F457672

General Info

Members Datasets Scaffolds Average Seq Length
514 258 1028 107

Family's Representative Sequence

Representative Sequence 3300005343|Ga0070687_100002971|Ga0070687_1000029715
Length 121
Sequence VPLWLSSLRDREYNHAMRVVNRTAVTITGGQPYLDWMHQTDSDFNRDGVTVVVPRVKAYGSAFLLPEFDLEEDLHEWVEENAAWLFEPPTRDLKTFKQWFRIDIHSVVVDVGDDDIEGEEL

Samples

Sample ID Description Type Environment
1 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
2 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
166 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
167 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
168 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
169 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
170 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
171 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
172 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
173 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
174 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
175 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
176 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
178 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
179 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
180 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
181 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
182 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
183 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
184 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
185 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
186 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
187 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
188 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
189 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
190 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
192 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
196 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
197 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
198 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
199 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
200 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
201 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
202 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
203 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
204 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
205 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
206 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
207 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
208 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
209 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
210 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
211 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
212 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
213 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
214 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
215 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
216 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
217 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
218 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
219 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
220 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
221 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
222 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
223 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
224 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
225 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
226 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
227 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
228 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
229 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
230 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
231 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
232 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
233 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
234 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
235 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
236 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
237 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
238 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
239 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
240 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
245 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
246 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
247 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
248 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
249 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
250 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
251 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
252 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
253 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
254 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
255 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
256 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
257 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
258 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0.39
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.7
Rhizosphere 96.3
Stem 0
Stem Tuber 0
Unclassified 34.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070687_100002971 3300005343 Bacteria 6504
