F457699

General Info

Members Datasets Scaffolds Average Seq Length
514 265 510 116

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10431735|Ga0075365_104317351
Length 130
Sequence VSADAVGNGKPANVESITVEVLEEIAERNQTWPVMAAKYGVENPLPPWRTSLDGLCDALDRSCSVDEKLHFTFKERRDEEDALAATRYADLPYPENQLVALAHSLVARGVISEAELQERLAAIRARLEAE

Samples

Sample ID Description Type Environment
1 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
2 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
3 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
4 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
5 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
9 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
12 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
13 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
14 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
81 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
82 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
89 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
173 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
174 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
175 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
176 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
177 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
178 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
181 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
182 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
183 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
184 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
185 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
186 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
187 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
188 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
189 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
190 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
191 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
192 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
193 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
194 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
195 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
196 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
197 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
198 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
199 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
200 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
201 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
202 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
203 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
204 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
205 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
219 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
220 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
221 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
222 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
223 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
224 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
225 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
226 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
227 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
228 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
229 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
230 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
233 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
236 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
237 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
238 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
239 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
240 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
241 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
242 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
243 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
244 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
245 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
246 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
247 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
248 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.72
Metatranscriptomes 3.5
Isolates 0.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.15
Nodule 0
Rhizoplane 9.14
Rhizosphere 72.18
Stem 0
Stem Tuber 0
Unclassified 2.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24747J21853_1004755 3300001978 Bacteria 1231
2 JGI24739J22299_10050493 3300001989 Bacteria 1345
3 JGI24743J22301_10067546 3300001991 Bacteria 743
4 JGI24750J21931_1020482 3300002070 Bacteria 922
5 JGI24748J21848_1005820 3300002074 Bacteria 1433
6 JGI24738J21930_10012597 3300002075 Bacteria 1845
7 JGI24749J21850_1013443 3300002076 Bacteria 1149
8 JGI24744J21845_10000053 3300002077 Bacteria 13445
9 JGI24034J26672_10003514 3300002239 Bacteria 2187
10 JGI24742J22300_10001182 3300002244 Bacteria 4071
11 Ga0070676_10056914 3300005328 Bacteria 2312
12 Ga0070683_100169512 3300005329 Bacteria 2072
13 Ga0070683_100203885 3300005329 Bacteria 1878
14 Ga0070690_100001292 3300005330 Bacteria 13002
15 Ga0070670_100103554 3300005331 Bacteria 2452
16 Ga0068869_100223734 3300005334 Bacteria 1493
17 Ga0070666_10096116 3300005335 Bacteria 2039
18 Ga0070666_11327925 3300005335 Bacteria 537
19 Ga0070682_100001916 3300005337 Bacteria 11610
20 Ga0070682_100028848 3300005337 Bacteria 3339
21 Ga0068868_100009639 3300005338 Bacteria 6966
22 Ga0068868_100101718 3300005338 Bacteria 2326
23 Ga0070660_100088067 3300005339 Bacteria 2445
24 Ga0070660_100224324 3300005339 Bacteria 1528
25 Ga0070689_100018207 3300005340 Bacteria 5171
26 Ga0070689_100206127 3300005340 Bacteria 1607
27 Ga0070691_10001466 3300005341 Bacteria 10121
28 Ga0070691_10848314 3300005341 Bacteria 560
29 Ga0070687_100652949 3300005343 Bacteria 729
30 Ga0070661_100932625 3300005344 Bacteria 718
31 Ga0070692_10261556 3300005345 Bacteria 1040
32 Ga0070692_10272579 3300005345 Bacteria 1022
33 Ga0070692_10699972 3300005345 Bacteria 682
34 Ga0070668_100000358 3300005347 Bacteria 30164
35 Ga0070668_100050475 3300005347 Bacteria 3203
36 Ga0070668_100206394 3300005347 Bacteria 1614
37 Ga0070669_100060942 3300005353 Bacteria 2772
38 Ga0070669_100091561 3300005353 Bacteria 2281
39 Ga0070675_100827050 3300005354 Bacteria 847
40 Ga0070671_100039829 3300005355 Bacteria 3901
41 Ga0070671_100126954 3300005355 Bacteria 2148
42 Ga0070671_100166305 3300005355 Bacteria 1865
43 Ga0070674_100003807 3300005356 Bacteria 8528
44 Ga0070673_100333189 3300005364 Bacteria 1343
45 Ga0070688_100002128 3300005365 Bacteria 9979
46 Ga0070659_100063532 3300005366 Bacteria 2921
47 Ga0070667_100000087 3300005367 Bacteria 114528
48 Ga0070667_100004048 3300005367 Bacteria 12396
49 Ga0070667_100012854 3300005367 Bacteria 6917
50 Ga0070667_100164775 3300005367 Bacteria 1954
51 Ga0070709_10046065 3300005434 Bacteria 2710
52 Ga0070709_11792888 3300005434 Bacteria 502
53 Ga0070714_100092290 3300005435 Bacteria 2654
54 Ga0070713_100230870 3300005436 Bacteria 1682
55 Ga0070701_10004264 3300005438 Bacteria 5766
56 Ga0070701_10756301 3300005438 Bacteria 659
57 Ga0070711_100063796 3300005439 Bacteria 2572
58 Ga0070705_100025323 3300005440 Bacteria 3216
59 Ga0070700_100014110 3300005441 Bacteria 4507
60 Ga0070694_100008986 3300005444 Bacteria 6121
61 Ga0070708_100229862 3300005445 Bacteria 1740
62 Ga0070663_100002640 3300005455 Bacteria 10142
63 Ga0070663_100889633 3300005455 Bacteria 768
64 Ga0070678_100001197 3300005456 Bacteria 13803
65 Ga0070678_100748763 3300005456 Bacteria 884
66 Ga0070662_100010769 3300005457 Bacteria 6019
67 Ga0068867_100006287 3300005459 Bacteria 8400
