F457633

General Info

Members Datasets Scaffolds Average Seq Length
513 378 1027 209

Family's Representative Sequence

Representative Sequence 3300048925|Ga0496122_0016454|Ga0496122_0016454_6135_6893
Length 252
Sequence MTEPTDMTGTSPTGFIVKSTALPLAIPAAFDRPEFRPTRRKRYAGFSTLMLFAAACVVLTATPGPDMLLIASRSISQGRAAGFLTYAGIALGTYCHALAAAFGLSQLFIAVPMAYDAIRWSGCAYLLYLAVKTIRSDATPFSPTTGLKRFSMQRILGEGLLTNLLNPKMALFVLALFPQFVAPQSGSLPLQMLVLATVLNITGLVVNGTVILLSGHIRTKVGARMRFKKLPQYLLATVFAALACRLALGSRN

Samples

Sample ID Description Type Environment
1 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
57 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
58 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
60 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
61 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
63 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
64 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
65 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
67 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
71 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
73 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
92 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
95 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
100 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
101 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
102 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
103 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
104 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
105 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
106 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
107 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
108 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
109 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
110 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
111 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
112 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
113 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
114 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
115 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
116 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
117 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
118 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
119 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
120 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
121 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
122 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
123 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
124 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
125 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
126 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
127 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
128 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
129 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
130 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
131 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
132 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
133 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
134 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
135 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
136 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
137 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
138 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
139 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
140 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
141 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
142 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
143 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
144 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
145 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
146 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
147 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
148 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
149 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
150 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
151 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
152 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
153 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
154 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
155 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
156 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
157 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
158 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
159 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
160 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
161 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
162 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
163 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
164 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
165 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
166 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
167 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
168 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
169 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
170 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
171 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
172 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
173 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
174 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
175 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
176 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
177 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
178 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
179 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
180 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
181 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
182 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
183 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
192 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
193 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
194 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
195 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
196 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
197 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
198 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
