
849 Ga0207704_10022939
850 Ga0207704_10038266
851 Ga0207691_10040373
852 Ga0207691_10043122
853 Ga0207691_10072170
854 Ga0207691_10074726
855 Ga0207691_10080538
856 Ga0207691_10238176
857 Ga0207691_10623972
858 Ga0207711_10041791
859 Ga0207711_10049002
860 Ga0207711_10293256
861 Ga0207711_10437026
862 Ga0207711_10930881
863 Ga0207689_10004769
864 Ga0207689_10497839
865 Ga0207689_10584640
866 Ga0207689_11069946
867 Ga0207661_10027026
868 Ga0207679_10038680
869 Ga0207679_10154294
870 Ga0207679_10231015
871 Ga0207679_10720029
872 Ga0207679_10830788
873 Ga0207679_11194357
874 Ga0207667_10187506
875 Ga0207651_10113781
876 Ga0207651_10213930
877 Ga0207651_10264596
878 Ga0207651_10900200
879 Ga0207668_10398823
880 Ga0207640_10018088
881 Ga0207640_10053034
882 Ga0207640_10349826
883 Ga0207658_10062531
884 Ga0207658_10239001
885 Ga0207677_10202166
886 Ga0207677_10346482
887 Ga0207677_10346847
888 Ga0207703_10018422
889 Ga0207703_10395367
890 Ga0207703_10397237
891 Ga0207678_10222519
892 Ga0207708_10015634
893 Ga0207708_10083007
894 Ga0207708_10114038
895 Ga0207708_10531914
896 Ga0207641_10003428
897 Ga0207641_10068952
898 Ga0207641_10085539
899 Ga0207641_10547259
900 Ga0207641_10587730
901 Ga0207648_10026662
902 Ga0207648_10126004
903 Ga0207676_10035454
904 Ga0207676_10036130
905 Ga0207676_10247074
906 Ga0207674_10137541
907 Ga0207674_10302095
908 Ga0207674_10331875
909 Ga0207674_10430241
910 Ga0207675_100001961
911 Ga0207675_100053359
912 Ga0207675_100076709
913 Ga0207675_100125120
914 Ga0207675_100152050
915 Ga0207675_100206786
916 Ga0207675_100345165
917 Ga0207675_100388510
918 Ga0207683_10104508
919 Ga0207683_10141624
920 Ga0207683_10170588
921 Ga0207683_10187583
922 Ga0207683_10237443
923 Ga0207683_11034543
924 Ga0207428_10022376
925 Ga0207428_10059452
926 Ga0268266_10189191
927 Ga0268266_10428441
928 Ga0268265_10074816
929 Ga0268265_10275070
930 Ga0268265_10335021
931 Ga0268265_10357284
932 Ga0268265_10500840
933 Ga0268264_10044786
934 Ga0268264_10241125
935 Ga0268264_10312834
936 Ga0307509_10391803
937 Ga0307410_10236216
938 Ga0307406_10358853
939 Ga0307407_10167686
940 Ga0307409_100080729
941 Ga0307416_100124115
942 Ga0307416_100145696
943 Ga0307414_10123076
944 Ga0307411_10181406
945 Ga0307411_10750364
946 Ga0373948_0100118
947 Ga0373938_0000206
948 Ga0373929_0014557
949 Ga0373940_0004281
950 Ga0373951_0000641
951 Ga0373952_0001452
952 Ga0373932_0000234
953 Ga0373939_0010538
954 Ga0373941_0000681
955 Ga0373941_0170103
956 Ga0373942_0001609
957 Ga0373961_0002109
958 Ga0373962_0001193
959 Ga0373962_0013954
960 Ga0373931_0037709
961 Ga0373931_0061124
962 Ga0373927_0339873
963 Ga0451791_1371515
964 Ga0439442_032919
965 Ga0439446_0049312
966 Ga0439434_0012216
967 Ga0439434_0080364
968 Ga0466964_0149695
969 Ga0451576_0215493
970 Ga0451576_0268525
971 Ga0495629_0125039
972 Ga0495630_0273256
973 Ga0495643_0378844
974 Ga0495640_0129118
975 Ga0495659_0042645
976 Ga0495659_0116094
977 Ga0495658_0150517
978 Ga0495669_0025398
979 Ga0495670_0043836
980 Ga0495680_0301947
981 Ga0496104_0010445
982 Ga0496104_0343877
983 Ga0496106_0054761
984 Ga0496108_0009031
985 Ga0496109_0108907
986 Ga0496111_0242222
987 Ga0496112_0042253
988 Ga0496113_0009126
989 Ga0496113_0011834
990 Ga0501034_0015307
991 Ga0501034_0174155
992 Ga0501046_0372409
993 Ga0501047_0006564
994 Ga0501067_0041572
995 Ga0501068_0078182
996 Ga0501044_0063277
997 nmdc:mga05p37_10862_c1
998 nmdc:mga05p37_109613_c1
999 nmdc:mga05p37_273921_c1
1000 nmdc:mga05p37_2888_c1
1001 nmdc:mga05p37_517811_c1
1002 nmdc:mga05p37_90897_c1
1003 nmdc:mga09592_1848_c1
1004 nmdc:mga0qj67_242610_c1
1005 nmdc:mga0qj67_319980_c1
1006 nmdc:mga08y16_12654_c1
1007 nmdc:mga08y16_148914_c1
1008 nmdc:mga08y16_24741_c1
1009 nmdc:mga08y16_266762_c1
1010 nmdc:mga08y16_33260_c1
1011 nmdc:mga0n895_123651_c1
1012 nmdc:mga0n895_191386_c1
1013 nmdc:mga0n895_370943_c1
1014 nmdc:mga0n895_48448_c1
1015 nmdc:mga0n895_496279_c1
1016 nmdc:mga0n895_530899_c1
1017 nmdc:mga0n895_84092_c1
1018 nmdc:mga0n895_979083_c1
1019 nmdc:mga0rr50_3354_c1
1020 nmdc:mga0rr50_336569_c1
1021 nmdc:mga0rr50_374437_c1
1022 nmdc:mga08x19_96791_c1
1023 nmdc:mga0a205_195506_c1
1024 nmdc:mga0a205_2103_c1
1025 nmdc:mga0a205_63329_c1
1026 Ga0500556_0028697
1027 Ga0500658_0073455
1028 Ga0590077_000704