68 Ga0070685_10161517 3300005466 Bacteria 1428
69 Ga0070707_100338797 3300005468 Bacteria 1461
70 Ga0070707_102236583 3300005468 Bacteria 514
71 Ga0070684_100221648 3300005535 Bacteria 1726
72 Ga0070684_101226282 3300005535 Bacteria 705
73 Ga0068853_100051687 3300005539 Bacteria 3538
74 Ga0070686_100220964 3300005544 Bacteria 1369
75 Ga0070695_100040554 3300005545 Bacteria 2948
76 Ga0070696_100003435 3300005546 Bacteria 10555
77 Ga0070693_100009575 3300005547 Bacteria 4821
78 Ga0070665_100006380 3300005548 Bacteria 12021
79 Ga0070665_100056878 3300005548 Bacteria 3922
80 Ga0070665_100076003 3300005548 Bacteria 3366
81 Ga0070665_100763764 3300005548 Bacteria 980
82 Ga0070665_102010997 3300005548 Bacteria 583
83 Ga0070704_100000391 3300005549 Bacteria 20083
84 Ga0068854_100004672 3300005578 Bacteria 8636
85 Ga0070702_101854928 3300005615 Bacteria 505
86 Ga0068859_100000291 3300005617 Bacteria 49882
87 Ga0068859_100003251 3300005617 Bacteria 16545
88 Ga0068859_100904618 3300005617 Bacteria 967
89 Ga0068864_100133940 3300005618 Bacteria 2229
90 Ga0068864_100493567 3300005618 Bacteria 1177
91 Ga0068864_100503857 3300005618 Bacteria 1165
92 Ga0068864_102377347 3300005618 Bacteria 536
93 Ga0068866_10002931 3300005718 Bacteria 7038
94 Ga0068861_100120570 3300005719 Bacteria 2115
95 Ga0068861_102480132 3300005719 Bacteria 522
96 Ga0068851_11044398 3300005834 Bacteria 517
97 Ga0068870_10217940 3300005840 Bacteria 1166
98 Ga0068870_11441148 3300005840 Bacteria 505
99 Ga0068863_100010649 3300005841 Bacteria 8927
100 Ga0068863_100032817 3300005841 Bacteria 4947
101 Ga0068863_100115967 3300005841 Bacteria 2552
102 Ga0068858_100001109 3300005842 Bacteria 27859
103 Ga0068858_100511701 3300005842 Bacteria 1160
104 Ga0068858_100597215 3300005842 Bacteria 1071
105 Ga0068858_100668373 3300005842 Bacteria 1010
106 Ga0068860_100000020 3300005843 Bacteria 283324
107 Ga0068860_100012429 3300005843 Bacteria 8385
108 Ga0068862_100000013 3300005844 Bacteria 263115
109 Ga0068862_100001869 3300005844 Bacteria 19086
110 Ga0070717_11657673 3300006028 Bacteria 579
111 Ga0075365_10034781 3300006038 Bacteria 3256
112 Ga0075365_10035069 3300006038 Bacteria 3244
113 Ga0075365_10149271 3300006038 Bacteria 1626
114 Ga0075365_10431735 3300006038 Bacteria 930
115 Ga0075363_100000172 3300006048 Bacteria 16838
116 Ga0075363_100010009 3300006048 Bacteria 4480
117 Ga0075363_100030212 3300006048 Bacteria 2803
118 Ga0075363_100033123 3300006048 Bacteria 2689
119 Ga0075363_100062936 3300006048 Bacteria 2001
120 Ga0075363_100068300 3300006048 Bacteria 1927
121 Ga0075363_100222118 3300006048 Bacteria 1083
122 Ga0075363_100275800 3300006048 Bacteria 972
123 Ga0075363_100821622 3300006048 Bacteria 566
124 Ga0075364_10001434 3300006051 Bacteria 12924
125 Ga0075364_10004468 3300006051 Bacteria 8052
126 Ga0075364_10005507 3300006051 Bacteria 7366
127 Ga0075364_10006448 3300006051 Bacteria 6893
128 Ga0075364_10010211 3300006051 Bacteria 5663
129 Ga0075364_10035870 3300006051 Bacteria 3205
130 Ga0075364_10099430 3300006051 Bacteria 1936
131 Ga0075364_10226264 3300006051 Bacteria 1270
132 Ga0075364_10258628 3300006051 Bacteria 1183
133 Ga0070715_10013054 3300006163 Bacteria 3042
134 Ga0070716_100001115 3300006173 Bacteria 11831
135 Ga0070712_100040073 3300006175 Bacteria 3209
136 Ga0075362_10048030 3300006177 Bacteria 1903
137 Ga0075362_10092326 3300006177 Bacteria 1407
138 Ga0075362_10220104 3300006177 Bacteria 927
139 Ga0075367_10015484 3300006178 Bacteria 4147
140 Ga0075367_10066386 3300006178 Bacteria 2162
141 Ga0075367_10175959 3300006178 Bacteria 1333
142 Ga0075367_10189670 3300006178 Bacteria 1283
143 Ga0075369_10009468 3300006186 Bacteria 3786
144 Ga0075369_10035202 3300006186 Bacteria 2128
145 Ga0075369_10109558 3300006186 Bacteria 1244
146 Ga0075369_10111607 3300006186 Bacteria 1232
147 Ga0075369_10139195 3300006186 Bacteria 1106
148 Ga0075369_10184586 3300006186 Bacteria 960
149 Ga0097621_100025123 3300006237 Bacteria 4659
150 Ga0075370_10002478 3300006353 Bacteria 8558
151 Ga0075370_10003387 3300006353 Bacteria 7575
152 Ga0075370_10004197 3300006353 Bacteria 6954
153 Ga0075370_10018671 3300006353 Bacteria 3763
154 Ga0075370_10052416 3300006353 Bacteria 2315
155 Ga0075370_10356640 3300006353 Bacteria 874
156 Ga0075370_10635065 3300006353 Bacteria 648
157 Ga0075370_10760011 3300006353 Bacteria 590
158 Ga0075428_100004846 3300006844 Bacteria 14930
159 Ga0075428_101748152 3300006844 Bacteria 648
160 Ga0075430_100059757 3300006846 Bacteria 3204
161 Ga0097620_100000291 3300006931 Bacteria 49882
162 Ga0097620_100003251 3300006931 Bacteria 16545
163 Ga0097620_100904754 3300006931 Bacteria 967
164 Ga0099795_10034371 3300007788 Bacteria 1766
165 Ga0105250_10016124 3300009092 Bacteria 3050
166 Ga0105250_10078910 3300009092 Bacteria 1334
167 Ga0105240_10295529 3300009093 Bacteria 1855
168 Ga0105240_11044593 3300009093 Bacteria 872
169 Ga0111539_10324418 3300009094 Bacteria 1792
170 Ga0111539_11466491 3300009094 Bacteria 791
171 Ga0105245_10002903 3300009098 Bacteria 15381
172 Ga0105247_10000009 3300009101 Bacteria 385991
173 Ga0105247_10000366 3300009101 Bacteria 38409
174 Ga0105247_10054301 3300009101 Bacteria 2472
175 Ga0114129_10005689 3300009147 Bacteria 17652
176 Ga0105243_10001450 3300009148 Bacteria 20829
177 Ga0105243_11814448 3300009148 Bacteria 641
178 Ga0105241_10101337 3300009174 Bacteria 2289
179 Ga0105241_10151323 3300009174 Bacteria 1899
180 Ga0105242_10004714 3300009176 Bacteria 10558
181 Ga0105242_11760822 3300009176 Bacteria 657
182 Ga0105248_10000207 3300009177 Bacteria 67863
183 Ga0105248_10002194 3300009177 Bacteria 21610
184 Ga0105248_12595656 3300009177 Bacteria 578
185 Ga0105237_10025835 3300009545 Bacteria 6004
186 Ga0105237_11278189 3300009545 Bacteria 740
187 Ga0105238_10312659 3300009551 Bacteria 1556
188 Ga0105238_10466333 3300009551 Bacteria 1261
189 Ga0105249_10000057 3300009553 Bacteria 159358
190 Ga0105249_10007809 3300009553 Bacteria 9318
191 Ga0105249_10024392 3300009553 Bacteria 5435
192 Ga0105249_10865007 3300009553 Bacteria 970
193 Ga0099796_10338704 3300010159 Bacteria 646
194 Ga0099796_10372947 3300010159 Bacteria 620
195 Ga0105239_10081492 3300010375 Bacteria 3562
196 Ga0105239_10106552 3300010375 Bacteria 3105
197 Ga0105239_10152069 3300010375 Bacteria 2583
198 Ga0105239_11567011 3300010375 Bacteria 762
199 Ga0105246_10592450 3300011119 Bacteria 957
200 Ga0105246_10688737 3300011119 Bacteria 894
201 Ga0105246_11315612 3300011119 Bacteria 670
202 Ga0157369_10886026 3300013105 Bacteria 915
203 Ga0157374_10403274 3300013296 Bacteria 1364
204 Ga0157374_10482456 3300013296 Bacteria 1243
205 Ga0157374_10592412 3300013296 Bacteria 1118
206 Ga0157378_10001442 3300013297 Bacteria 21432
207 Ga0157378_11810546 3300013297 Bacteria 659
208 Ga0163162_10002768 3300013306 Bacteria 16649
209 Ga0163162_10027127 3300013306 Bacteria 5664
210 Ga0163162_10519986 3300013306 Bacteria 1320
211 Ga0157372_10009077 3300013307 Bacteria 10565
212 Ga0157375_10001272 3300013308 Bacteria 21812
213 Ga0157375_10987741 3300013308 Bacteria 982
214 Ga0157375_11668220 3300013308 Bacteria 754
215 Ga0163163_10131869 3300014325 Bacteria 2539
216 Ga0157380_10000302 3300014326 Bacteria 29666
217 Ga0157380_13279714 3300014326 Bacteria 517
218 Ga0157377_10496193 3300014745 Bacteria 852
219 Ga0157377_11179417 3300014745 Bacteria 592
220 Ga0157379_10045701 3300014968 Bacteria 3909
221 Ga0157379_10202170 3300014968 Bacteria 1797
222 Ga0157379_10998010 3300014968 Bacteria 798
223 Ga0163161_10000799 3300017792 Bacteria 24668
224 Ga0163161_10871216 3300017792 Bacteria 761
225 Ga0209051_1114236 3300025303 Bacteria 698
226 Ga0207692_10030153 3300025898 Bacteria 2583
227 Ga0207642_10000143 3300025899 Bacteria 20251
228 Ga0207710_10000014 3300025900 Bacteria 408072
229 Ga0207710_10001961 3300025900 Bacteria 9831
230 Ga0207710_10367778 3300025900 Bacteria 734