2 Ga0058861_11184094 3300004800 Unclassified 552
3 Ga0065714_10432667 3300005288 Unclassified 566
4 Ga0065704_10409081 3300005289 Unclassified 743
5 Ga0065712_10108102 3300005290 Unclassified 1880
6 Ga0065715_10425725 3300005293 Bacteria 853
7 Ga0065715_10480993 3300005293 Bacteria 797
8 Ga0065707_10105170 3300005295 Bacteria 2658
9 Ga0070658_10130073 3300005327 Unclassified 2097
10 Ga0070676_10324712 3300005328 Unclassified 1051
11 Ga0070676_10822441 3300005328 Bacteria 687
12 Ga0070683_100056015 3300005329 Bacteria 3660
13 Ga0070683_100222424 3300005329 Bacteria 1794
14 Ga0070683_102119885 3300005329 Unclassified 540
15 Ga0070670_100261998 3300005331 Unclassified 1507
16 Ga0070670_101051819 3300005331 Bacteria 741
17 Ga0070677_10007010 3300005333 Bacteria 3749
18 Ga0068869_100231128 3300005334 Bacteria 1469
19 Ga0068869_100775320 3300005334 Unclassified 822
20 Ga0068869_101272541 3300005334 Bacteria 648
21 Ga0070666_10008768 3300005335 Bacteria 6287
22 Ga0070666_10064841 3300005335 Unclassified 2478
23 Ga0070680_100021059 3300005336 Bacteria 5179
24 Ga0070682_101808029 3300005337 Unclassified 533
25 Ga0068868_100228022 3300005338 Unclassified 1562
26 Ga0068868_101102678 3300005338 Unclassified 730
27 Ga0068868_101936076 3300005338 Unclassified 559
28 Ga0070689_100069023 3300005340 Bacteria 2757
29 Ga0070691_10786340 3300005341 Bacteria 578
30 Ga0070687_100249385 3300005343 Bacteria 1102
31 Ga0070687_100480968 3300005343 Unclassified 832
32 Ga0070661_100179025 3300005344 Bacteria 1612
33 Ga0070661_100847887 3300005344 Unclassified 752
34 Ga0070661_101868354 3300005344 Unclassified 510
35 Ga0070668_100036858 3300005347 Bacteria 3732
36 Ga0070668_102272149 3300005347 Unclassified 501
37 Ga0070669_100039664 3300005353 Bacteria 3422
38 Ga0070669_101756372 3300005353 Unclassified 541
39 Ga0070675_100163000 3300005354 Bacteria 1918
40 Ga0070675_100258319 3300005354 Bacteria 1526
41 Ga0070675_101358526 3300005354 Unclassified 655
42 Ga0070671_100515594 3300005355 Unclassified 1029
43 Ga0070671_100887243 3300005355 Unclassified 779
44 Ga0070674_100050319 3300005356 Unclassified 2868
45 Ga0070674_100065233 3300005356 Bacteria 2555
46 Ga0070674_100077546 3300005356 Bacteria 2366
47 Ga0070673_100032054 3300005364 Bacteria 3951
48 Ga0070673_100327812 3300005364 Bacteria 1354
49 Ga0070673_100364040 3300005364 Bacteria 1286
50 Ga0070673_100366862 3300005364 Unclassified 1281
51 Ga0070688_100224338 3300005365 Unclassified 1326
52 Ga0070659_101283950 3300005366 Bacteria 649
53 Ga0070667_100134494 3300005367 Bacteria 2161
54 Ga0070709_10016431 3300005434 Bacteria 4225
55 Ga0070713_100794809 3300005436 Bacteria 907
56 Ga0070701_10271994 3300005438 Unclassified 1031
57 Ga0070705_100540445 3300005440 Bacteria 891
58 Ga0070705_100829243 3300005440 Unclassified 738
59 Ga0070700_100254700 3300005441 Unclassified 1261
60 Ga0070694_100040919 3300005444 Bacteria 3090
61 Ga0070694_100257249 3300005444 Bacteria 1323
62 Ga0070694_100630016 3300005444 Bacteria 866
63 Ga0070694_101264533 3300005444 Unclassified 620
64 Ga0070708_100676642 3300005445 Unclassified 972
65 Ga0070708_101906033 3300005445 Bacteria 551
66 Ga0070678_100008709 3300005456 Bacteria 6093
67 Ga0070678_100299006 3300005456 Unclassified 1367
68 Ga0070662_101989777 3300005457 Unclassified 502
69 Ga0070681_10018894 3300005458 Bacteria 6896
70 Ga0070681_10109548 3300005458 Bacteria 2701
71 Ga0068867_101489789 3300005459 Unclassified 630
72 Ga0070685_10374019 3300005466 Unclassified 980
73 Ga0070706_100369622 3300005467 Bacteria 1336
74 Ga0070706_101125972 3300005467 Bacteria 722
75 Ga0070706_101527884 3300005467 Unclassified 610
76 Ga0070707_100062807 3300005468 Bacteria 3564
77 Ga0070707_100122584 3300005468 Bacteria 2524
78 Ga0070707_101815361 3300005468 Bacteria 577
79 Ga0070698_100091133 3300005471 Bacteria 3031
80 Ga0070698_101082000 3300005471 Unclassified 750
81 Ga0070698_101453475 3300005471 Unclassified 637
82 Ga0070699_100008612 3300005518 Bacteria 8840
83 Ga0070699_100036371 3300005518 Bacteria 4260
84 Ga0070699_100589286 3300005518 Unclassified 1013
85 Ga0070679_100081013 3300005530 Bacteria 3236
86 Ga0070684_100125976 3300005535 Bacteria 2307
87 Ga0070684_100190043 3300005535 Bacteria 1868
88 Ga0070684_100260251 3300005535 Bacteria 1587
89 Ga0070697_100040422 3300005536 Bacteria 3773
90 Ga0070697_100446020 3300005536 Unclassified 1127
91 Ga0070697_102138526 3300005536 Bacteria 501
92 Ga0070672_100128599 3300005543 Bacteria 2080
93 Ga0070672_100758272 3300005543 Unclassified 852
94 Ga0070686_100008500 3300005544 Bacteria 5749
95 Ga0070686_100156578 3300005544 Bacteria 1600
96 Ga0070686_101206011 3300005544 Bacteria 629
97 Ga0070695_100030802 3300005545 Bacteria 3341
98 Ga0070696_100045510 3300005546 Bacteria 3040
99 Ga0070696_100794200 3300005546 Bacteria 779
100 Ga0070696_101083104 3300005546 Unclassified 673
101 Ga0070696_101544217 3300005546 Unclassified 569
102 Ga0070693_100040857 3300005547 Bacteria 2606
103 Ga0070693_100333420 3300005547 Bacteria 1033
104 Ga0070665_101821058 3300005548 Unclassified 615
105 Ga0070704_100553058 3300005549 Bacteria 1006
106 Ga0070704_101480088 3300005549 Unclassified 624
107 Ga0068855_100348290 3300005563 Unclassified 1632
108 Ga0068855_100903027 3300005563 Unclassified 933
109 Ga0070664_100224182 3300005564 Unclassified 1683
110 Ga0070664_100306170 3300005564 Bacteria 1437
111 Ga0070664_100312384 3300005564 Unclassified 1422
112 Ga0070664_100449455 3300005564 Unclassified 1183
113 Ga0070664_100568006 3300005564 Bacteria 1050