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02075

RuvC

Crossover junction endodeoxyribonuclease RuvC

3

151

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xhj-assembly1.cif.gz_A crystal structure of ruvc from deinococcus radiodurans 0.945 1 155
6lw3-assembly1.cif.gz_B crystal structure of ruvc from pseudomonas aeruginosa 0.9442 2 154
7w8d-assembly1.cif.gz_B the structure of deinococcus radiodurans ruvc 0.9395 1 156
7xhj-assembly1.cif.gz_A crystal structure of ruvc from deinococcus radiodurans 0.9392 1 155
6s16-assembly1.cif.gz_A t. thermophilus ruvc in complex with holliday junction substrate 0.9376 1 158
ID Description Score Start End Superfamily
1hjrC00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9418 1 153 3.30.420.10
af_P9WGV9_1_161_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.941 1 159 3.30.420.10
4ld0B00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9362 1 152 3.30.420.10
af_P9WGV9_1_161_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9242 1 159 3.30.420.10
1hjrC00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8962 1 153 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A3D2WYF3-F1-model_v4 Crossover junction endodeoxyribonuclease RuvC (EC 3.1.21.10) (Holliday junction nuclease RuvC) (Holliday junction resolvase RuvC) 0.9729 1 152 GO:0000287
GO:0003677
GO:0005737
GO:0006281
GO:0006310
GO:0008821
GO:0048476
AF-A0A661JJL3-F1-model_v4 Crossover junction endodeoxyribonuclease RuvC 0.9729 1 114 GO:0003677
GO:0004520
GO:0006281
GO:0006310
GO:0046872
AF-A0A3B9MQ23-F1-model_v4 Crossover junction endodeoxyribonuclease RuvC 0.9729 1 69 GO:0003677
GO:0004520
GO:0006281
GO:0006310
GO:0046872
AF-A0A7T9IP38-F1-model_v4 deleted 0.9716 2 153
AF-A0A831K739-F1-model_v4 Crossover junction endodeoxyribonuclease RuvC (EC 3.1.21.10) (Holliday junction nuclease RuvC) (Holliday junction resolvase RuvC) 0.9709 2 156 GO:0000287
GO:0003677
GO:0005737
GO:0006281
GO:0006310
GO:0008821
GO:0048476

Map