231 Ga0207688_10000090 3300025901 Bacteria 35199
232 Ga0207688_10409747 3300025901 Bacteria 841
233 Ga0207680_10027001 3300025903 Bacteria 3190
234 Ga0207680_10287750 3300025903 Bacteria 1143
235 Ga0207647_10069287 3300025904 Bacteria 2132
236 Ga0207685_10005331 3300025905 Bacteria 3383
237 Ga0207699_10012071 3300025906 Bacteria 4386
238 Ga0207643_10014234 3300025908 Bacteria 4320
239 Ga0207705_10831512 3300025909 Bacteria 716
240 Ga0207654_10101003 3300025911 Bacteria 1777
241 Ga0207654_10183282 3300025911 Bacteria 1367
242 Ga0207693_10000555 3300025915 Bacteria 33777
243 Ga0207663_10002170 3300025916 Bacteria 9368
244 Ga0207662_10020246 3300025918 Bacteria 3794
245 Ga0207662_10057811 3300025918 Bacteria 2319
246 Ga0207652_10460070 3300025921 Bacteria 1147
247 Ga0207681_10009454 3300025923 Bacteria 5959
248 Ga0207681_10219736 3300025923 Bacteria 1469
249 Ga0207650_10265741 3300025925 Bacteria 1393
250 Ga0207659_10736274 3300025926 Bacteria 845
251 Ga0207687_10158624 3300025927 Bacteria 1734
252 Ga0207700_10325492 3300025928 Bacteria 1333
253 Ga0207664_10706671 3300025929 Bacteria 906
254 Ga0207644_10170369 3300025931 Bacteria 1699
255 Ga0207644_10514373 3300025931 Bacteria 988
256 Ga0207690_10032665 3300025932 Bacteria 3341
257 Ga0207706_10016540 3300025933 Bacteria 6658
258 Ga0207686_10001099 3300025934 Bacteria 15816
259 Ga0207709_10002258 3300025935 Bacteria 12252
260 Ga0207709_10701851 3300025935 Bacteria 810
261 Ga0207670_10029755 3300025936 Bacteria 3482
262 Ga0207670_10855997 3300025936 Bacteria 760
263 Ga0207670_11868408 3300025936 Bacteria 511
264 Ga0207669_10000752 3300025937 Bacteria 13994
265 Ga0207704_10000393 3300025938 Bacteria 19943
266 Ga0207704_11514464 3300025938 Bacteria 576
267 Ga0207665_10003000 3300025939 Bacteria 11326
268 Ga0207665_10693532 3300025939 Bacteria 800
269 Ga0207711_10000242 3300025941 Bacteria 58458
270 Ga0207711_10012688 3300025941 Bacteria 6999
271 Ga0207689_10287007 3300025942 Bacteria 1363
272 Ga0207661_10116060 3300025944 Bacteria 2272
273 Ga0207661_10270274 3300025944 Bacteria 1517
274 Ga0207712_10000050 3300025961 Bacteria 159469
275 Ga0207712_10046835 3300025961 Bacteria 3000
276 Ga0207712_10164232 3300025961 Bacteria 1729
277 Ga0207712_10699648 3300025961 Bacteria 884
278 Ga0207712_11346226 3300025961 Bacteria 638
279 Ga0207668_10005693 3300025972 Bacteria 7338
280 Ga0207668_10108657 3300025972 Bacteria 2076
281 Ga0207668_10142883 3300025972 Bacteria 1843
282 Ga0207640_10074644 3300025981 Bacteria 2296
283 Ga0207640_10174993 3300025981 Bacteria 1603
284 Ga0207658_10000065 3300025986 Bacteria 117079
285 Ga0207658_10000557 3300025986 Bacteria 33829
286 Ga0207658_10002082 3300025986 Bacteria 14885
287 Ga0207658_10024434 3300025986 Bacteria 4228
288 Ga0207658_10352205 3300025986 Bacteria 1282
289 Ga0207677_10003455 3300026023 Bacteria 8370
290 Ga0207703_10044415 3300026035 Bacteria 3571
291 Ga0207703_10168866 3300026035 Bacteria 1922
292 Ga0207703_10632880 3300026035 Bacteria 1014
293 Ga0207703_10773631 3300026035 Bacteria 915
294 Ga0207639_10003107 3300026041 Bacteria 11160
295 Ga0207678_10011227 3300026067 Bacteria 7867
296 Ga0207678_10336995 3300026067 Bacteria 1299
297 Ga0207708_10006978 3300026075 Bacteria 8352
298 Ga0207702_10287709 3300026078 Bacteria 1556
299 Ga0207702_12473870 3300026078 Bacteria 506
300 Ga0207641_10000740 3300026088 Bacteria 35113
301 Ga0207641_10026371 3300026088 Bacteria 4795
302 Ga0207641_10223902 3300026088 Bacteria 1746
303 Ga0207641_10938073 3300026088 Bacteria 860
304 Ga0207648_10000349 3300026089 Bacteria 50786
305 Ga0207676_10441892 3300026095 Bacteria 1224
306 Ga0207674_10187464 3300026116 Bacteria 2019
307 Ga0207675_100006409 3300026118 Bacteria 11147
308 Ga0207675_101211234 3300026118 Bacteria 775
309 Ga0207683_10000040 3300026121 Bacteria 95127
310 Ga0207683_10888671 3300026121 Bacteria 827
311 Ga0207698_10103266 3300026142 Bacteria 2369
312 Ga0209179_1016712 3300027512 Bacteria 1380
313 Ga0209813_10459000 3300027866 Bacteria 522
314 Ga0268266_10009738 3300028379 Bacteria 8450
315 Ga0268266_10062689 3300028379 Bacteria 3209
316 Ga0268266_10142417 3300028379 Bacteria 2152
317 Ga0268266_10820556 3300028379 Bacteria 898
318 Ga0268265_10000004 3300028380 Bacteria 648376
319 Ga0268265_10005589 3300028380 Bacteria 8582
320 Ga0268265_10156026 3300028380 Bacteria 1932
321 Ga0268264_10000024 3300028381 Bacteria 470081
322 Ga0268264_10225825 3300028381 Bacteria 1726
323 Ga0307408_101610550 3300031548 Bacteria 617
324 Ga0307413_10052844 3300031824 Bacteria 2457
325 Ga0307413_10279750 3300031824 Bacteria 1254
326 Ga0307410_10034781 3300031852 Bacteria 3267
327 Ga0307410_10144566 3300031852 Bacteria 1764
328 Ga0307410_10714016 3300031852 Bacteria 846
329 Ga0307410_12026189 3300031852 Bacteria 514
330 Ga0307406_10171820 3300031901 Bacteria 1569
331 Ga0307406_10666314 3300031901 Bacteria 865
332 Ga0307407_10042717 3300031903 Bacteria 2544
333 Ga0307409_100038157 3300031995 Bacteria 3550
334 Ga0307409_100041086 3300031995 Bacteria 3451
335 Ga0307416_100006772 3300032002 Bacteria 7204
336 Ga0307411_10019423 3300032005 Bacteria 3926
337 Ga0307411_11284546 3300032005 Bacteria 666
338 Ga0307415_100148578 3300032126 Bacteria 1800
339 Ga0307415_101084026 3300032126 Bacteria 749
340 Ga0307415_101941370 3300032126 Bacteria 572
341 Ga0373928_0108852 3300035084 Bacteria 731
342 Ga0373929_0135978 3300035085 Bacteria 648
343 Ga0373952_0108006 3300035092 Bacteria 741
344 Ga0373939_0177774 3300035114 Bacteria 792
345 Ga0373931_0066239 3300035691 Bacteria 1960
346 Ga0395900_1366347 3300037418 Bacteria 622
347 Ga0439461_0000057 3300041410 Bacteria 13747
348 Ga0439461_0031593 3300041410 Bacteria 1106
349 Ga0439466_0001478 3300041411 Bacteria 9175
350 Ga0439466_0005991 3300041411 Bacteria 4627
351 Ga0439466_0007929 3300041411 Bacteria 4005
352 Ga0439465_0000439 3300041413 Bacteria 12169
353 Ga0439465_0009138 3300041413 Bacteria 3122
354 Ga0439465_0016394 3300041413 Bacteria 2311
355 Ga0439465_0028130 3300041413 Bacteria 1781
356 Ga0439465_0097503 3300041413 Bacteria 1012
357 Ga0451853_3930057 3300041512 Bacteria 1903
358 Ga0439431_0000502 3300041997 Bacteria 8282
359 Ga0439431_0001548 3300041997 Bacteria 5093
360 Ga0439442_034931 3300042002 Bacteria 1051
361 Ga0439434_0021913 3300042435 Bacteria 1920
362 Ga0439434_0257913 3300042435 Bacteria 597
363 Ga0466969_0013120 3300044656 Bacteria 4366
364 Ga0466969_0398615 3300044656 Bacteria 625
365 Ga0466972_0023340 3300044658 Bacteria 3077
366 Ga0466972_0026448 3300044658 Bacteria 2877
367 Ga0466972_0031868 3300044658 Bacteria 2591
368 Ga0466965_0052361 3300044683 Bacteria 2027
369 Ga0466963_0135262 3300044694 Bacteria 1705
370 Ga0466963_0931343 3300044694 Bacteria 612
371 Ga0466963_0965576 3300044694 Bacteria 600
372 Ga0466971_0003835 3300044719 Bacteria 6441
373 Ga0466968_0055795 3300044735 Bacteria 1696
374 Ga0466957_0327096 3300044842 Bacteria 1035
375 Ga0466957_1296175 3300044842 Bacteria 528
376 Ga0466960_0000122 3300044901 Bacteria 25798
377 Ga0466958_0019898 3300045836 Bacteria 3911
378 Ga0466958_0194194 3300045836 Bacteria 1291
379 Ga0466967_0001060 3300045976 Bacteria 15161
380 Ga0466967_0275615 3300045976 Bacteria 1613
381 Ga0466967_0391460 3300045976 Bacteria 1351
382 Ga0466967_2572766 3300045976 Bacteria 504
383 Ga0495686_0615793 3300047472 Bacteria 561
384 Ga0496100_0005195 3300048903 Bacteria 6986
385 Ga0496100_0017984 3300048903 Bacteria 4185
386 Ga0496100_0266589 3300048903 Bacteria 1272
387 Ga0496100_0880807 3300048903 Bacteria 703
388 Ga0496101_0002316 3300048904 Bacteria 11658
389 Ga0496101_0446541 3300048904 Bacteria 1020
390 Ga0496101_1315002 3300048904 Bacteria 565
391 Ga0496102_0000600 3300048905 Bacteria 37655
392 Ga0496102_0000718 3300048905 Bacteria 32794
393 Ga0496102_0004697 3300048905 Bacteria 11558
394 Ga0496102_0076178 3300048905 Bacteria 3085