199 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
200 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
201 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
202 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
203 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
208 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
209 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
210 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
211 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
212 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
213 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
214 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
217 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
218 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
219 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
220 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
221 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
222 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
223 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
224 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
225 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
226 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
227 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
228 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
229 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
230 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
231 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
232 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
233 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
234 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
235 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
236 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
237 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
238 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
239 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
240 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
241 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
242 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
243 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
244 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
245 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
246 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
247 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
248 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
249 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
250 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
251 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
252 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
253 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
254 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
255 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
256 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
257 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
258 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
259 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
260 2643221557 Ensifer sp. Root558 Isolate Unclassified
261 2643221568 Rhizobium sp. Root564 Isolate Unclassified
262 2643221618 Ensifer sp. Root231 Isolate Unclassified
263 2643221626 Ensifer sp. Root31 Isolate Unclassified
264 2643221655 Ensifer sp. Root1252 Isolate Unclassified
265 2643221659 Ensifer sp. Root127 Isolate Unclassified
266 2643221668 Ensifer sp. Root423 Isolate Unclassified
267 2643221698 Ensifer sp. Root142 Isolate Unclassified
268 2643221712 Ensifer sp. Root258 Isolate Unclassified
269 2643221723 Ensifer sp. Root278 Isolate Unclassified
270 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
271 2718217927 Rhizobium sp. N324 Isolate Nodule
272 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
273 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
274 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
275 2718218423 Rhizobium sp. N941 Isolate Nodule
276 2721755809 Rhizobium sp. N541 Isolate Nodule
277 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
278 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
279 2751185800 Brucella pituitosa AA2 Isolate Unclassified
280 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
281 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
282 2791355256 Rhizobium sp. M10 Isolate Nodule
283 2791355262 Rhizobium sp. M1 Isolate Nodule
284 2791355265 Rhizobium sp. H4 Isolate Nodule
285 2791355266 Rhizobium sp. L43 Isolate Nodule
286 2802429633 Rhizobium anhuiense J3 Isolate Nodule
287 2802429634 Rhizobium anhuiense S10 Isolate Nodule
288 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
289 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
290 2802429637 Rhizobium anhuiense C15 Isolate Nodule
291 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
292 2838048938 Rhizobium pisi 27/80 Isolate Nodule
293 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
294 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
295 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
296 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
297 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
298 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
299 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
300 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
301 2841760612 Bosea sp. Tri-49 Isolate Nodule
302 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
303 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
304 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
305 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
306 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
307 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
308 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
309 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
310 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
311 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
312 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
313 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
314 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
315 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
316 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
317 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
318 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
319 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