114 Ga0068854_100052705 3300005578 Bacteria 2918
115 Ga0068854_100117982 3300005578 Bacteria 2010
116 Ga0068854_100994559 3300005578 Unclassified 742
117 Ga0068854_101518461 3300005578 Unclassified 608
118 Ga0068856_100010295 3300005614 Bacteria 9090
119 Ga0070702_101425984 3300005615 Bacteria 567
120 Ga0068852_101189043 3300005616 Unclassified 783
121 Ga0068852_102082440 3300005616 Bacteria 589
122 Ga0068859_100096959 3300005617 Bacteria 3001
123 Ga0068859_100706586 3300005617 Unclassified 1099
124 Ga0068859_100797002 3300005617 Bacteria 1033
125 Ga0068859_101374102 3300005617 Unclassified 779
126 Ga0068859_101897385 3300005617 Unclassified 658
127 Ga0068864_100012788 3300005618 Bacteria 6939
128 Ga0068864_102196218 3300005618 Unclassified 558
129 Ga0068866_10430880 3300005718 Unclassified 858
130 Ga0068866_10436578 3300005718 Unclassified 853
131 Ga0068861_100068733 3300005719 Bacteria 2738
132 Ga0068861_100132089 3300005719 Bacteria 2027
133 Ga0068861_100379978 3300005719 Bacteria 1248
134 Ga0068861_100402287 3300005719 Unclassified 1215
135 Ga0068861_100488688 3300005719 Bacteria 1110
136 Ga0068861_100659385 3300005719 Unclassified 968
137 Ga0068861_100926974 3300005719 Bacteria 827
138 Ga0068851_10120682 3300005834 Bacteria 1408
139 Ga0068870_10136793 3300005840 Bacteria 1429
140 Ga0068870_10148417 3300005840 Bacteria 1379
141 Ga0068863_100842237 3300005841 Bacteria 916
142 Ga0068863_102571599 3300005841 Unclassified 518
143 Ga0068858_100283782 3300005842 Bacteria 1577
144 Ga0068858_100411578 3300005842 Unclassified 1300
145 Ga0068858_100437220 3300005842 Bacteria 1260
146 Ga0068858_101669860 3300005842 Unclassified 629
147 Ga0068860_100114987 3300005843 Bacteria 2573
148 Ga0068860_100707154 3300005843 Bacteria 1018
149 Ga0068862_100255112 3300005844 Bacteria 1599
150 Ga0068862_101228584 3300005844 Unclassified 749
151 Ga0068862_101745713 3300005844 Unclassified 631
152 Ga0081455_10105397 3300005937 Bacteria 2253
153 Ga0070716_100145732 3300006173 Bacteria 1517
154 Ga0097621_100003790 3300006237 Bacteria 10468
155 Ga0097621_100284933 3300006237 Bacteria 1455
156 Ga0097621_100513065 3300006237 Unclassified 1087
157 Ga0097621_100571190 3300006237 Bacteria 1031
158 Ga0097621_100655112 3300006237 Unclassified 964
159 Ga0068871_100000268 3300006358 Bacteria 35785
160 Ga0068871_100184697 3300006358 Unclassified 1793
161 Ga0068871_100365811 3300006358 Bacteria 1278
162 Ga0068871_100527856 3300006358 Unclassified 1067
163 Ga0068871_100793856 3300006358 Bacteria 872
164 Ga0068871_101458764 3300006358 Bacteria 646
165 Ga0075428_102646742 3300006844 Bacteria 512
166 Ga0075433_10608868 3300006852 Bacteria 959
167 Ga0075433_11294297 3300006852 Bacteria 632
168 Ga0075434_100000761 3300006871 Bacteria 25412
169 Ga0075434_100075574 3300006871 Bacteria 3363
170 Ga0075434_100091315 3300006871 Bacteria 3047
171 Ga0075434_100141564 3300006871 Unclassified 2425
172 Ga0075434_100599102 3300006871 Bacteria 1121
173 Ga0075434_101007552 3300006871 Bacteria 847
174 Ga0075434_101771095 3300006871 Unclassified 625
175 Ga0075434_101794865 3300006871 Unclassified 620
176 Ga0068865_100230522 3300006881 Bacteria 1453
177 Ga0075436_100024412 3300006914 Bacteria 4155
178 Ga0075436_100038140 3300006914 Bacteria 3317
179 Ga0075436_100043027 3300006914 Bacteria 3114
180 Ga0075436_100131878 3300006914 Bacteria 1752
181 Ga0075436_100299958 3300006914 Unclassified 1151
182 Ga0097620_100096952 3300006931 Bacteria 3001
183 Ga0097620_100706634 3300006931 Unclassified 1099
184 Ga0097620_100796953 3300006931 Bacteria 1033
185 Ga0097620_101374183 3300006931 Unclassified 779
186 Ga0097620_101897094 3300006931 Unclassified 658
187 Ga0075435_100000057 3300007076 Bacteria 58158
188 Ga0075435_100000780 3300007076 Bacteria 19791
189 Ga0075435_100063081 3300007076 Bacteria 3009
190 Ga0075435_100113118 3300007076 Bacteria 2259
191 Ga0075435_100202216 3300007076 Unclassified 1683
192 Ga0099794_10523524 3300007265 Unclassified 625
193 Ga0105240_10006183 3300009093 Bacteria 17642
194 Ga0105240_10077434 3300009093 Bacteria 4097
195 Ga0111539_13216408 3300009094 Unclassified 526
196 Ga0105245_10163344 3300009098 Bacteria 2115
197 Ga0105245_10249257 3300009098 Bacteria 1725
198 Ga0105245_10414452 3300009098 Bacteria 1349
199 Ga0105245_10722266 3300009098 Bacteria 1031
200 Ga0105245_12222849 3300009098 Bacteria 602
201 Ga0105247_10019420 3300009101 Bacteria 4080
202 Ga0105247_10170066 3300009101 Unclassified 1448
203 Ga0105247_11792779 3300009101 Unclassified 510
204 Ga0114129_10012455 3300009147 Bacteria 12109
205 Ga0114129_10016455 3300009147 Bacteria 10527
206 Ga0114129_10331803 3300009147 Bacteria 2019
207 Ga0114129_11968391 3300009147 Bacteria 707
208 Ga0105243_10020394 3300009148 Bacteria 5026
209 Ga0105241_10173525 3300009174 Bacteria 1782
210 Ga0105241_10686199 3300009174 Bacteria 933
211 Ga0105241_11767466 3300009174 Unclassified 602
212 Ga0105241_12404742 3300009174 Bacteria 526
213 Ga0105242_10149476 3300009176 Unclassified 2035
214 Ga0105242_10883817 3300009176 Unclassified 892
215 Ga0105242_11029541 3300009176 Bacteria 833
216 Ga0105242_12227750 3300009176 Unclassified 593
217 Ga0105242_12464431 3300009176 Bacteria 568
218 Ga0105248_10079581 3300009177 Bacteria 3683
219 Ga0105248_10160083 3300009177 Bacteria 2540
220 Ga0105248_10175862 3300009177 Bacteria 2412
221 Ga0105248_10228621 3300009177 Unclassified 2094
222 Ga0105248_10721381 3300009177 Bacteria 1125
223 Ga0105248_10740901 3300009177 Unclassified 1109
224 Ga0105248_10816419 3300009177 Bacteria 1052