395 Ga0496102_0474172 3300048905 Bacteria 1173
396 Ga0496102_1740814 3300048905 Bacteria 541
397 Ga0496103_0000630 3300048906 Bacteria 26992
398 Ga0496103_0000667 3300048906 Bacteria 25794
399 Ga0496103_0185552 3300048906 Bacteria 1337
400 Ga0496104_0078845 3300048907 Bacteria 3139
401 Ga0496105_0166989 3300048908 Bacteria 1805
402 Ga0496106_0006021 3300048909 Bacteria 8973
403 Ga0496106_0141577 3300048909 Bacteria 1892
404 Ga0496106_0278097 3300048909 Bacteria 1341
405 Ga0496107_0002661 3300048910 Bacteria 11698
406 Ga0496107_0028122 3300048910 Bacteria 3995
407 Ga0496108_0036265 3300048911 Bacteria 4103
408 Ga0496109_0019118 3300048912 Bacteria 6034
409 Ga0496109_0105288 3300048912 Bacteria 2620
410 Ga0496109_0176751 3300048912 Bacteria 2004
411 Ga0496109_1130573 3300048912 Bacteria 720
412 Ga0496109_1313945 3300048912 Bacteria 659
413 Ga0496110_0016422 3300048913 Bacteria 6181
414 Ga0496110_0415501 3300048913 Bacteria 1226
415 Ga0496110_0539931 3300048913 Bacteria 1060
416 Ga0496110_0716236 3300048913 Bacteria 903
417 Ga0496110_1443182 3300048913 Bacteria 598
418 Ga0496111_0065077 3300048914 Bacteria 2646
419 Ga0496111_0092801 3300048914 Bacteria 2213
420 Ga0496112_0038084 3300048915 Bacteria 4695
421 Ga0496112_0362996 3300048915 Bacteria 1390
422 Ga0496112_0491178 3300048915 Bacteria 1163
423 Ga0496112_1539007 3300048915 Bacteria 579
424 Ga0496113_0169866 3300048916 Bacteria 1727
425 Ga0496113_0467351 3300048916 Bacteria 1014
426 Ga0496114_0001610 3300048917 Bacteria 17143
427 Ga0496114_1118971 3300048917 Bacteria 673
428 Ga0496114_1412623 3300048917 Bacteria 583
429 Ga0496115_0101192 3300048918 Bacteria 2363
430 Ga0496115_0264715 3300048918 Bacteria 1413
431 Ga0496116_0009817 3300048919 Bacteria 8110
432 Ga0496116_0297327 3300048919 Bacteria 771
433 Ga0496117_0001462 3300048920 Bacteria 34041
434 Ga0496118_0002617 3300048921 Bacteria 23874
435 Ga0496119_0037605 3300048922 Bacteria 3141
436 Ga0496120_0006562 3300048923 Bacteria 8888
437 Ga0496121_0002393 3300048924 Bacteria 28754
438 Ga0496124_0406236 3300048927 Bacteria 943
439 Ga0496125_0014032 3300048928 Bacteria 7832
440 Ga0496126_0011652 3300048929 Bacteria 9073
441 Ga0501034_0117846 3300049571 Bacteria 2643
442 Ga0501047_0390668 3300049581 Bacteria 1225
443 Ga0501047_0471827 3300049581 Bacteria 1083
444 Ga0501067_0139531 3300049583 Bacteria 1350
445 Ga0501070_0063913 3300049586 Bacteria 3049
446 Ga0501044_0090925 3300049823 Bacteria 3079
447 nmdc:mga03683_253400_c1 3300050489 Bacteria 818
448 nmdc:mga03n38_116519_c1 3300050490 Bacteria 1308
449 nmdc:mga03n38_16746_c1 3300050490 Bacteria 2859
450 nmdc:mga03n38_200767_c1 3300050490 Bacteria 1032
451 nmdc:mga03n38_34733_c1 3300050490 Bacteria 2155
452 nmdc:mga03n38_375218_c1 3300050490 Bacteria 778
453 nmdc:mga03n38_46186_c1 3300050490 Bacteria 1922
454 nmdc:mga03n38_49426_c1 3300050490 Bacteria 1870
455 nmdc:mga03n38_6642_c1 3300050490 Bacteria 4037
456 nmdc:mga03n38_91288_c1 3300050490 Bacteria 1451
457 nmdc:mga00v17_146087_c1 3300050491 Bacteria 1518
458 nmdc:mga00v17_263175_c1 3300050491 Bacteria 1119
459 nmdc:mga00v17_34555_c1 3300050491 Bacteria 3004
460 nmdc:mga00v17_368729_c1 3300050491 Bacteria 934
461 nmdc:mga00v17_395469_c1 3300050491 Bacteria 898
462 nmdc:mga00v17_412477_c1 3300050491 Bacteria 877
463 nmdc:mga00v17_610_c1 3300050491 Bacteria 9214
464 nmdc:mga00v17_6708_c1 3300050491 Bacteria 6117
465 nmdc:mga00v17_7742_c1 3300050491 Bacteria 4200
466 nmdc:mga0yw44_17411_c1 3300050492 Bacteria 3909
467 nmdc:mga0yw44_297256_c1 3300050492 Bacteria 1081
468 nmdc:mga0yw44_327465_c1 3300050492 Bacteria 1029
469 nmdc:mga0k408_319481_c1 3300050493 Bacteria 926
470 nmdc:mga06z11_124318_c1 3300050494 Bacteria 1442
471 nmdc:mga06z11_186990_c1 3300050494 Bacteria 1197
472 nmdc:mga06z11_433152_c1 3300050494 Bacteria 793
473 nmdc:mga06z11_47584_c1 3300050494 Bacteria 2179
474 nmdc:mga06z11_491073_c1 3300050494 Bacteria 743
475 nmdc:mga06z11_549848_c1 3300050494 Bacteria 701
476 nmdc:mga04h51_493949_c1 3300050495 Bacteria 522
477 nmdc:mga07m45_11942_c1 3300050496 Bacteria 4576
478 nmdc:mga07m45_161982_c1 3300050496 Bacteria 1299
479 nmdc:mga07m45_26078_c1 3300050496 Bacteria 3210
480 nmdc:mga07m45_65095_c1 3300050496 Bacteria 2069
481 nmdc:mga05p37_6360_c1 3300050507 Bacteria 13918
482 nmdc:mga0qj67_1481843_c1 3300050509 Bacteria 522
483 nmdc:mga0qj67_28056_c1 3300050509 Bacteria 4367
484 nmdc:mga08y16_1778236_c1 3300050511 Bacteria 570
485 nmdc:mga08y16_1905325_c1 3300050511 Bacteria 545
486 nmdc:mga0sz30_119441_c1 3300050516 Bacteria 1158
487 nmdc:mga0sz30_138275_c1 3300050516 Bacteria 1075
488 nmdc:mga0sz30_149127_c1 3300050516 Bacteria 1034
489 nmdc:mga0sz30_87848_c1 3300050516 Bacteria 1350
490 Ga0495655_0017771 3300053083 Bacteria 1554
491 Ga0495655_0165323 3300053083 Unclassified 705
492 Ga0495655_0278751 3300053083 Bacteria 569
493 Ga0587093_001174 3300059478 Bacteria 2132
494 Ga0587066_007940 3300059490 Bacteria 1457
495 Ga0587070_012298 3300059491 Bacteria 1298
496 Ga0587077_010762 3300059493 Bacteria 1423
497 Ga0587083_0036723 3300059505 Bacteria 1005
498 Ga0587085_001870 3300059506 Bacteria 2052
499 Ga0587086_014953 3300059507 Bacteria 996
500 Ga0587089_003635 3300059509 Bacteria 1656
501 Ga0587092_010094 3300059512 Bacteria 1283
502 Ga0587094_004307 3300059513 Bacteria 1610
503 Ga0587101_007846 3300059623 Bacteria 1273
504 Ga0587109_014559 3300059624 Bacteria 1322
505 Ga0587115_011462 3300059626 Bacteria 1119
506 Ga0587128_008311 3300059630 Bacteria 1339
507 Ga0587067_011757 3300059640 Bacteria 1355
508 Ga0587072_004675 3300059643 Bacteria 2006
509 Ga0587076_013838 3300059645 Bacteria 1231
510 Ga0587107_017108 3300059652 Bacteria 967

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005842 Ga0068858_100597215 Ga0068858_1005972152 91
2 3300048912 Ga0496109_1313945 Ga0496109_1313945_361_642 93
3 3300048916 Ga0496113_0467351 Ga0496113_0467351_692_973 93
4 3300050491 nmdc:mga00v17_412477_c1 nmdc:mga00v17_412477_c1_19_300 93
5 3300041413 Ga0439465_0097503 Ga0439465_0097503_265_624 105
6 iso_pu_bacteria 2643221715 2644639636 109
7 iso_pu_bacteria 2902810491 2902814274 109
8 3300006038 Ga0075365_10431735 Ga0075365_104317351 110
9 3300006048 Ga0075363_100033123 Ga0075363_1000331232 110
10 3300006051 Ga0075364_10004468 Ga0075364_100044688 110
11 3300006177 Ga0075362_10048030 Ga0075362_100480303 110
12 3300006186 Ga0075369_10009468 Ga0075369_100094683 110
13 3300009092 Ga0105250_10016124 Ga0105250_100161246 110
14 3300041413 Ga0439465_0016394 Ga0439465_0016394_400_792 110
15 3300044694 Ga0466963_0965576 Ga0466963_0965576_201_560 110
16 3300044842 Ga0466957_1296175 Ga0466957_1296175_22_381 110
17 3300048913 Ga0496110_1443182 Ga0496110_1443182_71_406 110
18 3300050489 nmdc:mga03683_253400_c1 nmdc:mga03683_253400_c1_256_609 110
19 3300050490 nmdc:mga03n38_34733_c1 nmdc:mga03n38_34733_c1_1565_1957 110
20 3300050491 nmdc:mga00v17_368729_c1 nmdc:mga00v17_368729_c1_148_540 110
21 iso_pu_bacteria 2939582691 2939585917 110
22 3300005329 Ga0070683_100203885 Ga0070683_1002038853 111
23 3300005331 Ga0070670_100103554 Ga0070670_1001035543 111
24 3300005334 Ga0068869_100223734 Ga0068869_1002237342 111
25 3300005335 Ga0070666_11327925 Ga0070666_113279252 111
26 3300005339 Ga0070660_100088067 Ga0070660_1000880672 111
27 3300005340 Ga0070689_100206127 Ga0070689_1002061272 111
28 3300005341 Ga0070691_10848314 Ga0070691_108483142 111
29 3300005345 Ga0070692_10699972 Ga0070692_106999722 111
30 3300005434 Ga0070709_11792888 Ga0070709_117928881 111
31 3300005435 Ga0070714_100092290 Ga0070714_1000922902 111
32 3300005436 Ga0070713_100230870 Ga0070713_1002308702 111
33 3300005438 Ga0070701_10756301 Ga0070701_107563011 111
34 3300005455 Ga0070663_100889633 Ga0070663_1008896332 111
35 3300005456 Ga0070678_100748763 Ga0070678_1007487631 111
36 3300005466 Ga0070685_10161517 Ga0070685_101615172 111