320 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
321 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
322 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
323 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
324 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
325 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
326 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
327 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
328 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
329 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
330 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
331 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
332 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
333 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
334 2844104063 Bosea sp. Tri-39 Isolate Nodule
335 2844163670 Ensifer sp. 1H6 Isolate Unclassified
336 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
337 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
338 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
339 2851182111 Bosea sp. Tri-44 Isolate Nodule
340 2851246043 Bosea sp. Tri-54 Isolate Nodule
341 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
342 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
343 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
344 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
345 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
346 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
347 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
348 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
349 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
350 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
351 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
352 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
353 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
354 2996887358 Rhizobium sp. R711 Isolate Nodule
355 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
356 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
357 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
358 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
359 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
360 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
361 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
362 8005258706 Rhizobium sp. R693 Isolate Nodule
363 8005275841 Rhizobium sp. N4311 Isolate Nodule
364 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
365 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
366 8005321885 Rhizobium sp. R72 Isolate Nodule
367 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
368 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
369 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
370 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
371 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
372 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
373 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
374 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
375 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
376 8056382006 Rhizobium croatiense 13T Isolate Nodule
377 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule
378 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 70.37
Metatranscriptomes 0.19
Isolates 29.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.08
Nodule 18.91
Rhizoplane 2.34
Rhizosphere 40.74
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496122_0016454 3300048925 Bacteria 6995
2 JGI25162J39368_1003551 3300002737 Bacteria 4394
3 JGI25152J39213_1012548 3300002773 Bacteria 1809
4 JGI25151J46595_10000134 3300003187 Bacteria 98987
5 JGI25165J46597_1000881 3300003214 Bacteria 21176
6 JGI25165J46597_1002614 3300003214 Bacteria 5446
7 JGI25153J46596_10007156 3300003215 Bacteria 5534
8 JGI25153J46596_10015431 3300003215 Bacteria 3113
9 rootH2_10081109 3300003320 Bacteria 1430
10 rootH2_10142689 3300003320 Bacteria 1014
11 rootH2_10267967 3300003320 Bacteria 1463
12 rootL2_10029532 3300003322 Bacteria 2459
13 rootL2_10029533 3300003322 Bacteria 1356
14 rootH1_10073190 3300003316 Bacteria 2664
15 rootH1_10073190 3300003323 Bacteria 1246
16 rootH1_10266958 3300003323 Bacteria 1125
17 JGI25160J50197_1000369 3300003354 Bacteria 29458
18 JGI25160J50197_1000564 3300003354 Bacteria 20961
19 JGI25161J50226_1004760 3300003374 Bacteria 2781
20 Ga0055526_1002122 3300003771 Bacteria 13611
21 Ga0055526_1010347 3300003771 Bacteria 4355
22 Ga0055524_1005781 3300003775 Bacteria 5465
23 Ga0055524_1006429 3300003775 Bacteria 5092
24 Ga0055524_1008582 3300003775 Bacteria 4237
25 Ga0055528_1003390 3300003790 Bacteria 8035
26 Ga0055528_1003861 3300003790 Bacteria 7374
27 Ga0055528_1024816 3300003790 Bacteria 1783
28 Ga0055540_1010744 3300003792 Bacteria 3022
29 Ga0055543_1003895 3300004625 Bacteria 4219
30 Ga0065165_1001223 3300005262 Bacteria 29493
31 Ga0065165_1015864 3300005262 Bacteria 2852
32 Ga0070659_100100630 3300005366 Bacteria 2326
33 Ga0070659_100906917 3300005366 Bacteria 770
34 Ga0070711_100295606 3300005439 Bacteria 1286
35 Ga0070700_100050826 3300005441 Bacteria 2578
36 Ga0070679_100593647 3300005530 Bacteria 1051
37 Ga0070684_100082568 3300005535 Bacteria 2845
38 Ga0068853_100125499 3300005539 Bacteria 2292
39 Ga0070695_100002040 3300005545 Bacteria 11538
40 Ga0070665_100079061 3300005548 Bacteria 3295
41 Ga0068855_100490390 3300005563 Bacteria 1336
42 Ga0070664_100188963 3300005564 Bacteria 1834
43 Ga0068857_100238718 3300005577 Bacteria 1664
44 Ga0068856_100761107 3300005614 Bacteria 988
45 Ga0068852_100096649 3300005616 Bacteria 2656
46 Ga0068851_10040779 3300005834 Bacteria 2334
47 Ga0081540_1130993 3300005983 Bacteria 1024
48 Ga0075365_10025234 3300006038 Bacteria 3761
49 Ga0075365_10107837 3300006038 Bacteria 1912
50 Ga0075365_10238215 3300006038 Bacteria 1278
51 Ga0075368_10001565 3300006042 Bacteria 7346
52 Ga0075368_10035635 3300006042 Bacteria 1943
53 Ga0075363_100012268 3300006048 Bacteria 4126
54 Ga0075363_100187523 3300006048 Bacteria 1179
55 Ga0075364_10000121 3300006051 Bacteria 32388
56 Ga0075364_10125685 3300006051 Bacteria 1719
57 Ga0075364_10180848 3300006051 Bacteria 1427
58 Ga0070712_100110920 3300006175 Bacteria 2047
59 Ga0075362_10000256 3300006177 Bacteria 14791
60 Ga0075367_10001287 3300006178 Bacteria 10608
61 Ga0075367_10018091 3300006178 Bacteria 3881
62 Ga0075367_10408995 3300006178 Bacteria 858
63 Ga0075369_10020452 3300006186 Bacteria 2711
64 Ga0075366_10038848 3300006195 Bacteria 2811