225 Ga0105248_11286826 3300009177 Unclassified 827
226 Ga0105248_11333261 3300009177 Bacteria 812
227 Ga0105248_11765174 3300009177 Bacteria 702
228 Ga0105237_10889124 3300009545 Bacteria 898
229 Ga0105238_10167447 3300009551 Unclassified 2173
230 Ga0105238_11233416 3300009551 Unclassified 773
231 Ga0105249_10609398 3300009553 Bacteria 1147
232 Ga0105249_10956013 3300009553 Bacteria 925
233 Ga0105239_10764676 3300010375 Bacteria 1106
234 Ga0105239_10907005 3300010375 Bacteria 1012
235 Ga0105239_12838712 3300010375 Bacteria 565
236 Ga0105246_10742059 3300011119 Bacteria 865
237 Ga0105246_10901804 3300011119 Bacteria 793
238 Ga0157370_10923717 3300013104 Unclassified 791
239 Ga0157374_10520639 3300013296 Bacteria 1195
240 Ga0157374_12366928 3300013296 Bacteria 558
241 Ga0157378_11133325 3300013297 Bacteria 820
242 Ga0157378_12736009 3300013297 Unclassified 546
243 Ga0157375_10880592 3300013308 Bacteria 1040
244 Ga0163163_10008651 3300014325 Bacteria 9053
245 Ga0157380_10234963 3300014326 Bacteria 1649
246 Ga0157380_10263978 3300014326 Bacteria 1566
247 Ga0157380_11276987 3300014326 Unclassified 781
248 Ga0157377_10219056 3300014745 Bacteria 1217
249 Ga0157379_10030452 3300014968 Bacteria 4804
250 Ga0157379_10530819 3300014968 Unclassified 1093
251 Ga0157376_10101595 3300014969 Bacteria 2513
252 Ga0157376_10176416 3300014969 Bacteria 1950
253 Ga0157376_11259402 3300014969 Unclassified 769
254 Ga0163161_10458388 3300017792 Bacteria 1032
255 Ga0163161_11050390 3300017792 Archaea 698
256 Ga0224712_10376770 3300022467 Bacteria 674
257 Ga0207682_10402719 3300025893 Unclassified 647
258 Ga0207642_10312862 3300025899 Bacteria 914
259 Ga0207642_10394008 3300025899 Bacteria 827
260 Ga0207710_10014728 3300025900 Bacteria 3301
261 Ga0207710_10114935 3300025900 Bacteria 1281
262 Ga0207680_10030359 3300025903 Bacteria 3048
263 Ga0207680_10037251 3300025903 Bacteria 2807
264 Ga0207680_10385892 3300025903 Unclassified 988
265 Ga0207685_10060819 3300025905 Bacteria 1495
266 Ga0207699_10013570 3300025906 Bacteria 4175
267 Ga0207645_10357087 3300025907 Bacteria 979
268 Ga0207645_10375619 3300025907 Bacteria 954
269 Ga0207645_10545143 3300025907 Bacteria 787
270 Ga0207643_10071076 3300025908 Unclassified 2003
271 Ga0207643_10379981 3300025908 Bacteria 890
272 Ga0207684_10290458 3300025910 Bacteria 1410
273 Ga0207654_10114852 3300025911 Unclassified 1681
274 Ga0207707_10421767 3300025912 Bacteria 1144
275 Ga0207707_10435142 3300025912 Bacteria 1123
276 Ga0207695_10120576 3300025913 Bacteria 2591
277 Ga0207671_10938800 3300025914 Bacteria 683
278 Ga0207693_11045246 3300025915 Unclassified 622
279 Ga0207662_10034636 3300025918 Bacteria 2947
280 Ga0207649_10078738 3300025920 Bacteria 2128
281 Ga0207649_10648105 3300025920 Unclassified 816
282 Ga0207652_10198526 3300025921 Bacteria 1805
283 Ga0207646_10517358 3300025922 Unclassified 1074
284 Ga0207646_11055398 3300025922 Bacteria 716
285 Ga0207646_11361465 3300025922 Unclassified 618
286 Ga0207681_10191589 3300025923 Bacteria 1564
287 Ga0207681_10347429 3300025923 Bacteria 1187
288 Ga0207681_11101797 3300025923 Unclassified 667
289 Ga0207694_10891779 3300025924 Unclassified 752
290 Ga0207650_10056448 3300025925 Unclassified 2918
291 Ga0207650_10451453 3300025925 Bacteria 1070
292 Ga0207650_11598641 3300025925 Bacteria 553
293 Ga0207659_10303846 3300025926 Unclassified 1311
294 Ga0207687_10046882 3300025927 Bacteria 2994
295 Ga0207687_10184996 3300025927 Unclassified 1617
296 Ga0207687_10362408 3300025927 Bacteria 1183
297 Ga0207687_10422198 3300025927 Bacteria 1101
298 Ga0207690_11109114 3300025932 Bacteria 660
299 Ga0207706_10083486 3300025933 Bacteria 2809
300 Ga0207686_10160570 3300025934 Bacteria 1575
301 Ga0207686_10472809 3300025934 Unclassified 968
302 Ga0207709_10190813 3300025935 Bacteria 1455
303 Ga0207670_10248055 3300025936 Unclassified 1375
304 Ga0207670_10412165 3300025936 Bacteria 1082
305 Ga0207669_10282024 3300025937 Bacteria 1253
306 Ga0207704_10265273 3300025938 Bacteria 1297
307 Ga0207691_10267947 3300025940 Unclassified 1471
308 Ga0207691_10395839 3300025940 Unclassified 1178
309 Ga0207711_10017030 3300025941 Bacteria 6036
310 Ga0207711_10041471 3300025941 Bacteria 3920
311 Ga0207711_10474294 3300025941 Bacteria 1165
312 Ga0207711_10735142 3300025941 Bacteria 920
313 Ga0207711_11133964 3300025941 Unclassified 723
314 Ga0207711_11560390 3300025941 Unclassified 603
315 Ga0207689_10034711 3300025942 Bacteria 4188
316 Ga0207661_10111473 3300025944 Unclassified 2315
317 Ga0207679_10195868 3300025945 Bacteria 1684
318 Ga0207679_10350355 3300025945 Bacteria 1287
319 Ga0207679_10623665 3300025945 Bacteria 973
320 Ga0207667_10438696 3300025949 Bacteria 1328
321 Ga0207667_10697179 3300025949 Bacteria 1018
322 Ga0207651_10517592 3300025960 Unclassified 1033
323 Ga0207651_11025976 3300025960 Bacteria 738
324 Ga0207651_11503790 3300025960 Bacteria 606
325 Ga0207712_10283647 3300025961 Bacteria 1352
326 Ga0207712_11750853 3300025961 Unclassified 557
327 Ga0207668_10090638 3300025972 Bacteria 2245
328 Ga0207640_10013750 3300025981 Bacteria 4646
329 Ga0207658_10511487 3300025986 Bacteria 1071
330 Ga0207677_11069858 3300026023 Bacteria 734
331 Ga0207677_11104652 3300026023 Unclassified 723
332 Ga0207677_11689582 3300026023 Bacteria 587
333 Ga0207703_10008831 3300026035 Bacteria 7945
334 Ga0207703_10009735 3300026035 Bacteria 7543
335 Ga0207703_10177073 3300026035 Bacteria 1880
336 Ga0207703_10430755 3300026035 Bacteria 1229
337 Ga0207703_10581442 3300026035 Unclassified 1058
338 Ga0207703_11619025 3300026035 Unclassified 623