37 3300005535 Ga0070684_101226282 Ga0070684_1012262821 111
38 3300005615 Ga0070702_101854928 Ga0070702_1018549282 111
39 3300005618 Ga0068864_100133940 Ga0068864_1001339403 111
40 3300005834 Ga0068851_11044398 Ga0068851_110443982 111
41 3300005840 Ga0068870_10217940 Ga0068870_102179402 111
42 3300005840 Ga0068870_11441148 Ga0068870_114411482 111
43 3300006038 Ga0075365_10034781 Ga0075365_100347812 111
44 3300006048 Ga0075363_100821622 Ga0075363_1008216222 111
45 3300009093 Ga0105240_10295529 Ga0105240_102955292 111
46 3300009101 Ga0105247_10054301 Ga0105247_100543014 111
47 3300009174 Ga0105241_10151323 Ga0105241_101513232 111
48 3300009177 Ga0105248_12595656 Ga0105248_125956561 111
49 3300009545 Ga0105237_11278189 Ga0105237_112781892 111
50 3300009551 Ga0105238_10466333 Ga0105238_104663332 111
51 3300009553 Ga0105249_10865007 Ga0105249_108650072 111
52 3300010375 Ga0105239_10081492 Ga0105239_100814926 111
53 3300011119 Ga0105246_11315612 Ga0105246_113156121 111
54 3300013105 Ga0157369_10886026 Ga0157369_108860262 111
55 3300013296 Ga0157374_10592412 Ga0157374_105924122 111
56 3300013308 Ga0157375_10987741 Ga0157375_109877412 111
57 3300013308 Ga0157375_11668220 Ga0157375_116682202 111
58 3300014326 Ga0157380_13279714 Ga0157380_132797142 111
59 3300014745 Ga0157377_11179417 Ga0157377_111794172 111
60 3300014968 Ga0157379_10998010 Ga0157379_109980103 111
61 3300017792 Ga0163161_10871216 Ga0163161_108712162 111
62 3300025900 Ga0207710_10367778 Ga0207710_103677782 111
63 3300025901 Ga0207688_10409747 Ga0207688_104097472 111
64 3300025903 Ga0207680_10287750 Ga0207680_102877502 111
65 3300025908 Ga0207643_10014234 Ga0207643_100142343 111
66 3300025909 Ga0207705_10831512 Ga0207705_108315122 111
67 3300025911 Ga0207654_10183282 Ga0207654_101832823 111
68 3300025918 Ga0207662_10020246 Ga0207662_100202463 111
69 3300025925 Ga0207650_10265741 Ga0207650_102657412 111
70 3300025926 Ga0207659_10736274 Ga0207659_107362742 111
71 3300025928 Ga0207700_10325492 Ga0207700_103254921 111
72 3300025929 Ga0207664_10706671 Ga0207664_107066712 111
73 3300025936 Ga0207670_10855997 Ga0207670_108559971 111
74 3300025936 Ga0207670_11868408 Ga0207670_118684082 111
75 3300025938 Ga0207704_11514464 Ga0207704_115144642 111
76 3300025939 Ga0207665_10693532 Ga0207665_106935322 111
77 3300025942 Ga0207689_10287007 Ga0207689_102870072 111
78 3300025944 Ga0207661_10116060 Ga0207661_101160602 111
79 3300025961 Ga0207712_11346226 Ga0207712_113462262 111
80 3300026035 Ga0207703_10773631 Ga0207703_107736312 111
81 3300026067 Ga0207678_10336995 Ga0207678_103369952 111
82 3300026078 Ga0207702_10287709 Ga0207702_102877092 111
83 3300026088 Ga0207641_10223902 Ga0207641_102239022 111
84 3300026116 Ga0207674_10187464 Ga0207674_101874642 111
85 3300026121 Ga0207683_10888671 Ga0207683_108886712 111
86 3300026142 Ga0207698_10103266 Ga0207698_101032662 111
87 3300027866 Ga0209813_10459000 Ga0209813_104590001 111
88 3300028379 Ga0268266_10142417 Ga0268266_101424172 111
89 3300028379 Ga0268266_10820556 Ga0268266_108205562 111
90 3300044694 Ga0466963_0135262 Ga0466963_0135262_1172_1534 111
91 3300044694 Ga0466963_0931343 Ga0466963_0931343_99_461 111
92 3300044842 Ga0466957_0327096 Ga0466957_0327096_243_605 111
93 3300045836 Ga0466958_0019898 Ga0466958_0019898_1999_2361 111
94 3300045976 Ga0466967_0391460 Ga0466967_0391460_136_498 111
95 3300048903 Ga0496100_0880807 Ga0496100_0880807_238_576 111
96 3300048913 Ga0496110_0716236 Ga0496110_0716236_320_655 111
97 3300048915 Ga0496112_1539007 Ga0496112_1539007_145_480 111
98 3300048918 Ga0496115_0101192 Ga0496115_0101192_204_542 111
99 3300050495 nmdc:mga04h51_493949_c1 nmdc:mga04h51_493949_c1_97_432 111
100 3300050511 nmdc:mga08y16_1905325_c1 nmdc:mga08y16_1905325_c1_20_355 111
101 3300053083 Ga0495655_0165323 Ga0495655_0165323_289_651 111
102 3300006051 Ga0075364_10001434 Ga0075364_1000143412 112
103 3300006186 Ga0075369_10109558 Ga0075369_101095582 112
104 3300025303 Ga0209051_1114236 Ga0209051_11142362 112
105 3300031548 Ga0307408_101610550 Ga0307408_1016105502 112
106 3300031852 Ga0307410_10144566 Ga0307410_101445662 112
107 3300031852 Ga0307410_10714016 Ga0307410_107140162 112
108 3300031901 Ga0307406_10171820 Ga0307406_101718202 112
109 3300031901 Ga0307406_10666314 Ga0307406_106663142 112
110 3300041410 Ga0439461_0000057 Ga0439461_0000057_7503_7850 112
111 3300041411 Ga0439466_0001478 Ga0439466_0001478_2572_2919 112
112 3300041413 Ga0439465_0028130 Ga0439465_0028130_952_1299 112
113 3300041997 Ga0439431_0000502 Ga0439431_0000502_4590_4937 112
114 3300044656 Ga0466969_0398615 Ga0466969_0398615_100_441 112
115 3300050491 nmdc:mga00v17_395469_c1 nmdc:mga00v17_395469_c1_333_674 112
116 3300050491 nmdc:mga00v17_6708_c1 nmdc:mga00v17_6708_c1_4229_4570 112
117 3300050494 nmdc:mga06z11_491073_c1 nmdc:mga06z11_491073_c1_347_688 112
118 3300050516 nmdc:mga0sz30_87848_c1 nmdc:mga0sz30_87848_c1_477_818 112
119 iso_pu_bacteria 2744054611 2744954408 112
120 3300005347 Ga0070668_100050475 Ga0070668_1000504753 113
121 3300005355 Ga0070671_100039829 Ga0070671_1000398295 113
122 3300005367 Ga0070667_100012854 Ga0070667_1000128543 113
123 3300005367 Ga0070667_100164775 Ga0070667_1001647752 113
124 3300005468 Ga0070707_102236583 Ga0070707_1022365831 113
125 3300005544 Ga0070686_100220964 Ga0070686_1002209642 113
126 3300005548 Ga0070665_100076003 Ga0070665_1000760032 113
127 3300005617 Ga0068859_100904618 Ga0068859_1009046182 113
128 3300005618 Ga0068864_100493567 Ga0068864_1004935672 113
129 3300005618 Ga0068864_102377347 Ga0068864_1023773472 113
130 3300005719 Ga0068861_102480132 Ga0068861_1024801322 113
131 3300005841 Ga0068863_100032817 Ga0068863_1000328172 113
132 3300005841 Ga0068863_100115967 Ga0068863_1001159674 113
133 3300005842 Ga0068858_100668373 Ga0068858_1006683732 113
134 3300006028 Ga0070717_11657673 Ga0070717_116576731 113
135 3300006038 Ga0075365_10149271 Ga0075365_101492712 113
136 3300006048 Ga0075363_100030212 Ga0075363_1000302124 113
137 3300006051 Ga0075364_10035870 Ga0075364_100358705 113
138 3300006051 Ga0075364_10226264 Ga0075364_102262642 113
139 3300006178 Ga0075367_10175959 Ga0075367_101759592 113
140 3300006178 Ga0075367_10189670 Ga0075367_101896701 113
141 3300006186 Ga0075369_10111607 Ga0075369_101116071 113
142 3300006353 Ga0075370_10002478 Ga0075370_1000247810 113
143 3300006353 Ga0075370_10052416 Ga0075370_100524162 113
144 3300006353 Ga0075370_10635065 Ga0075370_106350652 113
145 3300006353 Ga0075370_10760011 Ga0075370_107600112 113
146 3300006844 Ga0075428_100004846 Ga0075428_1000048464 113
147 3300006846 Ga0075430_100059757 Ga0075430_1000597573 113
148 3300006931 Ga0097620_100904754 Ga0097620_1009047542 113
149 3300009092 Ga0105250_10078910 Ga0105250_100789102 113
150 3300009147 Ga0114129_10005689 Ga0114129_1000568914 113
151 3300009553 Ga0105249_10024392 Ga0105249_100243925 113
152 3300010375 Ga0105239_11567011 Ga0105239_115670112 113
153 3300013306 Ga0163162_10519986 Ga0163162_105199862 113
154 3300025931 Ga0207644_10514373 Ga0207644_105143732 113
155 3300025961 Ga0207712_10164232 Ga0207712_101642323 113
156 3300025972 Ga0207668_10108657 Ga0207668_101086573 113
157 3300025986 Ga0207658_10024434 Ga0207658_100244345 113
158 3300025986 Ga0207658_10352205 Ga0207658_103522052 113
159 3300026035 Ga0207703_10632880 Ga0207703_106328802 113
160 3300026078 Ga0207702_12473870 Ga0207702_124738701 113
161 3300026088 Ga0207641_10026371 Ga0207641_100263712 113
162 3300026088 Ga0207641_10938073 Ga0207641_109380732 113
163 3300028379 Ga0268266_10062689 Ga0268266_100626892 113
164 3300028380 Ga0268265_10156026 Ga0268265_101560263 113
165 3300032126 Ga0307415_101084026 Ga0307415_1010840262 113
166 3300041410 Ga0439461_0031593 Ga0439461_0031593_294_635 113
167 3300041411 Ga0439466_0007929 Ga0439466_0007929_2108_2449 113
168 3300041413 Ga0439465_0000439 Ga0439465_0000439_6693_7034 113