65 Ga0075370_10013367 3300006353 Bacteria 4361
66 Ga0105240_10000013 3300009093 Bacteria 483458
67 Ga0111539_10778053 3300009094 Bacteria 1114
68 Ga0105243_10859204 3300009148 Bacteria 899
69 Ga0105248_10186474 3300009177 Bacteria 2337
70 Ga0105237_10198325 3300009545 Bacteria 2007
71 Ga0105237_10321165 3300009545 Bacteria 1552
72 Ga0105238_10056325 3300009551 Bacteria 3945
73 Ga0105249_11167707 3300009553 Bacteria 841
74 Ga0105239_10186294 3300010375 Bacteria 2323
75 Ga0105239_10215214 3300010375 Bacteria 2154
76 Ga0157371_10079136 3300013102 Bacteria 2328
77 Ga0157370_10000209 3300013104 Bacteria 74351
78 Ga0157369_10073848 3300013105 Bacteria 3658
79 Ga0157369_10109902 3300013105 Bacteria 2931
80 Ga0157369_10164875 3300013105 Bacteria 2338
81 Ga0171463_1004 3300013249 Bacteria 437207
82 Ga0157372_10112632 3300013307 Bacteria 3117
83 Ga0183362_10031 3300015683 Bacteria 1956
84 Ga0183363_1088 3300015690 Bacteria 27664
85 Ga0206353_10283733 3300020082 Bacteria 715
86 Ga0209437_100107 3300025233 Bacteria 218656
87 Ga0207425_1011860 3300025245 Bacteria 2063
88 Ga0209677_100297 3300025253 Bacteria 32532
89 Ga0209759_1000181 3300025256 Bacteria 103230
90 Ga0209129_1001169 3300025258 Bacteria 15122
91 Ga0209129_1017127 3300025258 Bacteria 1432
92 Ga0209233_1000072 3300025261 Bacteria 363074
93 Ga0209233_1000440 3300025261 Bacteria 28932
94 Ga0209673_1000048 3300025273 Bacteria 287976
95 Ga0209673_1000448 3300025273 Bacteria 70096
96 Ga0209673_1000505 3300025273 Bacteria 64374
97 Ga0209673_1006468 3300025273 Bacteria 5653
98 Ga0209130_1031120 3300025284 Bacteria 1097
99 Ga0209675_1019375 3300025291 Bacteria 1874
100 Ga0209025_1001818 3300025294 Bacteria 25116
101 Ga0209025_1018076 3300025294 Bacteria 4028
102 Ga0209025_1103579 3300025294 Bacteria 894
103 Ga0209564_1000375 3300025295 Bacteria 82204
104 Ga0209564_1004975 3300025295 Bacteria 7830
105 Ga0209564_1006118 3300025295 Bacteria 6606
106 Ga0209564_1034837 3300025295 Bacteria 1468
107 Ga0209758_1000342 3300025297 Bacteria 86095
108 Ga0209758_1003614 3300025297 Bacteria 13833
109 Ga0209256_1000809 3300025299 Bacteria 40091
110 Ga0209256_1000852 3300025299 Bacteria 38024
111 Ga0209256_1001067 3300025299 Bacteria 31762
112 Ga0209256_1010932 3300025299 Bacteria 3717
113 Ga0207426_1000037 3300025302 Bacteria 442735
114 Ga0207426_1000039 3300025302 Bacteria 439937
115 Ga0209051_1004699 3300025303 Bacteria 8304
116 Ga0209051_1018668 3300025303 Bacteria 3060
117 Ga0207699_10092788 3300025906 Bacteria 1899
118 Ga0207695_10000044 3300025913 Bacteria 440819
119 Ga0207671_10220943 3300025914 Bacteria 1484
120 Ga0207671_10338512 3300025914 Bacteria 1192
121 Ga0207693_10261936 3300025915 Bacteria 1356
122 Ga0207700_10034175 3300025928 Bacteria 3647
123 Ga0207690_10322600 3300025932 Bacteria 1214
124 Ga0207667_10138505 3300025949 Bacteria 2506
125 Ga0207640_10133826 3300025981 Bacteria 1796
126 Ga0207640_10347247 3300025981 Bacteria 1191
127 Ga0207677_10602237 3300026023 Bacteria 964
128 Ga0207708_10057450 3300026075 Bacteria 2968
129 Ga0207702_10072355 3300026078 Bacteria 2971
130 Ga0207674_10243907 3300026116 Bacteria 1744
131 Ga0207675_100325415 3300026118 Unclassified 1502
132 Ga0209371_1001242 3300027312 Bacteria 18244
133 Ga0209588_1001850 3300027671 Bacteria 5644
134 Ga0209813_10000670 3300027866 Bacteria 7831
135 Ga0209813_10042787 3300027866 Bacteria 1386
136 Ga0209813_10070326 3300027866 Bacteria 1136
137 Ga0268266_10060437 3300028379 Bacteria 3267
138 Ga0268266_10343957 3300028379 Bacteria 1400
139 Ga0268256_1000890 3300030500 Bacteria 20629
140 Ga0307409_100248399 3300031995 Bacteria 1625
141 Ga0307416_100152608 3300032002 Bacteria 2121
142 Ga0307411_10033544 3300032005 Bacteria 3185
143 Ga0373925_0089523 3300037068 Bacteria 2351
144 Ga0395900_0029421 3300037418 Bacteria 5635
145 Ga0395905_0000168 3300037471 Bacteria 107034
146 Ga0395905_0144442 3300037471 Bacteria 2239
147 Ga0395901_0526312 3300038443 Bacteria 1200
148 Ga0439465_0005728 3300041413 Bacteria 3953
149 Ga0451789_0908635 3300041443 Bacteria 1242
150 Ga0451833_0646044 3300041491 Bacteria 882
151 Ga0451835_0734409 3300041492 Bacteria 3658
152 Ga0451839_0203472 3300041496 Bacteria 1168
153 Ga0451841_0374368 3300041498 Bacteria 2810
154 Ga0451845_0757317 3300041501 Bacteria 1701
155 Ga0451847_0567405 3300041503 Bacteria 1010
156 Ga0451849_0465561 3300041505 Bacteria 796
157 Ga0451851_0275297 3300041507 Bacteria 1207
158 Ga0451851_0669320 3300041507 Bacteria 3802
159 Ga0451843_0541141 3300041509 Bacteria 1093
160 Ga0451853_2346071 3300041512 Bacteria 1580
161 Ga0439448_0091500 3300042005 Bacteria 1028
162 Ga0451576_0009782 3300045051 Bacteria 11082
163 Ga0495592_0009189 3300046454 Bacteria 7436
164 Ga0495603_0005167 3300046455 Bacteria 7794
165 Ga0495603_0193855 3300046455 Bacteria 1174
166 Ga0495590_0044895 3300046457 Bacteria 1541
167 Ga0495591_007672 3300046458 Bacteria 4543
168 Ga0495629_0000175 3300046459 Bacteria 57283
169 Ga0495629_0045032 3300046459 Bacteria 3096
170 Ga0495638_0026425 3300046460 Bacteria 3761
171 Ga0495638_0029824 3300046460 Bacteria 3517
172 Ga0495641_0015195 3300046461 Bacteria 4127
173 Ga0495641_0116036 3300046461 Bacteria 1194
174 Ga0495653_0004485 3300046463 Bacteria 11274
175 Ga0495653_0021648 3300046463 Bacteria 5207
176 Ga0495650_0023617 3300046471 Bacteria 2924
177 Ga0495650_0081334 3300046471 Bacteria 1248
178 Ga0495580_0000125 3300046472 Bacteria 52763
179 Ga0495580_0005761 3300046472 Bacteria 10173
180 Ga0495580_0026806 3300046472 Bacteria 4197
181 Ga0495580_0085789 3300046472 Bacteria 2192
182 Ga0495582_0011424 3300046473 Bacteria 4891
183 Ga0495605_0029979 3300046474 Bacteria 2793
184 Ga0495605_0191866 3300046474 Bacteria 894
185 Ga0495662_0049314 3300046476 Bacteria 2032
186 Ga0495662_0080225 3300046476 Bacteria 1587
187 Ga0495664_0022911 3300046477 Bacteria 3622
188 Ga0495664_0480926 3300046477 Bacteria 742
189 Ga0495594_0306940 3300046499 Bacteria 904
190 Ga0495596_0154365 3300046500 Bacteria 892
191 Ga0495607_0004064 3300046501 Bacteria 10958
192 Ga0495583_0020939 3300046506 Bacteria 3371
193 Ga0495606_0001911 3300046507 Bacteria 25953
194 Ga0495606_0054311 3300046507 Bacteria 2594
195 Ga0495610_0029955 3300046512 Bacteria 2858
196 Ga0495616_0070075 3300046513 Bacteria 1698
197 Ga0495616_0138714 3300046513 Bacteria 1109
198 Ga0495618_0085297 3300046514 Bacteria 2018
199 Ga0495620_0005644 3300046515 Bacteria 6964
200 Ga0495620_0008976 3300046515 Bacteria 5341
201 Ga0495628_0033478 3300046516 Bacteria 4141
202 Ga0495628_0119612 3300046516 Bacteria 2021
203 Ga0495630_0163866 3300046517 Bacteria 1692