339 Ga0207639_10424523 3300026041 Unclassified 1203
340 Ga0207708_10306134 3300026075 Unclassified 1293
341 Ga0207708_10409317 3300026075 Bacteria 1123
342 Ga0207702_10015197 3300026078 Bacteria 6383
343 Ga0207702_11472137 3300026078 Unclassified 674
344 Ga0207641_10021267 3300026088 Bacteria 5333
345 Ga0207641_10187445 3300026088 Unclassified 1899
346 Ga0207641_10571763 3300026088 Unclassified 1104
347 Ga0207648_10241263 3300026089 Bacteria 1609
348 Ga0207648_10556981 3300026089 Bacteria 1053
349 Ga0207648_11295058 3300026089 Bacteria 685
350 Ga0207676_10016276 3300026095 Bacteria 5384
351 Ga0207676_10982008 3300026095 Bacteria 831
352 Ga0207675_100022766 3300026118 Bacteria 5830
353 Ga0207675_100086392 3300026118 Bacteria 2945
354 Ga0207675_100163367 3300026118 Bacteria 2126
355 Ga0207675_100252809 3300026118 Bacteria 1706
356 Ga0207675_100555864 3300026118 Unclassified 1147
357 Ga0207675_100880102 3300026118 Bacteria 911
358 Ga0207675_100890163 3300026118 Unclassified 906
359 Ga0207683_10024966 3300026121 Bacteria 5152
360 Ga0207683_10271535 3300026121 Bacteria 1549
361 Ga0207698_12156565 3300026142 Unclassified 570
362 Ga0268266_10047552 3300028379 Bacteria 3676
363 Ga0268265_10095088 3300028380 Bacteria 2391
364 Ga0268265_10494857 3300028380 Bacteria 1151
365 Ga0268265_10541624 3300028380 Bacteria 1103
366 Ga0268264_10151252 3300028381 Bacteria 2081
367 Ga0268264_10303611 3300028381 Bacteria 1503
368 Ga0268264_10729179 3300028381 Bacteria 986
369 Ga0268264_10808405 3300028381 Bacteria 937
370 Ga0268264_11012249 3300028381 Bacteria 838
371 Ga0307408_102120780 3300031548 Bacteria 542
372 Ga0265314_10125818 3300031711 Bacteria 1606
373 Ga0373930_0003751 3300034816 Bacteria 2435
374 Ga0373948_0006388 3300034817 Bacteria 1947
375 Ga0373950_0005404 3300034818 Bacteria 1907
376 Ga0373950_0033493 3300034818 Unclassified 960
377 Ga0373959_0001774 3300034820 Bacteria 3441
378 Ga0373928_0062022 3300035084 Unclassified 906
379 Ga0373928_0120100 3300035084 Unclassified 704
380 Ga0373940_0002093 3300035088 Bacteria 3799
381 Ga0373944_0205377 3300035089 Bacteria 714
382 Ga0373949_0010052 3300035090 Bacteria 2070
383 Ga0373949_0118889 3300035090 Bacteria 740
384 Ga0373951_0000764 3300035091 Bacteria 8811
385 Ga0373952_0083102 3300035092 Bacteria 820
386 Ga0373923_0187654 3300035111 Bacteria 952
387 Ga0373932_0000524 3300035112 Bacteria 11788
388 Ga0373939_0002027 3300035114 Bacteria 4831
389 Ga0373939_0191006 3300035114 Unclassified 769
390 Ga0373941_0003447 3300035115 Bacteria 3581
391 Ga0373941_0043999 3300035115 Unclassified 1392
392 Ga0373953_0504813 3300035117 Unclassified 536
393 Ga0373954_0043613 3300035118 Bacteria 2092
394 Ga0373956_0063284 3300035119 Unclassified 1678
395 Ga0373956_0164590 3300035119 Unclassified 1046
396 Ga0373960_0002851 3300035121 Bacteria 3913
397 Ga0373943_0243922 3300035170 Bacteria 1007
398 Ga0373955_0807279 3300035172 Bacteria 577
399 Ga0373955_1001338 3300035172 Bacteria 515
400 Ga0373942_0000642 3300035207 Bacteria 9769
401 Ga0373961_0024216 3300035241 Bacteria 1640
402 Ga0373962_0028860 3300035242 Bacteria 1508
403 Ga0373931_0696801 3300035691 Unclassified 670
404 Ga0373931_0885446 3300035691 Bacteria 599
405 Ga0373935_0117046 3300035692 Bacteria 1776
406 Ga0373935_0160300 3300035692 Bacteria 1533
407 Ga0373927_0275799 3300035695 Bacteria 1106
408 Ga0373947_0165641 3300035725 Bacteria 1431
409 Ga0373937_0066119 3300036401 Bacteria 3329
410 Ga0373937_0410793 3300036401 Bacteria 1284
411 Ga0373937_0973018 3300036401 Unclassified 797
412 Ga0373937_0995894 3300036401 Bacteria 787
413 Ga0373925_0292709 3300037068 Bacteria 1313
414 Ga0373925_0567560 3300037068 Unclassified 934
415 Ga0395901_1556319 3300038443 Unclassified 616
416 Ga0453683_0287550 3300044673 Unclassified 1051
417 Ga0451576_0030292 3300045051 Bacteria 5784
418 Ga0451576_1875869 3300045051 Unclassified 619
419 Ga0466967_0839463 3300045976 Unclassified 913
420 Ga0495603_0073725 3300046455 Bacteria 2005
421 Ga0495629_0036891 3300046459 Bacteria 3448
422 Ga0495629_0765052 3300046459 Unclassified 639
423 Ga0495651_0809316 3300046462 Unclassified 578
424 Ga0495580_0338974 3300046472 Bacteria 1020
425 Ga0495639_0049595 3300046475 Unclassified 1906
426 Ga0495662_0675987 3300046476 Bacteria 504
427 Ga0495664_0531927 3300046477 Unclassified 701
428 Ga0495594_0561731 3300046499 Bacteria 647
429 Ga0495608_0224405 3300046511 Bacteria 1178
430 Ga0495630_1008970 3300046517 Bacteria 632
431 Ga0495640_0512002 3300046533 Bacteria 730
432 Ga0495586_0324293 3300046535 Bacteria 883
433 Ga0495587_0535494 3300046536 Unclassified 647
434 Ga0495645_0004297 3300046543 Bacteria 9735
435 Ga0495667_0065381 3300046559 Bacteria 2379
436 Ga0495667_1026152 3300046559 Unclassified 502
437 Ga0495656_0280739 3300046615 Bacteria 849
438 Ga0495634_0262243 3300046642 Bacteria 1054
439 Ga0495635_0081300 3300046663 Bacteria 2217
440 Ga0495635_0257703 3300046663 Unclassified 1175
441 Ga0495647_0038331 3300046681 Bacteria 1812
442 Ga0495647_0057042 3300046681 Bacteria 1532
443 Ga0495647_0175943 3300046681 Bacteria 929
444 Ga0495658_0064947 3300046683 Bacteria 2104
445 Ga0495658_0779894 3300046683 Unclassified 612
446 Ga0495669_0113146 3300046684 Bacteria 1268
447 Ga0495613_0051000 3300046689 Bacteria 3051
448 Ga0495670_0202422 3300046691 Bacteria 1052
449 Ga0495671_0606065 3300046692 Bacteria 521
450 Ga0495674_1195484 3300047319 Bacteria 575
451 Ga0495680_0107382 3300047322 Bacteria 2073
452 Ga0495684_0333411 3300047471 Bacteria 1081
453 Ga0495593_0098848 3300047673 Bacteria 1498