169 3300042002 Ga0439442_034931 Ga0439442_034931_552_893 113
170 3300042435 Ga0439434_0257913 Ga0439434_0257913_155_496 113
171 3300044658 Ga0466972_0023340 Ga0466972_0023340_321_662 113
172 3300044658 Ga0466972_0026448 Ga0466972_0026448_2292_2633 113
173 3300044658 Ga0466972_0031868 Ga0466972_0031868_1771_2112 113
174 3300044683 Ga0466965_0052361 Ga0466965_0052361_1118_1459 113
175 3300044735 Ga0466968_0055795 Ga0466968_0055795_1128_1469 113
176 3300044901 Ga0466960_0000122 Ga0466960_0000122_15488_15829 113
177 3300045976 Ga0466967_2572766 Ga0466967_2572766_23_364 113
178 3300048903 Ga0496100_0266589 Ga0496100_0266589_697_1038 113
179 3300048904 Ga0496101_0446541 Ga0496101_0446541_333_674 113
180 3300048904 Ga0496101_1315002 Ga0496101_1315002_179_520 113
181 3300048905 Ga0496102_0004697 Ga0496102_0004697_7028_7369 113
182 3300048905 Ga0496102_0076178 Ga0496102_0076178_1386_1727 113
183 3300048906 Ga0496103_0185552 Ga0496103_0185552_546_887 113
184 3300048907 Ga0496104_0078845 Ga0496104_0078845_292_633 113
185 3300048908 Ga0496105_0166989 Ga0496105_0166989_987_1328 113
186 3300048909 Ga0496106_0278097 Ga0496106_0278097_721_1062 113
187 3300048911 Ga0496108_0036265 Ga0496108_0036265_412_753 113
188 3300048912 Ga0496109_0019118 Ga0496109_0019118_4455_4796 113
189 3300048912 Ga0496109_1130573 Ga0496109_1130573_152_493 113
190 3300048913 Ga0496110_0016422 Ga0496110_0016422_5115_5456 113
191 3300048913 Ga0496110_0539931 Ga0496110_0539931_106_447 113
192 3300048914 Ga0496111_0065077 Ga0496111_0065077_1047_1388 113
193 3300048915 Ga0496112_0491178 Ga0496112_0491178_758_1099 113
194 3300048916 Ga0496113_0169866 Ga0496113_0169866_437_778 113
195 3300048917 Ga0496114_1412623 Ga0496114_1412623_47_388 113
196 3300048919 Ga0496116_0297327 Ga0496116_0297327_235_576 113
197 3300049581 Ga0501047_0471827 Ga0501047_0471827_189_530 113
198 3300049583 Ga0501067_0139531 Ga0501067_0139531_645_1004 113
199 3300050490 nmdc:mga03n38_49426_c1 nmdc:mga03n38_49426_c1_1257_1598 113
200 3300050492 nmdc:mga0yw44_297256_c1 nmdc:mga0yw44_297256_c1_131_472 113
201 3300050494 nmdc:mga06z11_124318_c1 nmdc:mga06z11_124318_c1_228_569 113
202 3300050494 nmdc:mga06z11_549848_c1 nmdc:mga06z11_549848_c1_282_623 113
203 3300050496 nmdc:mga07m45_65095_c1 nmdc:mga07m45_65095_c1_1404_1745 113
204 3300050507 nmdc:mga05p37_6360_c1 nmdc:mga05p37_6360_c1_1039_1380 113
205 3300050509 nmdc:mga0qj67_1481843_c1 nmdc:mga0qj67_1481843_c1_36_377 113
206 3300050509 nmdc:mga0qj67_28056_c1 nmdc:mga0qj67_28056_c1_1802_2143 113
207 3300059478 Ga0587093_001174 Ga0587093_001174_1533_1892 113
208 3300059490 Ga0587066_007940 Ga0587066_007940_708_1067 113
209 3300059491 Ga0587070_012298 Ga0587070_012298_239_598 113
210 3300059493 Ga0587077_010762 Ga0587077_010762_773_1132 113
211 3300059505 Ga0587083_0036723 Ga0587083_0036723_492_851 113
212 3300059506 Ga0587085_001870 Ga0587085_001870_1338_1697 113
213 3300059507 Ga0587086_014953 Ga0587086_014953_603_962 113
214 3300059509 Ga0587089_003635 Ga0587089_003635_586_945 113
215 3300059512 Ga0587092_010094 Ga0587092_010094_569_928 113
216 3300059513 Ga0587094_004307 Ga0587094_004307_389_748 113
217 3300059623 Ga0587101_007846 Ga0587101_007846_730_1089 113
218 3300059624 Ga0587109_014559 Ga0587109_014559_723_1082 113
219 3300059626 Ga0587115_011462 Ga0587115_011462_520_879 113
220 3300059630 Ga0587128_008311 Ga0587128_008311_791_1150 113
221 3300059640 Ga0587067_011757 Ga0587067_011757_288_647 113
222 3300059643 Ga0587072_004675 Ga0587072_004675_41_400 113
223 3300059645 Ga0587076_013838 Ga0587076_013838_171_530 113
224 3300059652 Ga0587107_017108 Ga0587107_017108_439_798 113
225 3300005353 Ga0070669_100060942 Ga0070669_1000609422 114
226 3300005367 Ga0070667_100000087 Ga0070667_100000087100 114
227 3300005548 Ga0070665_100056878 Ga0070665_1000568782 114
228 3300005617 Ga0068859_100000291 Ga0068859_10000029137 114
229 3300005618 Ga0068864_100503857 Ga0068864_1005038572 114
230 3300005841 Ga0068863_100010649 Ga0068863_1000106497 114
231 3300005842 Ga0068858_100511701 Ga0068858_1005117011 114
232 3300005843 Ga0068860_100000020 Ga0068860_100000020254 114
233 3300005844 Ga0068862_100000013 Ga0068862_100000013238 114
234 3300006931 Ga0097620_100000291 Ga0097620_10000029137 114
235 3300009101 Ga0105247_10000009 Ga0105247_10000009357 114
236 3300009177 Ga0105248_10000207 Ga0105248_1000020753 114
237 3300009553 Ga0105249_10000057 Ga0105249_10000057140 114
238 3300010159 Ga0099796_10372947 Ga0099796_103729471 114
239 3300013306 Ga0163162_10027127 Ga0163162_100271273 114
240 3300014968 Ga0157379_10202170 Ga0157379_102021702 114
241 3300025900 Ga0207710_10000014 Ga0207710_10000014373 114
242 3300025923 Ga0207681_10009454 Ga0207681_100094546 114
243 3300025941 Ga0207711_10000242 Ga0207711_1000024250 114
244 3300025961 Ga0207712_10000050 Ga0207712_1000005017 114
245 3300025972 Ga0207668_10142883 Ga0207668_101428834 114
246 3300025986 Ga0207658_10000065 Ga0207658_1000006598 114
247 3300025986 Ga0207658_10000557 Ga0207658_1000055714 114
248 3300026035 Ga0207703_10168866 Ga0207703_101688662 114
249 3300026088 Ga0207641_10000740 Ga0207641_1000074033 114
250 3300026095 Ga0207676_10441892 Ga0207676_104418922 114
251 3300026118 Ga0207675_101211234 Ga0207675_1012112342 114
252 3300028379 Ga0268266_10009738 Ga0268266_100097382 114
253 3300028380 Ga0268265_10000004 Ga0268265_1000000415 114
254 3300028381 Ga0268264_10000024 Ga0268264_1000002416 114
255 3300045976 Ga0466967_0001060 Ga0466967_0001060_994_1353 114
256 3300048903 Ga0496100_0017984 Ga0496100_0017984_3273_3620 114
257 3300048905 Ga0496102_0000718 Ga0496102_0000718_12266_12613 114
258 3300048906 Ga0496103_0000630 Ga0496103_0000630_1075_1422 114
259 3300048909 Ga0496106_0141577 Ga0496106_0141577_588_935 114
260 3300048910 Ga0496107_0028122 Ga0496107_0028122_3603_3950 114
261 3300048912 Ga0496109_0105288 Ga0496109_0105288_715_1062 114
262 3300048917 Ga0496114_1118971 Ga0496114_1118971_79_429 114
263 3300048919 Ga0496116_0009817 Ga0496116_0009817_591_938 114
264 3300048920 Ga0496117_0001462 Ga0496117_0001462_21404_21751 114
265 3300048921 Ga0496118_0002617 Ga0496118_0002617_10449_10796 114
266 3300048922 Ga0496119_0037605 Ga0496119_0037605_2516_2863 114
267 3300048923 Ga0496120_0006562 Ga0496120_0006562_7056_7403 114
268 3300048924 Ga0496121_0002393 Ga0496121_0002393_16023_16370 114
269 3300048927 Ga0496124_0406236 Ga0496124_0406236_329_676 114
270 3300048928 Ga0496125_0014032 Ga0496125_0014032_4156_4503 114
271 3300048929 Ga0496126_0011652 Ga0496126_0011652_8288_8635 114
272 3300049571 Ga0501034_0117846 Ga0501034_0117846_1791_2150 114
273 3300005329 Ga0070683_100169512 Ga0070683_1001695123 115
274 3300005337 Ga0070682_100028848 Ga0070682_1000288485 115
275 3300005345 Ga0070692_10261556 Ga0070692_102615562 115
276 3300005355 Ga0070671_100166305 Ga0070671_1001663053 115
277 3300005364 Ga0070673_100333189 Ga0070673_1003331892 115
278 3300005535 Ga0070684_100221648 Ga0070684_1002216482 115
279 3300005548 Ga0070665_100763764 Ga0070665_1007637642 115
280 3300006048 Ga0075363_100000172 Ga0075363_10000017222 115
281 3300006048 Ga0075363_100222118 Ga0075363_1002221182 115
282 3300009094 Ga0111539_10324418 Ga0111539_103244183 115
283 3300009148 Ga0105243_11814448 Ga0105243_118144481 115
284 3300010375 Ga0105239_10106552 Ga0105239_101065522 115
285 3300011119 Ga0105246_10688737 Ga0105246_106887372 115
286 3300013296 Ga0157374_10482456 Ga0157374_104824562 115
287 3300013297 Ga0157378_11810546 Ga0157378_118105461 115
288 3300014325 Ga0163163_10131869 Ga0163163_101318692 115
289 3300025935 Ga0207709_10701851 Ga0207709_107018511 115
290 3300025944 Ga0207661_10270274 Ga0207661_102702742 115
291 3300025981 Ga0207640_10074644 Ga0207640_100746443 115
292 3300041512 Ga0451853_3930057 Ga0451853_3930057_491_871 115
293 3300044719 Ga0466971_0003835 Ga0466971_0003835_4256_4624 115