204 Ga0495632_0011658 3300046519 Bacteria 5120
205 Ga0495632_0092674 3300046519 Bacteria 1430
206 Ga0495643_0065244 3300046522 Bacteria 1922
207 Ga0495648_0044917 3300046524 Bacteria 2753
208 Ga0495648_0080774 3300046524 Bacteria 1851
209 Ga0495666_0005485 3300046526 Bacteria 6389
210 Ga0495666_0027384 3300046526 Bacteria 2805
211 Ga0495642_0232013 3300046528 Bacteria 806
212 Ga0495652_0250524 3300046529 Bacteria 1313
213 Ga0495654_0085435 3300046530 Bacteria 1472
214 Ga0495640_0055704 3300046533 Bacteria 2704
215 Ga0495587_0042128 3300046536 Bacteria 2723
216 Ga0495597_0006281 3300046542 Bacteria 6157
217 Ga0495645_0010790 3300046543 Bacteria 6418
218 Ga0495633_0065070 3300046558 Bacteria 1704
219 Ga0495656_0349431 3300046615 Bacteria 766
220 Ga0495668_0001167 3300046616 Bacteria 26733
221 Ga0495668_0069784 3300046616 Bacteria 1932
222 Ga0495634_0040210 3300046642 Bacteria 3181
223 Ga0495611_0092237 3300046648 Bacteria 1401
224 Ga0495611_0161692 3300046648 Bacteria 1046
225 Ga0495611_0223456 3300046648 Bacteria 876
226 Ga0495625_0016290 3300046660 Bacteria 5853
227 Ga0495625_0077159 3300046660 Bacteria 2328
228 Ga0495635_0045042 3300046663 Bacteria 3043
229 Ga0495661_0004632 3300046665 Bacteria 9895
230 Ga0495661_0014631 3300046665 Bacteria 5254
231 Ga0495661_0200066 3300046665 Bacteria 1046
232 Ga0495588_0023656 3300046674 Bacteria 3044
233 Ga0495599_0023573 3300046678 Bacteria 3848
234 Ga0495623_0282808 3300046679 Bacteria 922
235 Ga0495646_0005123 3300046680 Bacteria 8266
236 Ga0495646_0028293 3300046680 Bacteria 3511
237 Ga0495613_0006432 3300046689 Bacteria 8781
238 Ga0495613_0052005 3300046689 Bacteria 3018
239 Ga0495624_0061382 3300046690 Bacteria 2355
240 Ga0495624_0080250 3300046690 Bacteria 2021
241 Ga0495624_0200824 3300046690 Bacteria 1211
242 Ga0495670_0308914 3300046691 Bacteria 848
243 Ga0495671_0328757 3300046692 Bacteria 734
244 Ga0495649_0001259 3300046694 Bacteria 19496
245 Ga0495660_0086648 3300046810 Bacteria 1634
246 Ga0495660_0119111 3300046810 Bacteria 1338
247 Ga0495660_0279183 3300046810 Bacteria 765
248 Ga0495581_0038603 3300047315 Bacteria 2763
249 Ga0495604_0057149 3300047317 Bacteria 3001
250 Ga0495674_0024894 3300047319 Bacteria 5494
251 Ga0495674_0174910 3300047319 Bacteria 1789
252 Ga0495674_0276235 3300047319 Bacteria 1377
253 Ga0495672_0118178 3300047320 Bacteria 1413
254 Ga0495676_0005079 3300047321 Bacteria 12072
255 Ga0495676_0013848 3300047321 Bacteria 7232
256 Ga0495676_0069005 3300047321 Bacteria 2729
257 Ga0495680_0005512 3300047322 Bacteria 11885
258 Ga0495683_0027246 3300047323 Bacteria 2922
259 Ga0495683_0070778 3300047323 Bacteria 1712
260 Ga0495687_027972 3300047443 Bacteria 2630
261 Ga0495675_0319580 3300047444 Bacteria 918
262 Ga0495679_000210 3300047446 Bacteria 50398
263 Ga0495679_003961 3300047446 Bacteria 6977
264 Ga0495681_0069677 3300047470 Bacteria 1597
265 Ga0495684_0102277 3300047471 Bacteria 2166
266 Ga0495686_0047007 3300047472 Bacteria 2726
267 Ga0495686_0051276 3300047472 Bacteria 2590
268 Ga0495686_0060157 3300047472 Bacteria 2362
269 Ga0495593_0008878 3300047673 Bacteria 5832
270 Ga0495593_0038478 3300047673 Bacteria 2583
271 Ga0495602_0167446 3300048088 Bacteria 1709
272 Ga0495614_0011277 3300048089 Bacteria 3932
273 Ga0495626_0008329 3300048091 Bacteria 5696
274 Ga0495626_0169160 3300048091 Bacteria 912
275 Ga0496100_0003704 3300048903 Bacteria 8006
276 Ga0496101_0030492 3300048904 Bacteria 3781
277 Ga0496101_0091936 3300048904 Bacteria 2258
278 Ga0496102_0006471 3300048905 Bacteria 9986
279 Ga0496102_1051334 3300048905 Bacteria 734
280 Ga0496103_0016270 3300048906 Bacteria 4439
281 Ga0496104_0807075 3300048907 Bacteria 844
282 Ga0496104_1084410 3300048907 Bacteria 704
283 Ga0496105_0267212 3300048908 Bacteria 1382
284 Ga0496106_0023040 3300048909 Bacteria 4625
285 Ga0496116_0000097 3300048919 Bacteria 200658
286 Ga0496117_0006353 3300048920 Bacteria 12005
287 Ga0496117_0080793 3300048920 Bacteria 2136
288 Ga0496117_0247757 3300048920 Bacteria 974
289 Ga0496118_0010815 3300048921 Bacteria 8988
290 Ga0496118_0075368 3300048921 Bacteria 2406
291 Ga0496118_0156738 3300048921 Bacteria 1415
292 Ga0496119_0016225 3300048922 Bacteria 5685
293 Ga0496119_0021204 3300048922 Bacteria 4705
294 Ga0496119_0043460 3300048922 Bacteria 2838
295 Ga0496119_0134413 3300048922 Bacteria 1343
296 Ga0496119_0175883 3300048922 Bacteria 1126
297 Ga0496120_0004337 3300048923 Bacteria 11983
298 Ga0496120_0020634 3300048923 Bacteria 4179
299 Ga0496121_0000001 3300048924 Bacteria 1830318
300 Ga0496121_0010219 3300048924 Bacteria 10624
301 Ga0496121_0032445 3300048924 Bacteria 4746
302 Ga0496121_0034693 3300048924 Bacteria 4537
303 Ga0496121_0040221 3300048924 Bacteria 4105
304 Ga0496121_0047723 3300048924 Bacteria 3650
305 Ga0496121_0092291 3300048924 Bacteria 2360
306 Ga0496122_0003171 3300048925 Bacteria 21952
307 Ga0496122_0052706 3300048925 Bacteria 3076
308 Ga0496122_0055657 3300048925 Bacteria 2956
309 Ga0496122_0093611 3300048925 Bacteria 2037
310 Ga0496122_0280619 3300048925 Bacteria 911
311 Ga0496123_0016208 3300048926 Bacteria 6067
312 Ga0496123_0044313 3300048926 Bacteria 3043
313 Ga0496123_0046218 3300048926 Bacteria 2954
314 Ga0496124_0000413 3300048927 Bacteria 76781
315 Ga0496124_0090882 3300048927 Bacteria 2489
316 Ga0496124_0229087 3300048927 Bacteria 1391
317 Ga0496125_0000401 3300048928 Bacteria 80953
318 Ga0496125_0208384 3300048928 Bacteria 1272
319 Ga0496125_0220784 3300048928 Bacteria 1221
320 Ga0496126_0000119 3300048929 Bacteria 184211
321 Ga0496126_0019451 3300048929 Bacteria 6687
322 Ga0496126_0085072 3300048929 Bacteria 2788
323 Ga0496126_0092523 3300048929 Bacteria 2657
324 Ga0496126_0295939 3300048929 Bacteria 1337
325 Ga0495678_065135 3300049459 Bacteria 1354
326 Ga0495678_138220 3300049459 Bacteria 800
327 Ga0495682_0055433 3300049460 Bacteria 1437
328 Ga0501032_0512853 3300049569 Bacteria 766
329 Ga0501033_0000361 3300049570 Bacteria 43373
330 Ga0501280_043634 3300049776 Bacteria 734
331 Ga0501035_0021342 3300049822 Bacteria 5953
332 nmdc:mga03683_1698_c1 3300050489 Bacteria 6634
333 nmdc:mga03n38_51438_c1 3300050490 Bacteria 1840
334 nmdc:mga00v17_134640_c1 3300050491 Bacteria 1581
335 nmdc:mga0yw44_232252_c1 3300050492 Bacteria 1224
336 nmdc:mga0yw44_5578_c1 3300050492 Bacteria 5972
337 nmdc:mga0k408_5566_c1 3300050493 Bacteria 6701
338 nmdc:mga06z11_118134_c1 3300050494 Bacteria 1476
339 nmdc:mga06z11_4144_c1 3300050494 Bacteria 5671
340 nmdc:mga06z11_67855_c1 3300050494 Bacteria 1878
341 nmdc:mga06z11_736_c1 3300050494 Bacteria 11974