454 Ga0496100_0779309 3300048903 Unclassified 749
455 Ga0496102_0441780 3300048905 Bacteria 1221
456 Ga0496102_1922122 3300048905 Viruses 508
457 Ga0496103_0206617 3300048906 Unclassified 1263
458 Ga0496104_0104952 3300048907 Bacteria 2708
459 Ga0496105_0225574 3300048908 Unclassified 1524
460 Ga0496106_0137101 3300048909 Bacteria 1923
461 Ga0496107_0516915 3300048910 Bacteria 885
462 Ga0496107_0622915 3300048910 Unclassified 796
463 Ga0496108_0021912 3300048911 Bacteria 5252
464 Ga0496109_0152104 3300048912 Unclassified 2166
465 Ga0496110_0273865 3300048913 Unclassified 1537
466 Ga0496110_1781399 3300048913 Unclassified 526
467 Ga0496112_0006929 3300048915 Bacteria 10002
468 Ga0496112_1243024 3300048915 Unclassified 661
469 Ga0496112_1363504 3300048915 Unclassified 624
470 Ga0496113_0197487 3300048916 Unclassified 1598
471 Ga0496114_0257131 3300048917 Unclassified 1537
472 Ga0496114_0541486 3300048917 Bacteria 1029
473 Ga0501032_0387836 3300049569 Unclassified 898
474 Ga0501034_0047554 3300049571 Bacteria 4332
475 Ga0501034_0192347 3300049571 Unclassified 2002
476 Ga0501043_0551381 3300049579 Unclassified 856
477 Ga0501047_0015806 3300049581 Bacteria 7193
478 Ga0501047_0471121 3300049581 Bacteria 1084
479 Ga0501067_0267374 3300049583 Unclassified 952
480 Ga0501072_0878245 3300049588 Unclassified 701
481 Ga0501073_0081144 3300049589 Bacteria 2256
482 Ga0501074_0915506 3300049590 Bacteria 617
483 Ga0501080_0456649 3300049742 Unclassified 1145
484 Ga0501080_1087842 3300049742 Bacteria 691
485 Ga0501083_0122942 3300049744 Unclassified 1702
486 Ga0501083_0286484 3300049744 Unclassified 1071
487 Ga0501044_0005941 3300049823 Bacteria 13519
488 nmdc:mga05p37_163660_c1 3300050507 Bacteria 2716
489 nmdc:mga05p37_425653_c1 3300050507 Bacteria 1544
490 nmdc:mga0n895_104153_c1 3300050512 Bacteria 2850
491 nmdc:mga0n895_131076_c1 3300050512 Bacteria 2532
492 nmdc:mga0n895_1412458_c1 3300050512 Unclassified 664
493 nmdc:mga0n895_1478271_c1 3300050512 Unclassified 646
494 nmdc:mga0n895_38_c1 3300050512 Bacteria 76202
495 nmdc:mga0n895_944881_c1 3300050512 Unclassified 846
496 nmdc:mga0rr50_1073393_c1 3300050513 Unclassified 685
497 nmdc:mga0rr50_132543_c1 3300050513 Bacteria 1997
498 nmdc:mga0rr50_2_c1 3300050513 Bacteria 373938
499 nmdc:mga0rr50_36240_c1 3300050513 Bacteria 3550
500 nmdc:mga0rr50_381493_c1 3300050513 Bacteria 1189
501 nmdc:mga0rr50_418_c1 3300050513 Bacteria 22918
502 nmdc:mga08x19_111066_c1 3300050514 Bacteria 1829
503 nmdc:mga08x19_127371_c1 3300050514 Unclassified 1711
504 nmdc:mga08x19_139989_c1 3300050514 Bacteria 1634
505 nmdc:mga08x19_1482_c1 3300050514 Bacteria 14534
506 nmdc:mga08x19_314229_c1 3300050514 Unclassified 1090
507 nmdc:mga08x19_60281_c1 3300050514 Bacteria 2458
508 nmdc:mga0a205_498823_c1 3300050515 Bacteria 1074
509 nmdc:mga0a205_588000_c1 3300050515 Bacteria 967
510 Ga0495595_0033318 3300053084 Bacteria 2324
511 Ga0495619_0129550 3300053085 Unclassified 1733
512 Ga0495619_0351427 3300053085 Unclassified 1020
513 Ga0495619_1047803 3300053085 Bacteria 544
514 Ga0501082_0556732 3300060353 Unclassified 1003
515 Ga0070687_100002971
516 Ga0058861_11184094
517 Ga0065714_10432667
518 Ga0065704_10409081
519 Ga0065712_10108102
520 Ga0065715_10425725
521 Ga0065715_10480993
522 Ga0065707_10105170
523 Ga0070658_10130073
524 Ga0070676_10324712
525 Ga0070676_10822441
526 Ga0070683_100056015
527 Ga0070683_100222424
528 Ga0070683_102119885
529 Ga0070670_100261998
530 Ga0070670_101051819
531 Ga0070677_10007010
532 Ga0068869_100231128
533 Ga0068869_100775320
534 Ga0068869_101272541
535 Ga0070666_10008768
536 Ga0070666_10064841
537 Ga0070680_100021059
538 Ga0070682_101808029
539 Ga0068868_100228022
540 Ga0068868_101102678
541 Ga0068868_101936076
542 Ga0070689_100069023
543 Ga0070691_10786340
544 Ga0070687_100249385
545 Ga0070687_100480968
546 Ga0070661_100179025
547 Ga0070661_100847887
548 Ga0070661_101868354
549 Ga0070668_100036858
550 Ga0070668_102272149
551 Ga0070669_100039664
552 Ga0070669_101756372
553 Ga0070675_100163000
554 Ga0070675_100258319
555 Ga0070675_101358526
556 Ga0070671_100515594
557 Ga0070671_100887243
558 Ga0070674_100050319
559 Ga0070674_100065233
560 Ga0070674_100077546
561 Ga0070673_100032054
562 Ga0070673_100327812
563 Ga0070673_100364040
564 Ga0070673_100366862
565 Ga0070688_100224338
566 Ga0070659_101283950
567 Ga0070667_100134494
568 Ga0070709_10016431
569 Ga0070713_100794809
570 Ga0070701_10271994
571 Ga0070705_100540445
572 Ga0070705_100829243
573 Ga0070700_100254700
574 Ga0070694_100040919
575 Ga0070694_100257249
576 Ga0070694_100630016
577 Ga0070694_101264533
578 Ga0070708_100676642
579 Ga0070708_101906033
580 Ga0070678_100008709
581 Ga0070678_100299006
582 Ga0070662_101989777
583 Ga0070681_10018894
584 Ga0070681_10109548
585 Ga0068867_101489789
586 Ga0070685_10374019
587 Ga0070706_100369622
588 Ga0070706_101125972
589 Ga0070706_101527884
590 Ga0070707_100062807
591 Ga0070707_100122584
592 Ga0070707_101815361
593 Ga0070698_100091133
594 Ga0070698_101082000
595 Ga0070698_101453475
596 Ga0070699_100008612
597 Ga0070699_100036371
598 Ga0070699_100589286
599 Ga0070679_100081013
600 Ga0070684_100125976
601 Ga0070684_100190043
602 Ga0070684_100260251
603 Ga0070697_100040422
604 Ga0070697_100446020
605 Ga0070697_102138526
606 Ga0070672_100128599
607 Ga0070672_100758272
608 Ga0070686_100008500
609 Ga0070686_100156578
610 Ga0070686_101206011
611 Ga0070695_100030802
612 Ga0070696_100045510
613 Ga0070696_100794200
614 Ga0070696_101083104
615 Ga0070696_101544217
616 Ga0070693_100040857
617 Ga0070693_100333420