294 3300045836 Ga0466958_0194194 Ga0466958_0194194_725_1093 115
295 3300047472 Ga0495686_0615793 Ga0495686_0615793_20_400 115
296 3300048905 Ga0496102_1740814 Ga0496102_1740814_80_460 115
297 3300048912 Ga0496109_0176751 Ga0496109_0176751_268_648 115
298 3300048913 Ga0496110_0415501 Ga0496110_0415501_483_863 115
299 3300048914 Ga0496111_0092801 Ga0496111_0092801_693_1073 115
300 3300048915 Ga0496112_0038084 Ga0496112_0038084_2578_2958 115
301 3300049581 Ga0501047_0390668 Ga0501047_0390668_403_774 115
302 3300049586 Ga0501070_0063913 Ga0501070_0063913_2045_2401 115
303 3300049823 Ga0501044_0090925 Ga0501044_0090925_1792_2163 115
304 3300050490 nmdc:mga03n38_375218_c1 nmdc:mga03n38_375218_c1_146_523 115
305 3300050490 nmdc:mga03n38_6642_c1 nmdc:mga03n38_6642_c1_3426_3806 115
306 3300050511 nmdc:mga08y16_1778236_c1 nmdc:mga08y16_1778236_c1_59_439 115
307 3300053083 Ga0495655_0017771 Ga0495655_0017771_427_807 115
308 3300053083 Ga0495655_0278751 Ga0495655_0278751_46_426 115
309 3300001978 JGI24747J21853_1004755 JGI24747J21853_10047552 116
310 3300001989 JGI24739J22299_10050493 JGI24739J22299_100504933 116
311 3300001991 JGI24743J22301_10067546 JGI24743J22301_100675462 116
312 3300002070 JGI24750J21931_1020482 JGI24750J21931_10204822 116
313 3300002074 JGI24748J21848_1005820 JGI24748J21848_10058202 116
314 3300002075 JGI24738J21930_10012597 JGI24738J21930_100125974 116
315 3300002076 JGI24749J21850_1013443 JGI24749J21850_10134432 116
316 3300002077 JGI24744J21845_10000053 JGI24744J21845_100000535 116
317 3300002239 JGI24034J26672_10003514 JGI24034J26672_100035144 116
318 3300002244 JGI24742J22300_10001182 JGI24742J22300_100011825 116
319 3300005328 Ga0070676_10056914 Ga0070676_100569143 116
320 3300005330 Ga0070690_100001292 Ga0070690_10000129210 116
321 3300005335 Ga0070666_10096116 Ga0070666_100961162 116
322 3300005337 Ga0070682_100001916 Ga0070682_10000191611 116
323 3300005338 Ga0068868_100009639 Ga0068868_1000096399 116
324 3300005338 Ga0068868_100101718 Ga0068868_1001017184 116
325 3300005339 Ga0070660_100224324 Ga0070660_1002243242 116
326 3300005340 Ga0070689_100018207 Ga0070689_1000182073 116
327 3300005341 Ga0070691_10001466 Ga0070691_100014663 116
328 3300005343 Ga0070687_100652949 Ga0070687_1006529491 116
329 3300005344 Ga0070661_100932625 Ga0070661_1009326252 116
330 3300005345 Ga0070692_10272579 Ga0070692_102725792 116
331 3300005347 Ga0070668_100000358 Ga0070668_10000035823 116
332 3300005347 Ga0070668_100206394 Ga0070668_1002063943 116
333 3300005353 Ga0070669_100091561 Ga0070669_1000915612 116
334 3300005354 Ga0070675_100827050 Ga0070675_1008270501 116
335 3300005355 Ga0070671_100126954 Ga0070671_1001269542 116
336 3300005356 Ga0070674_100003807 Ga0070674_10000380711 116
337 3300005365 Ga0070688_100002128 Ga0070688_1000021285 116
338 3300005366 Ga0070659_100063532 Ga0070659_1000635323 116
339 3300005367 Ga0070667_100004048 Ga0070667_1000040487 116
340 3300005434 Ga0070709_10046065 Ga0070709_100460652 116
341 3300005438 Ga0070701_10004264 Ga0070701_100042644 116
342 3300005439 Ga0070711_100063796 Ga0070711_1000637965 116
343 3300005440 Ga0070705_100025323 Ga0070705_1000253234 116
344 3300005441 Ga0070700_100014110 Ga0070700_1000141103 116
345 3300005444 Ga0070694_100008986 Ga0070694_1000089862 116
346 3300005445 Ga0070708_100229862 Ga0070708_1002298623 116
347 3300005455 Ga0070663_100002640 Ga0070663_1000026405 116
348 3300005456 Ga0070678_100001197 Ga0070678_1000011971 116
349 3300005457 Ga0070662_100010769 Ga0070662_1000107699 116
350 3300005459 Ga0068867_100006287 Ga0068867_1000062871 116
351 3300005468 Ga0070707_100338797 Ga0070707_1003387972 116
352 3300005539 Ga0068853_100051687 Ga0068853_1000516873 116
353 3300005545 Ga0070695_100040554 Ga0070695_1000405542 116
354 3300005546 Ga0070696_100003435 Ga0070696_1000034359 116
355 3300005547 Ga0070693_100009575 Ga0070693_1000095752 116
356 3300005548 Ga0070665_100006380 Ga0070665_1000063805 116
357 3300005548 Ga0070665_102010997 Ga0070665_1020109972 116
358 3300005549 Ga0070704_100000391 Ga0070704_10000039113 116
359 3300005578 Ga0068854_100004672 Ga0068854_1000046726 116
360 3300005617 Ga0068859_100003251 Ga0068859_1000032515 116
361 3300005718 Ga0068866_10002931 Ga0068866_100029314 116
362 3300005719 Ga0068861_100120570 Ga0068861_1001205704 116
363 3300005842 Ga0068858_100001109 Ga0068858_1000011095 116
364 3300005843 Ga0068860_100012429 Ga0068860_10001242911 116
365 3300005844 Ga0068862_100001869 Ga0068862_10000186910 116
366 3300006038 Ga0075365_10035069 Ga0075365_100350695 116
367 3300006048 Ga0075363_100010009 Ga0075363_1000100097 116
368 3300006048 Ga0075363_100062936 Ga0075363_1000629363 116
369 3300006048 Ga0075363_100068300 Ga0075363_1000683002 116
370 3300006048 Ga0075363_100275800 Ga0075363_1002758002 116
371 3300006051 Ga0075364_10005507 Ga0075364_100055074 116
372 3300006051 Ga0075364_10006448 Ga0075364_100064482 116
373 3300006051 Ga0075364_10010211 Ga0075364_100102112 116
374 3300006051 Ga0075364_10099430 Ga0075364_100994303 116
375 3300006051 Ga0075364_10258628 Ga0075364_102586282 116
376 3300006163 Ga0070715_10013054 Ga0070715_100130543 116
377 3300006173 Ga0070716_100001115 Ga0070716_1000011159 116
378 3300006175 Ga0070712_100040073 Ga0070712_1000400734 116
379 3300006177 Ga0075362_10092326 Ga0075362_100923262 116
380 3300006177 Ga0075362_10220104 Ga0075362_102201042 116
381 3300006178 Ga0075367_10015484 Ga0075367_100154845 116
382 3300006178 Ga0075367_10066386 Ga0075367_100663863 116
383 3300006186 Ga0075369_10035202 Ga0075369_100352023 116
384 3300006186 Ga0075369_10139195 Ga0075369_101391952 116
385 3300006186 Ga0075369_10184586 Ga0075369_101845862 116
386 3300006237 Ga0097621_100025123 Ga0097621_1000251232 116
387 3300006353 Ga0075370_10003387 Ga0075370_100033874 116
388 3300006353 Ga0075370_10004197 Ga0075370_100041978 116
389 3300006353 Ga0075370_10018671 Ga0075370_100186713 116
390 3300006353 Ga0075370_10356640 Ga0075370_103566401 116
391 3300006844 Ga0075428_101748152 Ga0075428_1017481522 116
392 3300006931 Ga0097620_100003251 Ga0097620_1000032515 116
393 3300007788 Ga0099795_10034371 Ga0099795_100343712 116
394 3300009093 Ga0105240_11044593 Ga0105240_110445932 116
395 3300009094 Ga0111539_11466491 Ga0111539_114664912 116
396 3300009098 Ga0105245_10002903 Ga0105245_1000290317 116
397 3300009101 Ga0105247_10000366 Ga0105247_1000036630 116
398 3300009148 Ga0105243_10001450 Ga0105243_1000145016 116
399 3300009174 Ga0105241_10101337 Ga0105241_101013373 116
400 3300009176 Ga0105242_10004714 Ga0105242_100047145 116
401 3300009176 Ga0105242_11760822 Ga0105242_117608222 116
402 3300009177 Ga0105248_10002194 Ga0105248_1000219414 116
403 3300009545 Ga0105237_10025835 Ga0105237_100258354 116
404 3300009551 Ga0105238_10312659 Ga0105238_103126593 116
405 3300009553 Ga0105249_10007809 Ga0105249_100078096 116
406 3300010159 Ga0099796_10338704 Ga0099796_103387042 116
407 3300010375 Ga0105239_10152069 Ga0105239_101520695 116
408 3300011119 Ga0105246_10592450 Ga0105246_105924502 116
409 3300013296 Ga0157374_10403274 Ga0157374_104032742 116
410 3300013297 Ga0157378_10001442 Ga0157378_100014429 116
411 3300013306 Ga0163162_10002768 Ga0163162_100027687 116
412 3300013307 Ga0157372_10009077 Ga0157372_100090775 116
413 3300013308 Ga0157375_10001272 Ga0157375_1000127217 116
414 3300014326 Ga0157380_10000302 Ga0157380_1000030224 116
415 3300014745 Ga0157377_10496193 Ga0157377_104961932 116
416 3300014968 Ga0157379_10045701 Ga0157379_100457014 116
417 3300017792 Ga0163161_10000799 Ga0163161_1000079914 116
418 3300025898 Ga0207692_10030153 Ga0207692_100301534 116
419 3300025899 Ga0207642_10000143 Ga0207642_1000014316 116
420 3300025900 Ga0207710_10001961 Ga0207710_1000196111 116
421 3300025901 Ga0207688_10000090 Ga0207688_1000009030 116
422 3300025903 Ga0207680_10027001 Ga0207680_100270012 116