342 nmdc:mga06z11_83453_c1 3300050494 Bacteria 1720
343 nmdc:mga04h51_718_c1 3300050495 Bacteria 7687
344 nmdc:mga04h51_77110_c1 3300050495 Bacteria 1176
345 nmdc:mga04h51_89413_c1 3300050495 Bacteria 1106
346 nmdc:mga07m45_5823_c1 3300050496 Bacteria 6179
347 nmdc:mga08y16_462262_c1 3300050511 Bacteria 1293
348 nmdc:mga0sz30_6412_c2 3300050516 Bacteria 1378
349 nmdc:mga0sz30_6698_c1 3300050516 Bacteria 4290
350 Ga0500641_0190728 3300053096 Bacteria 877
351 Ga0500569_003185 3300053109 Bacteria 3321
352 Ga0500618_000373 3300053125 Bacteria 30954
353 Ga0500618_004147 3300053125 Bacteria 4738
354 Ga0500618_008488 3300053125 Bacteria 2862
355 Ga0500628_036658 3300053129 Bacteria 1098
356 Ga0500642_0003953 3300053130 Bacteria 4570
357 Ga0500658_0000867 3300053134 Bacteria 12415
358 Ga0500658_0004355 3300053134 Bacteria 5306
359 Ga0500659_0136211 3300053135 Bacteria 1238
360 Ga0500586_038653 3300053145 Bacteria 1609
361 Ga0500604_0031201 3300053151 Bacteria 1563
362 Ga0500616_0017869 3300053153 Bacteria 4016
363 Ga0500633_0006375 3300053160 Bacteria 2889
364 2510133295 2510065019 Bacteria 6903379
365 2510246276 2510065045 Bacteria 7761063
366 2510841822 2510461069 Bacteria 5505000
367 2510894665 2510461076 Bacteria 8618824
368 2511135833 2510917022 Bacteria 6504556
369 2511200072 2510917030 Bacteria 7460662
370 2511391545 2511231027 Bacteria 5013807
371 2513577264 2513237085 Bacteria 7695351
372 2513634478 2513237093 Bacteria 7545552
373 2513708747 2513237103 Bacteria 7647401
374 2514021614 2513237162 Bacteria 7468464
375 2515112256 2515075009 Bacteria 7288508
376 2515637194 2515154113 Bacteria 7807172
377 2515639757 2515154114 Bacteria 7848616
378 2515657403 2515154116 Bacteria 7552979
379 2515738594 2515154134 Bacteria 7220242
380 2517035987 2516653077 Bacteria 7555578
381 2517076381 2516653085 Bacteria 7346596
382 2563061844 2562617112 Bacteria 10918404
383 2585224332 2582581298 Bacteria 7315509
384 2585272077 2582581307 Bacteria 6597605
385 2585280602 2582581308 Bacteria 7413247
386 2585334279 2582581316 Bacteria 7774528
387 2585527623 2585427526 Bacteria 7258840
388 2585537524 2585427528 Bacteria 6842387
389 2585546453 2585427529 Bacteria 7395659
390 2585563378 2585427531 Bacteria 6992870
391 2585835474 2585427593 Bacteria 7141551
392 2585909115 2585427609 Bacteria 6667127
393 2587984529 2585428125 Bacteria 6662905
394 2599723551 2599185236 Bacteria 6875203
395 2617384958 2617270742 Bacteria 6808054
396 2643807997 2643221557 Bacteria 7184309
397 2643858131 2643221568 Bacteria 5187270
398 2644107436 2643221618 Bacteria 7717186
399 2644150707 2643221626 Bacteria 8069654
400 2644308831 2643221655 Bacteria 7722067
401 2644335652 2643221659 Bacteria 7890716
402 2644379431 2643221668 Bacteria 7306521
403 2644540057 2643221698 Bacteria 7756764
404 2644614772 2643221712 Bacteria 7729434
405 2644677026 2643221723 Bacteria 7095460
406 2713478321 2711768613 Bacteria 11048459
407 2719385770 2718217927 Bacteria 6972593
408 2719665588 2718217997 Bacteria 6740740
409 2720492008 2718218199 Bacteria 6740745
410 2720613276 2718218232 Bacteria 6720332
411 2721399550 2718218423 Bacteria 6438183
412 2724038363 2721755809 Bacteria 6438790
413 2739036486 2738541333 Bacteria 7106503
414 2739352109 2738543031 Bacteria 5769731
415 2753359034 2751185800 Bacteria 5467370
416 2753569697 2751185846 Bacteria 7242164
417 2766063152 2765235942 Bacteria 7445910
418 2793294655 2791355256 Bacteria 6798008
419 2793335749 2791355262 Bacteria 6774204
420 2793356770 2791355265 Bacteria 6539969
421 2793361188 2791355266 Bacteria 7116587
422 2806046036 2802429633 Bacteria 7341974
423 2806054415 2802429634 Bacteria 7083200
424 2806060420 2802429635 Bacteria 7650140
425 2806065123 2802429636 Bacteria 7597525
426 2806072387 2802429637 Bacteria 7067217
427 2838021489 2838016132 Bacteria 6577831
428 2838052442 2838048938 Bacteria 6044578
429 2838666609 2838661181 Bacteria 7385261
430 2838679627 2838675328 Bacteria 4909118
431 2838689475 2838686498 Bacteria 7807632
432 2838717604 2838714209 Bacteria 5525906
433 2838724195 2838719591 Bacteria 5523910
434 2838729487 2838724970 Bacteria 4908691
435 2838730808 2838729681 Bacteria 7400765
436 2838743749 2838742623 Bacteria 7396178
437 2841761527 2841760612 Bacteria 6454112
438 2841857825 2841851746 Bacteria 7532261
439 2842110517 2842110456 Bacteria 7656360
440 2842134836 2842130223 Bacteria 4909145
441 2842156861 2842152218 Bacteria 4908957
442 2842157438 2842156927 Bacteria 6894975
443 2842164629 2842163707 Bacteria 6916235
444 2842172875 2842170452 Bacteria 5525737
445 2842180457 2842175837 Bacteria 4908771
446 2842180977 2842180545 Bacteria 6888678
447 2842192105 2842187318 Bacteria 5524014
448 2842216420 2842211629 Bacteria 5523832
449 2842217208 2842217011 Bacteria 7497767
450 2842229141 2842224351 Bacteria 5524473
451 2842230964 2842229732 Bacteria 7475766
452 2842244928 2842243621 Bacteria 7421798
453 2842258741 2842257432 Bacteria 7401195
454 2842266066 2842264693 Bacteria 6472963
455 2842273495 2842271015 Bacteria 7807131
456 2842304272 2842304105 Bacteria 7023636
457 2842316686 2842311132 Bacteria 6616990
458 2842324646 2842324504 Bacteria 9364110
459 2842345857 2842341865 Bacteria 7003929
460 2842348924 2842348783 Bacteria 9002918
461 2842429297 2842428310 Bacteria 6767288
462 2842435910 2842434925 Bacteria 6502746
463 2842442257 2842441272 Bacteria 6769273
464 2842450548 2842447887 Bacteria 6754142
465 2842457370 2842454564 Bacteria 8730687
466 2842463718 2842462802 Bacteria 6588055
467 2842470239 2842469257 Bacteria 6752936
468 2842488015 2842482326 Bacteria 7212537
469 2842876143 2842871566 Bacteria 4827117
470 2844104552 2844104063 Bacteria 6440972
471 2844166719 2844163670 Bacteria 7266046
472 2844459184 2844454524 Bacteria 7952546
473 2847420883 2847417321 Bacteria 6913799
474 2848995714 2848992105 Bacteria 6810864
475 2851184582 2851182111 Bacteria 6047226
476 2851247540 2851246043 Bacteria 6439203
477 2855878247 2855872281 Bacteria 6964271
478 2857518698 2857516855 Bacteria 7787325
479 2870074369 2870068957 Bacteria 8925310
480 2919169892 2919166419 Bacteria 4952238
481 2919410944 2919408235 Bacteria 6149349
482 2921643797 2921643360 Bacteria 11448031
483 2929140365 2929138655 Bacteria 5810547
484 2933011457 2933006813 Bacteria 4912075
485 2933571548 2933570622 Bacteria 7023390
486 2933586546 2933586486 Bacteria 7667493
487 2935904721 2935901341 Bacteria 7341747
488 2941502283 2941499720 Bacteria 7599444
489 2978972353 2978969890 Bacteria 5400756
490 2996891687 2996887358 Bacteria 5795980
491 3005421754 3005416602 Bacteria 7064308