618 Ga0070665_101821058
619 Ga0070704_100553058
620 Ga0070704_101480088
621 Ga0068855_100348290
622 Ga0068855_100903027
623 Ga0070664_100224182
624 Ga0070664_100306170
625 Ga0070664_100312384
626 Ga0070664_100449455
627 Ga0070664_100568006
628 Ga0068854_100052705
629 Ga0068854_100117982
630 Ga0068854_100994559
631 Ga0068854_101518461
632 Ga0068856_100010295
633 Ga0070702_101425984
634 Ga0068852_101189043
635 Ga0068852_102082440
636 Ga0068859_100096959
637 Ga0068859_100706586
638 Ga0068859_100797002
639 Ga0068859_101374102
640 Ga0068859_101897385
641 Ga0068864_100012788
642 Ga0068864_102196218
643 Ga0068866_10430880
644 Ga0068866_10436578
645 Ga0068861_100068733
646 Ga0068861_100132089
647 Ga0068861_100379978
648 Ga0068861_100402287
649 Ga0068861_100488688
650 Ga0068861_100659385
651 Ga0068861_100926974
652 Ga0068851_10120682
653 Ga0068870_10136793
654 Ga0068870_10148417
655 Ga0068863_100842237
656 Ga0068863_102571599
657 Ga0068858_100283782
658 Ga0068858_100411578
659 Ga0068858_100437220
660 Ga0068858_101669860
661 Ga0068860_100114987
662 Ga0068860_100707154
663 Ga0068862_100255112
664 Ga0068862_101228584
665 Ga0068862_101745713
666 Ga0081455_10105397
667 Ga0070716_100145732
668 Ga0097621_100003790
669 Ga0097621_100284933
670 Ga0097621_100513065
671 Ga0097621_100571190
672 Ga0097621_100655112
673 Ga0068871_100000268
674 Ga0068871_100184697
675 Ga0068871_100365811
676 Ga0068871_100527856
677 Ga0068871_100793856
678 Ga0068871_101458764
679 Ga0075428_102646742
680 Ga0075433_10608868
681 Ga0075433_11294297
682 Ga0075434_100000761
683 Ga0075434_100075574
684 Ga0075434_100091315
685 Ga0075434_100141564
686 Ga0075434_100599102
687 Ga0075434_101007552
688 Ga0075434_101771095
689 Ga0075434_101794865
690 Ga0068865_100230522
691 Ga0075436_100024412
692 Ga0075436_100038140
693 Ga0075436_100043027
694 Ga0075436_100131878
695 Ga0075436_100299958
696 Ga0097620_100096952
697 Ga0097620_100706634
698 Ga0097620_100796953
699 Ga0097620_101374183
700 Ga0097620_101897094
701 Ga0075435_100000057
702 Ga0075435_100000780
703 Ga0075435_100063081
704 Ga0075435_100113118
705 Ga0075435_100202216
706 Ga0099794_10523524
707 Ga0105240_10006183
708 Ga0105240_10077434
709 Ga0111539_13216408
710 Ga0105245_10163344
711 Ga0105245_10249257
712 Ga0105245_10414452
713 Ga0105245_10722266
714 Ga0105245_12222849
715 Ga0105247_10019420
716 Ga0105247_10170066
717 Ga0105247_11792779
718 Ga0114129_10012455
719 Ga0114129_10016455
720 Ga0114129_10331803
721 Ga0114129_11968391
722 Ga0105243_10020394
723 Ga0105241_10173525
724 Ga0105241_10686199
725 Ga0105241_11767466
726 Ga0105241_12404742
727 Ga0105242_10149476
728 Ga0105242_10883817
729 Ga0105242_11029541
730 Ga0105242_12227750
731 Ga0105242_12464431
732 Ga0105248_10079581
733 Ga0105248_10160083
734 Ga0105248_10175862
735 Ga0105248_10228621
736 Ga0105248_10721381
737 Ga0105248_10740901
738 Ga0105248_10816419
739 Ga0105248_11286826
740 Ga0105248_11333261
741 Ga0105248_11765174
742 Ga0105237_10889124
743 Ga0105238_10167447
744 Ga0105238_11233416
745 Ga0105249_10609398
746 Ga0105249_10956013
747 Ga0105239_10764676
748 Ga0105239_10907005
749 Ga0105239_12838712
750 Ga0105246_10742059
751 Ga0105246_10901804
752 Ga0157370_10923717
753 Ga0157374_10520639
754 Ga0157374_12366928
755 Ga0157378_11133325
756 Ga0157378_12736009
757 Ga0157375_10880592
758 Ga0163163_10008651
759 Ga0157380_10234963
760 Ga0157380_10263978
761 Ga0157380_11276987
762 Ga0157377_10219056
763 Ga0157379_10030452
764 Ga0157379_10530819
765 Ga0157376_10101595
766 Ga0157376_10176416
767 Ga0157376_11259402
768 Ga0163161_10458388
769 Ga0163161_11050390
770 Ga0224712_10376770
771 Ga0207682_10402719
772 Ga0207642_10312862
773 Ga0207642_10394008
774 Ga0207710_10014728
775 Ga0207710_10114935
776 Ga0207680_10030359
777 Ga0207680_10037251
778 Ga0207680_10385892
779 Ga0207685_10060819
780 Ga0207699_10013570
781 Ga0207645_10357087
782 Ga0207645_10375619
783 Ga0207645_10545143
784 Ga0207643_10071076
785 Ga0207643_10379981
786 Ga0207684_10290458
787 Ga0207654_10114852
788 Ga0207707_10421767
789 Ga0207707_10435142
790 Ga0207695_10120576
791 Ga0207671_10938800
792 Ga0207693_11045246
793 Ga0207662_10034636
794 Ga0207649_10078738
795 Ga0207649_10648105
796 Ga0207652_10198526
797 Ga0207646_10517358
798 Ga0207646_11055398
799 Ga0207646_11361465
800 Ga0207681_10191589
801 Ga0207681_10347429
802 Ga0207681_11101797
803 Ga0207694_10891779
804 Ga0207650_10056448
805 Ga0207650_10451453
806 Ga0207650_11598641
807 Ga0207659_10303846
808 Ga0207687_10046882
809 Ga0207687_10184996
810 Ga0207687_10362408
811 Ga0207687_10422198
812 Ga0207690_11109114
813 Ga0207706_10083486
814 Ga0207686_10160570
815 Ga0207686_10472809
816 Ga0207709_10190813
817 Ga0207670_10248055
818 Ga0207670_10412165
819 Ga0207669_10282024
820 Ga0207704_10265273
821 Ga0207691_10267947
822 Ga0207691_10395839
823 Ga0207711_10017030
824 Ga0207711_10041471
825 Ga0207711_10474294
826 Ga0207711_10735142
827 Ga0207711_11133964
828 Ga0207711_11560390
829 Ga0207689_10034711
830 Ga0207661_10111473
831 Ga0207679_10195868
832 Ga0207679_10350355
833 Ga0207679_10623665
834 Ga0207667_10438696
835 Ga0207667_10697179
836 Ga0207651_10517592
837 Ga0207651_11025976
838 Ga0207651_11503790
839 Ga0207712_10283647
840 Ga0207712_11750853
841 Ga0207668_10090638
842 Ga0207640_10013750
843 Ga0207658_10511487
844 Ga0207677_11069858
845 Ga0207677_11104652
846 Ga0207677_11689582
847 Ga0207703_10008831
848 Ga0207703_10009735
849 Ga0207703_10177073
850 Ga0207703_10430755
851 Ga0207703_10581442
852 Ga0207703_11619025
853 Ga0207639_10424523
854 Ga0207708_10306134