423 3300025904 Ga0207647_10069287 Ga0207647_100692872 116
424 3300025905 Ga0207685_10005331 Ga0207685_100053315 116
425 3300025906 Ga0207699_10012071 Ga0207699_100120716 116
426 3300025911 Ga0207654_10101003 Ga0207654_101010032 116
427 3300025915 Ga0207693_10000555 Ga0207693_100005555 116
428 3300025916 Ga0207663_10002170 Ga0207663_1000217011 116
429 3300025918 Ga0207662_10057811 Ga0207662_100578112 116
430 3300025921 Ga0207652_10460070 Ga0207652_104600702 116
431 3300025923 Ga0207681_10219736 Ga0207681_102197362 116
432 3300025927 Ga0207687_10158624 Ga0207687_101586244 116
433 3300025931 Ga0207644_10170369 Ga0207644_101703692 116
434 3300025932 Ga0207690_10032665 Ga0207690_100326653 116
435 3300025933 Ga0207706_10016540 Ga0207706_100165403 116
436 3300025934 Ga0207686_10001099 Ga0207686_1000109911 116
437 3300025935 Ga0207709_10002258 Ga0207709_1000225811 116
438 3300025936 Ga0207670_10029755 Ga0207670_100297555 116
439 3300025937 Ga0207669_10000752 Ga0207669_1000075212 116
440 3300025938 Ga0207704_10000393 Ga0207704_100003934 116
441 3300025939 Ga0207665_10003000 Ga0207665_100030009 116
442 3300025941 Ga0207711_10012688 Ga0207711_100126882 116
443 3300025961 Ga0207712_10046835 Ga0207712_100468353 116
444 3300025961 Ga0207712_10699648 Ga0207712_106996481 116
445 3300025972 Ga0207668_10005693 Ga0207668_100056932 116
446 3300025981 Ga0207640_10174993 Ga0207640_101749932 116
447 3300025986 Ga0207658_10002082 Ga0207658_1000208212 116
448 3300026023 Ga0207677_10003455 Ga0207677_100034551 116
449 3300026035 Ga0207703_10044415 Ga0207703_100444155 116
450 3300026041 Ga0207639_10003107 Ga0207639_100031073 116
451 3300026067 Ga0207678_10011227 Ga0207678_100112274 116
452 3300026075 Ga0207708_10006978 Ga0207708_1000697810 116
453 3300026089 Ga0207648_10000349 Ga0207648_1000034927 116
454 3300026118 Ga0207675_100006409 Ga0207675_1000064098 116
455 3300026121 Ga0207683_10000040 Ga0207683_1000004058 116
456 3300027512 Ga0209179_1016712 Ga0209179_10167122 116
457 3300028380 Ga0268265_10005589 Ga0268265_100055893 116
458 3300028381 Ga0268264_10225825 Ga0268264_102258254 116
459 3300031824 Ga0307413_10052844 Ga0307413_100528442 116
460 3300031824 Ga0307413_10279750 Ga0307413_102797502 116
461 3300031852 Ga0307410_10034781 Ga0307410_100347815 116
462 3300031852 Ga0307410_12026189 Ga0307410_120261891 116
463 3300031903 Ga0307407_10042717 Ga0307407_100427174 116
464 3300031995 Ga0307409_100038157 Ga0307409_1000381574 116
465 3300031995 Ga0307409_100041086 Ga0307409_1000410865 116
466 3300032002 Ga0307416_100006772 Ga0307416_1000067724 116
467 3300032005 Ga0307411_10019423 Ga0307411_100194235 116
468 3300032005 Ga0307411_11284546 Ga0307411_112845462 116
469 3300032126 Ga0307415_100148578 Ga0307415_1001485784 116
470 3300032126 Ga0307415_101941370 Ga0307415_1019413702 116
471 3300035084 Ga0373928_0108852 Ga0373928_0108852_60_410 116
472 3300035085 Ga0373929_0135978 Ga0373929_0135978_15_365 116
473 3300035092 Ga0373952_0108006 Ga0373952_0108006_72_422 116
474 3300035114 Ga0373939_0177774 Ga0373939_0177774_372_722 116
475 3300035691 Ga0373931_0066239 Ga0373931_0066239_876_1226 116
476 3300037418 Ga0395900_1366347 Ga0395900_1366347_118_489 116
477 3300041411 Ga0439466_0005991 Ga0439466_0005991_2038_2388 116
478 3300041413 Ga0439465_0009138 Ga0439465_0009138_181_531 116
479 3300041997 Ga0439431_0001548 Ga0439431_0001548_1078_1428 116
480 3300042435 Ga0439434_0021913 Ga0439434_0021913_523_873 116
481 3300044656 Ga0466969_0013120 Ga0466969_0013120_1411_1776 116
482 3300045976 Ga0466967_0275615 Ga0466967_0275615_284_658 116
483 3300048903 Ga0496100_0005195 Ga0496100_0005195_3166_3516 116
484 3300048904 Ga0496101_0002316 Ga0496101_0002316_3461_3811 116
485 3300048905 Ga0496102_0000600 Ga0496102_0000600_4365_4715 116
486 3300048905 Ga0496102_0474172 Ga0496102_0474172_617_988 116
487 3300048906 Ga0496103_0000667 Ga0496103_0000667_11315_11665 116
488 3300048909 Ga0496106_0006021 Ga0496106_0006021_8186_8536 116
489 3300048910 Ga0496107_0002661 Ga0496107_0002661_4287_4637 116
490 3300048915 Ga0496112_0362996 Ga0496112_0362996_700_1089 116
491 3300048917 Ga0496114_0001610 Ga0496114_0001610_443_793 116
492 3300048918 Ga0496115_0264715 Ga0496115_0264715_61_411 116
493 3300050490 nmdc:mga03n38_116519_c1 nmdc:mga03n38_116519_c1_929_1294 116
494 3300050490 nmdc:mga03n38_16746_c1 nmdc:mga03n38_16746_c1_2023_2379 116
495 3300050490 nmdc:mga03n38_200767_c1 nmdc:mga03n38_200767_c1_118_483 116
496 3300050490 nmdc:mga03n38_46186_c1 nmdc:mga03n38_46186_c1_400_765 116
497 3300050490 nmdc:mga03n38_91288_c1 nmdc:mga03n38_91288_c1_270_632 116
498 3300050491 nmdc:mga00v17_146087_c1 nmdc:mga00v17_146087_c1_720_1085 116
499 3300050491 nmdc:mga00v17_263175_c1 nmdc:mga00v17_263175_c1_488_850 116
500 3300050491 nmdc:mga00v17_34555_c1 nmdc:mga00v17_34555_c1_1193_1558 116
501 3300050491 nmdc:mga00v17_610_c1 nmdc:mga00v17_610_c1_2973_3338 116
502 3300050491 nmdc:mga00v17_7742_c1 nmdc:mga00v17_7742_c1_3135_3491 116
503 3300050492 nmdc:mga0yw44_17411_c1 nmdc:mga0yw44_17411_c1_982_1338 116
504 3300050492 nmdc:mga0yw44_327465_c1 nmdc:mga0yw44_327465_c1_339_704 116
505 3300050493 nmdc:mga0k408_319481_c1 nmdc:mga0k408_319481_c1_232_588 116
506 3300050494 nmdc:mga06z11_186990_c1 nmdc:mga06z11_186990_c1_182_538 116
507 3300050494 nmdc:mga06z11_433152_c1 nmdc:mga06z11_433152_c1_108_473 116
508 3300050494 nmdc:mga06z11_47584_c1 nmdc:mga06z11_47584_c1_287_649 116
509 3300050496 nmdc:mga07m45_11942_c1 nmdc:mga07m45_11942_c1_1921_2286 116
510 3300050496 nmdc:mga07m45_161982_c1 nmdc:mga07m45_161982_c1_843_1205 116
511 3300050496 nmdc:mga07m45_26078_c1 nmdc:mga07m45_26078_c1_1723_2079 116
512 3300050516 nmdc:mga0sz30_119441_c1 nmdc:mga0sz30_119441_c1_661_1026 116
513 3300050516 nmdc:mga0sz30_138275_c1 nmdc:mga0sz30_138275_c1_385_750 116
514 3300050516 nmdc:mga0sz30_149127_c1 nmdc:mga0sz30_149127_c1_553_909 116

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21006

NHase_beta_N

Nitrile hydratase beta subunit, N-terminal

21

130

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1v29-assembly1.cif.gz_B-2 crystal structure of nitrile hydratase from a thermophile bacillus smithii 0.544 31 116
7w8m-assembly1.cif.gz_B-2 crystal structure of co-type nitrile hydratase mutant from pseudomonas thermophila - a129r 0.5373 31 116
1ire-assembly1.cif.gz_B crystal structure of co-type nitrile hydratase from pseudonocardia thermophila 0.5363 31 116
2dd4-assembly1.cif.gz_H thiocyanate hydrolase (scnase) from thiobacillus thioparus recombinant apo-enzyme 0.5219 29 115
7s5b-assembly2.cif.gz_B unbound state of a de novo designed protein binder to the human interleukin-7 receptor 0.493 63 116
ID Description Score Start End Superfamily
3hhtB01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Nitrile hydratase, beta subunit 0.5662 33 116 1.10.472.20
1ireB01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Nitrile hydratase, beta subunit 0.5363 31 116 1.10.472.20
2ahjD01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Nitrile hydratase, beta subunit 0.518 30 109 1.10.472.20
4nsrD00 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.4512 37 111 1.10.8.1160
3hhtB01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Nitrile hydratase, beta subunit 0.4422 33 116 1.10.472.20
ID Description Score Start End GO Terms
AF-A0A7I7NIM5-F1-model_v4 Nitrile hydratase beta subunit-like N-terminal domain-containing protein 0.9102 53 116
AF-A0A7I7NIM5-F1-model_v4 Nitrile hydratase beta subunit-like N-terminal domain-containing protein 0.8256 53 116
AF-A0A6H0S665-F1-model_v4 Thiocyanate hydrolase 0.7663 5 116 GO:0016787
AF-A0A1J0VV66-F1-model_v4 Thiocyanate hydrolase 0.7601 3 116 GO:0016787
AF-A0A3B0Z942-F1-model_v4 Thiocyanate hydrolase subunit beta 0.7585 4 114

Feature Viewer

pLDDT pTM Quality
75.95 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map