492 3005447501 3005445848 Bacteria 6906074
493 639648512 639633055 Bacteria 7751309
494 642594344 642555112 Bacteria 8676562
495 642622918 642555113 Bacteria 8214658
496 643827473 643692032 Bacteria 6891900
497 8005248376 8005246636 Bacteria 4933972
498 8005263017 8005258706 Bacteria 6184835
499 8005280547 8005275841 Bacteria 6929066
500 8005314512 8005307578 Bacteria 7395396
501 8005319546 8005314921 Bacteria 7072929
502 8005326214 8005321885 Bacteria 5795980
503 8005462917 8005460587 Bacteria 7157962
504 8005557739 8005556819 Bacteria 6908598
505 8005568910 8005563573 Bacteria 7153261
506 8005574728 8005570704 Bacteria 6957481
507 8005621689 8005619151 Bacteria 7030230
508 8005687585 8005682033 Bacteria 6726518
509 8018166825 8018163183 Bacteria 7277977
510 8023685412 8023680758 Bacteria 7729763
511 8054463458 8054460903 Bacteria 4872905
512 8056388120 8056382006 Bacteria 6408074
513 8057530294 8057529695 Bacteria 6306553
514 8057875090 8057874678 Bacteria 7494653
515 Ga0496122_0016454
516 JGI25162J39368_1003551
517 JGI25152J39213_1012548
518 JGI25151J46595_10000134
519 JGI25165J46597_1000881
520 JGI25165J46597_1002614
521 JGI25153J46596_10007156
522 JGI25153J46596_10015431
523 rootH2_10081109
524 rootH2_10142689
525 rootH2_10267967
526 rootL2_10029532
527 rootL2_10029533
528 rootH1_10073190
529 rootH1_10266958
530 JGI25160J50197_1000369
531 JGI25160J50197_1000564
532 JGI25161J50226_1004760
533 Ga0055526_1002122
534 Ga0055526_1010347
535 Ga0055524_1005781
536 Ga0055524_1006429
537 Ga0055524_1008582
538 Ga0055528_1003390
539 Ga0055528_1003861
540 Ga0055528_1024816
541 Ga0055540_1010744
542 Ga0055543_1003895
543 Ga0065165_1001223
544 Ga0065165_1015864
545 Ga0070659_100100630
546 Ga0070659_100906917
547 Ga0070711_100295606
548 Ga0070700_100050826
549 Ga0070679_100593647
550 Ga0070684_100082568
551 Ga0068853_100125499
552 Ga0070695_100002040
553 Ga0070665_100079061
554 Ga0068855_100490390
555 Ga0070664_100188963
556 Ga0068857_100238718
557 Ga0068856_100761107
558 Ga0068852_100096649
559 Ga0068851_10040779
560 Ga0081540_1130993
561 Ga0075365_10025234
562 Ga0075365_10107837
563 Ga0075365_10238215
564 Ga0075368_10001565
565 Ga0075368_10035635
566 Ga0075363_100012268
567 Ga0075363_100187523
568 Ga0075364_10000121
569 Ga0075364_10125685
570 Ga0075364_10180848
571 Ga0070712_100110920
572 Ga0075362_10000256
573 Ga0075367_10001287
574 Ga0075367_10018091
575 Ga0075367_10408995
576 Ga0075369_10020452
577 Ga0075366_10038848
578 Ga0075370_10013367
579 Ga0105240_10000013
580 Ga0111539_10778053
581 Ga0105243_10859204
582 Ga0105248_10186474
583 Ga0105237_10198325
584 Ga0105237_10321165
585 Ga0105238_10056325
586 Ga0105249_11167707
587 Ga0105239_10186294
588 Ga0105239_10215214
589 Ga0157371_10079136
590 Ga0157370_10000209
591 Ga0157369_10073848
592 Ga0157369_10109902
593 Ga0157369_10164875
594 Ga0171463_1004
595 Ga0157372_10112632
596 Ga0183362_10031
597 Ga0183363_1088
598 Ga0206353_10283733
599 Ga0209437_100107
600 Ga0207425_1011860
601 Ga0209677_100297
602 Ga0209759_1000181
603 Ga0209129_1001169
604 Ga0209129_1017127
605 Ga0209233_1000072
606 Ga0209233_1000440
607 Ga0209673_1000048
608 Ga0209673_1000448
609 Ga0209673_1000505
610 Ga0209673_1006468
611 Ga0209130_1031120
612 Ga0209675_1019375
613 Ga0209025_1001818
614 Ga0209025_1018076
615 Ga0209025_1103579
616 Ga0209564_1000375
617 Ga0209564_1004975
618 Ga0209564_1006118
619 Ga0209564_1034837
620 Ga0209758_1000342
621 Ga0209758_1003614
622 Ga0209256_1000809
623 Ga0209256_1000852
624 Ga0209256_1001067
625 Ga0209256_1010932
626 Ga0207426_1000037
627 Ga0207426_1000039
628 Ga0209051_1004699
629 Ga0209051_1018668
630 Ga0207699_10092788
631 Ga0207695_10000044
632 Ga0207671_10220943
633 Ga0207671_10338512
634 Ga0207693_10261936
635 Ga0207700_10034175
636 Ga0207690_10322600
637 Ga0207667_10138505
638 Ga0207640_10133826
639 Ga0207640_10347247
640 Ga0207677_10602237
641 Ga0207708_10057450
642 Ga0207702_10072355
643 Ga0207674_10243907
644 Ga0207675_100325415
645 Ga0209371_1001242
646 Ga0209588_1001850
647 Ga0209813_10000670
648 Ga0209813_10042787
649 Ga0209813_10070326
650 Ga0268266_10060437
651 Ga0268266_10343957
652 Ga0268256_1000890
653 Ga0307409_100248399
654 Ga0307416_100152608
655 Ga0307411_10033544
656 Ga0373925_0089523
657 Ga0395900_0029421
658 Ga0395905_0000168
659 Ga0395905_0144442
660 Ga0395901_0526312
661 Ga0439465_0005728
662 Ga0451789_0908635
663 Ga0451833_0646044
664 Ga0451835_0734409
665 Ga0451839_0203472
666 Ga0451841_0374368
667 Ga0451845_0757317
668 Ga0451847_0567405
669 Ga0451849_0465561
670 Ga0451851_0275297
671 Ga0451851_0669320
672 Ga0451843_0541141
673 Ga0451853_2346071
674 Ga0439448_0091500
675 Ga0451576_0009782
676 Ga0495592_0009189
677 Ga0495603_0005167
678 Ga0495603_0193855
679 Ga0495590_0044895
680 Ga0495591_007672
681 Ga0495629_0000175
682 Ga0495629_0045032
683 Ga0495638_0026425
684 Ga0495638_0029824
685 Ga0495641_0015195
686 Ga0495641_0116036
687 Ga0495653_0004485
688 Ga0495653_0021648
689 Ga0495650_0023617
690 Ga0495650_0081334
691 Ga0495580_0000125
692 Ga0495580_0005761
693 Ga0495580_0026806
694 Ga0495580_0085789
695 Ga0495582_0011424
696 Ga0495605_0029979
697 Ga0495605_0191866
698 Ga0495662_0049314
699 Ga0495662_0080225
700 Ga0495664_0022911
701 Ga0495664_0480926
702 Ga0495594_0306940
703 Ga0495596_0154365
704 Ga0495607_0004064
705 Ga0495583_0020939
706 Ga0495606_0001911
707 Ga0495606_0054311
708 Ga0495610_0029955
709 Ga0495616_0070075
710 Ga0495616_0138714
711 Ga0495618_0085297
712 Ga0495620_0005644
713 Ga0495620_0008976
714 Ga0495628_0033478
715 Ga0495628_0119612
716 Ga0495630_0163866
717 Ga0495632_0011658
718 Ga0495632_0092674
719 Ga0495643_0065244
720 Ga0495648_0044917
721 Ga0495648_0080774
722 Ga0495666_0005485
723 Ga0495666_0027384
724 Ga0495642_0232013
725 Ga0495652_0250524
726 Ga0495654_0085435
727 Ga0495640_0055704
728 Ga0495587_0042128
729 Ga0495597_0006281
730 Ga0495645_0010790
731 Ga0495633_0065070
732 Ga0495656_0349431
733 Ga0495668_0001167
734 Ga0495668_0069784
735 Ga0495634_0040210
736 Ga0495611_0092237
737 Ga0495611_0161692
738 Ga0495611_0223456
739 Ga0495625_0016290
740 Ga0495625_0077159
741 Ga0495635_0045042
742 Ga0495661_0004632
743 Ga0495661_0014631
744 Ga0495661_0200066
745 Ga0495588_0023656
746 Ga0495599_0023573
747 Ga0495623_0282808
748 Ga0495646_0005123
749 Ga0495646_0028293
750 Ga0495613_0006432
751 Ga0495613_0052005
752 Ga0495624_0061382
753 Ga0495624_0080250
754 Ga0495624_0200824
755 Ga0495670_0308914
756 Ga0495671_0328757
757 Ga0495649_0001259
758 Ga0495660_0086648
759 Ga0495660_0119111
760 Ga0495660_0279183
761 Ga0495581_0038603
762 Ga0495604_0057149