855 Ga0207708_10409317
856 Ga0207702_10015197
857 Ga0207702_11472137
858 Ga0207641_10021267
859 Ga0207641_10187445
860 Ga0207641_10571763
861 Ga0207648_10241263
862 Ga0207648_10556981
863 Ga0207648_11295058
864 Ga0207676_10016276
865 Ga0207676_10982008
866 Ga0207675_100022766
867 Ga0207675_100086392
868 Ga0207675_100163367
869 Ga0207675_100252809
870 Ga0207675_100555864
871 Ga0207675_100880102
872 Ga0207675_100890163
873 Ga0207683_10024966
874 Ga0207683_10271535
875 Ga0207698_12156565
876 Ga0268266_10047552
877 Ga0268265_10095088
878 Ga0268265_10494857
879 Ga0268265_10541624
880 Ga0268264_10151252
881 Ga0268264_10303611
882 Ga0268264_10729179
883 Ga0268264_10808405
884 Ga0268264_11012249
885 Ga0307408_102120780
886 Ga0265314_10125818
887 Ga0373930_0003751
888 Ga0373948_0006388
889 Ga0373950_0005404
890 Ga0373950_0033493
891 Ga0373959_0001774
892 Ga0373928_0062022
893 Ga0373928_0120100
894 Ga0373940_0002093
895 Ga0373944_0205377
896 Ga0373949_0010052
897 Ga0373949_0118889
898 Ga0373951_0000764
899 Ga0373952_0083102
900 Ga0373923_0187654
901 Ga0373932_0000524
902 Ga0373939_0002027
903 Ga0373939_0191006
904 Ga0373941_0003447
905 Ga0373941_0043999
906 Ga0373953_0504813
907 Ga0373954_0043613
908 Ga0373956_0063284
909 Ga0373956_0164590
910 Ga0373960_0002851
911 Ga0373943_0243922
912 Ga0373955_0807279
913 Ga0373955_1001338
914 Ga0373942_0000642
915 Ga0373961_0024216
916 Ga0373962_0028860
917 Ga0373931_0696801
918 Ga0373931_0885446
919 Ga0373935_0117046
920 Ga0373935_0160300
921 Ga0373927_0275799
922 Ga0373947_0165641
923 Ga0373937_0066119
924 Ga0373937_0410793
925 Ga0373937_0973018
926 Ga0373937_0995894
927 Ga0373925_0292709
928 Ga0373925_0567560
929 Ga0395901_1556319
930 Ga0453683_0287550
931 Ga0451576_0030292
932 Ga0451576_1875869
933 Ga0466967_0839463
934 Ga0495603_0073725
935 Ga0495629_0036891
936 Ga0495629_0765052
937 Ga0495651_0809316
938 Ga0495580_0338974
939 Ga0495639_0049595
940 Ga0495662_0675987
941 Ga0495664_0531927
942 Ga0495594_0561731
943 Ga0495608_0224405
944 Ga0495630_1008970
945 Ga0495640_0512002
946 Ga0495586_0324293
947 Ga0495587_0535494
948 Ga0495645_0004297
949 Ga0495667_0065381
950 Ga0495667_1026152
951 Ga0495656_0280739
952 Ga0495634_0262243
953 Ga0495635_0081300
954 Ga0495635_0257703
955 Ga0495647_0038331
956 Ga0495647_0057042
957 Ga0495647_0175943
958 Ga0495658_0064947
959 Ga0495658_0779894
960 Ga0495669_0113146
961 Ga0495613_0051000
962 Ga0495670_0202422
963 Ga0495671_0606065
964 Ga0495674_1195484
965 Ga0495680_0107382
966 Ga0495684_0333411
967 Ga0495593_0098848
968 Ga0496100_0779309
969 Ga0496102_0441780
970 Ga0496102_1922122
971 Ga0496103_0206617
972 Ga0496104_0104952
973 Ga0496105_0225574
974 Ga0496106_0137101
975 Ga0496107_0516915
976 Ga0496107_0622915
977 Ga0496108_0021912
978 Ga0496109_0152104
979 Ga0496110_0273865
980 Ga0496110_1781399
981 Ga0496112_0006929
982 Ga0496112_1243024
983 Ga0496112_1363504
984 Ga0496113_0197487
985 Ga0496114_0257131
986 Ga0496114_0541486
987 Ga0501032_0387836
988 Ga0501034_0047554
989 Ga0501034_0192347
990 Ga0501043_0551381
991 Ga0501047_0015806
992 Ga0501047_0471121
993 Ga0501067_0267374
994 Ga0501072_0878245
995 Ga0501073_0081144
996 Ga0501074_0915506
997 Ga0501080_0456649
998 Ga0501080_1087842
999 Ga0501083_0122942
1000 Ga0501083_0286484
1001 Ga0501044_0005941
1002 nmdc:mga05p37_163660_c1
1003 nmdc:mga05p37_425653_c1
1004 nmdc:mga0n895_104153_c1
1005 nmdc:mga0n895_131076_c1
1006 nmdc:mga0n895_1412458_c1
1007 nmdc:mga0n895_1478271_c1
1008 nmdc:mga0n895_38_c1
1009 nmdc:mga0n895_944881_c1
1010 nmdc:mga0rr50_1073393_c1
1011 nmdc:mga0rr50_132543_c1
1012 nmdc:mga0rr50_2_c1
1013 nmdc:mga0rr50_36240_c1
1014 nmdc:mga0rr50_381493_c1
1015 nmdc:mga0rr50_418_c1
1016 nmdc:mga08x19_111066_c1
1017 nmdc:mga08x19_127371_c1
1018 nmdc:mga08x19_139989_c1
1019 nmdc:mga08x19_1482_c1
1020 nmdc:mga08x19_314229_c1
1021 nmdc:mga08x19_60281_c1
1022 nmdc:mga0a205_498823_c1
1023 nmdc:mga0a205_588000_c1
1024 Ga0495595_0033318
1025 Ga0495619_0129550
1026 Ga0495619_0351427
1027 Ga0495619_1047803
1028 Ga0501082_0556732

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1t4a-assembly1.cif.gz_A structure of b. subtilis purs c2 crystal form 0.4995 7 86
1x7v-assembly3.cif.gz_C crystal structure of pa3566 from pseudomonas aeruginosa 0.4955 2 88
1t4a-assembly1.cif.gz_A structure of b. subtilis purs c2 crystal form 0.49 7 86
2yx5-assembly1.cif.gz_A crystal structure of methanocaldococcus jannaschii purs, one of the subunits of formylglycinamide ribonucleotide amidotransferase in the purine biosynthetic pathway 0.4744 7 90
4ney-assembly1.cif.gz_A crystal structure of an engineered protein with ferredoxin fold, northeast structural genomics consortium (nesg) target or277 0.4663 7 85
ID Description Score Start End Superfamily
3ug4C01 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.5394 3 89 2.60.40.1180
1x7vB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.4915 8 88 3.30.70.100
2glzB00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;; 0.4895 9 86 3.30.1330.130
1t4aB00 Alpha Beta;2-Layer Sandwich;Mth169; Chain: A ,;Phosphoribosylformylglycinamidine synthase subunit PurS 0.4891 9 84 3.30.1280.10
2yx5A00 Alpha Beta;2-Layer Sandwich;Mth169; Chain: A ,;Phosphoribosylformylglycinamidine synthase subunit PurS 0.4744 7 90 3.30.1280.10
ID Description Score Start End GO Terms
AF-A0A5Q4EEC9-F1-model_v4 Uncharacterized protein 0.5862 8 90
AF-A0A3S0B7W6-F1-model_v4 VacJ 0.5832 4 99
AF-A0A8A8EV28-F1-model_v4 deleted 0.5742 4 95
AF-A0A1F5UHZ0-F1-model_v4 VacJ 0.5681 1 93
AF-A0A1I1I251-F1-model_v4 VacJ 0.5665 4 94

Map