763 Ga0495674_0024894
764 Ga0495674_0174910
765 Ga0495674_0276235
766 Ga0495672_0118178
767 Ga0495676_0005079
768 Ga0495676_0013848
769 Ga0495676_0069005
770 Ga0495680_0005512
771 Ga0495683_0027246
772 Ga0495683_0070778
773 Ga0495687_027972
774 Ga0495675_0319580
775 Ga0495679_000210
776 Ga0495679_003961
777 Ga0495681_0069677
778 Ga0495684_0102277
779 Ga0495686_0047007
780 Ga0495686_0051276
781 Ga0495686_0060157
782 Ga0495593_0008878
783 Ga0495593_0038478
784 Ga0495602_0167446
785 Ga0495614_0011277
786 Ga0495626_0008329
787 Ga0495626_0169160
788 Ga0496100_0003704
789 Ga0496101_0030492
790 Ga0496101_0091936
791 Ga0496102_0006471
792 Ga0496102_1051334
793 Ga0496103_0016270
794 Ga0496104_0807075
795 Ga0496104_1084410
796 Ga0496105_0267212
797 Ga0496106_0023040
798 Ga0496116_0000097
799 Ga0496117_0006353
800 Ga0496117_0080793
801 Ga0496117_0247757
802 Ga0496118_0010815
803 Ga0496118_0075368
804 Ga0496118_0156738
805 Ga0496119_0016225
806 Ga0496119_0021204
807 Ga0496119_0043460
808 Ga0496119_0134413
809 Ga0496119_0175883
810 Ga0496120_0004337
811 Ga0496120_0020634
812 Ga0496121_0000001
813 Ga0496121_0010219
814 Ga0496121_0032445
815 Ga0496121_0034693
816 Ga0496121_0040221
817 Ga0496121_0047723
818 Ga0496121_0092291
819 Ga0496122_0003171
820 Ga0496122_0052706
821 Ga0496122_0055657
822 Ga0496122_0093611
823 Ga0496122_0280619
824 Ga0496123_0016208
825 Ga0496123_0044313
826 Ga0496123_0046218
827 Ga0496124_0000413
828 Ga0496124_0090882
829 Ga0496124_0229087
830 Ga0496125_0000401
831 Ga0496125_0208384
832 Ga0496125_0220784
833 Ga0496126_0000119
834 Ga0496126_0019451
835 Ga0496126_0085072
836 Ga0496126_0092523
837 Ga0496126_0295939
838 Ga0495678_065135
839 Ga0495678_138220
840 Ga0495682_0055433
841 Ga0501032_0512853
842 Ga0501033_0000361
843 Ga0501280_043634
844 Ga0501035_0021342
845 nmdc:mga03683_1698_c1
846 nmdc:mga03n38_51438_c1
847 nmdc:mga00v17_134640_c1
848 nmdc:mga0yw44_232252_c1
849 nmdc:mga0yw44_5578_c1
850 nmdc:mga0k408_5566_c1
851 nmdc:mga06z11_118134_c1
852 nmdc:mga06z11_4144_c1
853 nmdc:mga06z11_67855_c1
854 nmdc:mga06z11_736_c1
855 nmdc:mga06z11_83453_c1
856 nmdc:mga04h51_718_c1
857 nmdc:mga04h51_77110_c1
858 nmdc:mga04h51_89413_c1
859 nmdc:mga07m45_5823_c1
860 nmdc:mga08y16_462262_c1
861 nmdc:mga0sz30_6412_c2
862 nmdc:mga0sz30_6698_c1
863 Ga0500641_0190728
864 Ga0500569_003185
865 Ga0500618_000373
866 Ga0500618_004147
867 Ga0500618_008488
868 Ga0500628_036658
869 Ga0500642_0003953
870 Ga0500658_0000867
871 Ga0500658_0004355
872 Ga0500659_0136211
873 Ga0500586_038653
874 Ga0500604_0031201
875 Ga0500616_0017869
876 Ga0500633_0006375
877 2510133295
878 2510246276
879 2510841822
880 2510894665
881 2511135833
882 2511200072
883 2511391545
884 2513577264
885 2513634478
886 2513708747
887 2514021614
888 2515112256
889 2515637194
890 2515639757
891 2515657403
892 2515738594
893 2517035987
894 2517076381
895 2563061844
896 2585224332
897 2585272077
898 2585280602
899 2585334279
900 2585527623
901 2585537524
902 2585546453
903 2585563378
904 2585835474
905 2585909115
906 2587984529
907 2599723551
908 2617384958
909 2643807997
910 2643858131
911 2644107436
912 2644150707
913 2644308831
914 2644335652
915 2644379431
916 2644540057
917 2644614772
918 2644677026
919 2713478321
920 2719385770
921 2719665588
922 2720492008
923 2720613276
924 2721399550
925 2724038363
926 2739036486
927 2739352109
928 2753359034
929 2753569697
930 2766063152
931 2793294655
932 2793335749
933 2793356770
934 2793361188
935 2806046036
936 2806054415
937 2806060420
938 2806065123
939 2806072387
940 2838021489
941 2838052442
942 2838666609
943 2838679627
944 2838689475
945 2838717604
946 2838724195
947 2838729487
948 2838730808
949 2838743749
950 2841761527
951 2841857825
952 2842110517
953 2842134836
954 2842156861
955 2842157438
956 2842164629
957 2842172875
958 2842180457
959 2842180977
960 2842192105
961 2842216420
962 2842217208
963 2842229141
964 2842230964
965 2842244928
966 2842258741
967 2842266066
968 2842273495
969 2842304272
970 2842316686
971 2842324646
972 2842345857
973 2842348924
974 2842429297
975 2842435910
976 2842442257
977 2842450548
978 2842457370
979 2842463718
980 2842470239
981 2842488015
982 2842876143
983 2844104552
984 2844166719
985 2844459184
986 2847420883
987 2848995714
988 2851184582
989 2851247540
990 2855878247
991 2857518698
992 2870074369
993 2919169892
994 2919410944
995 2921643797
996 2929140365
997 2933011457
998 2933571548
999 2933586546
1000 2935904721
1001 2941502283
1002 2978972353
1003 2996891687
1004 3005421754
1005 3005447501
1006 639648512
1007 642594344
1008 642622918
1009 643827473
1010 8005248376
1011 8005263017
1012 8005280547
1013 8005314512
1014 8005319546
1015 8005326214
1016 8005462917
1017 8005557739
1018 8005568910
1019 8005574728
1020 8005621689
1021 8005687585
1022 8018166825
1023 8023685412
1024 8054463458
1025 8056388120
1026 8057530294
1027 8057875090

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01810

LysE

LysE type translocator

57

250

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xzi-assembly1.cif.gz_A cryo-em structure of toc-tic supercomplex from chlamydomonas reinhardtii 0.5353 36 240
5gxb-assembly1.cif.gz_A crystal structure of a lacy/nanobody complex 0.4958 36 238
7xzi-assembly1.cif.gz_A cryo-em structure of toc-tic supercomplex from chlamydomonas reinhardtii 0.4738 36 240
6ob6-assembly1.cif.gz_A human equilibrative nucleoside transporter-1, s-(4-nitrobenzyl)-6-thioinosine bound, merohedrally twinned 0.4538 37 236
6ob7-assembly1.cif.gz_A human equilibrative nucleoside transporter-1, dilazep bound 0.4516 37 236
ID Description Score Start End Superfamily
af_P76264_30_182_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5541 70 236 1.20.1250.20
af_P76264_30_182_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5403 70 236 1.20.1250.20
af_C6TIG3_1_228_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5256 35 238 1.20.1250.20
af_Q2R4J1_1_279_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5068 1 242 1.20.1250.20
af_Q2R4J1_1_279_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5052 1 242 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A850LDA0-F1-model_v4 LysE family translocator 0.8998 35 239 GO:0005886
GO:0015171
AF-E1SN29-F1-model_v4 Lysine exporter protein (LYSE/YGGA) 0.8996 35 238 GO:0005886
GO:0015171
AF-A0A109W5B2-F1-model_v4 Homoserine/homoserine lactone efflux protein 0.8909 35 242 GO:0005886
GO:0042970
AF-A0A4U3BIL5-F1-model_v4 deleted 0.8894 33 195
AF-E3BL22-F1-model_v4 Putative homoserine/homoserine lactone efflux protein 0.8873 35 242 GO:0005886
GO:0042970

Map