F457527

General Info

Members Datasets Scaffolds Average Seq Length
513 201 513 184

Family's Representative Sequence

Representative Sequence 3300005354|Ga0070675_100348362|Ga0070675_1003483621
Length 207
Sequence LPFLDLAASENPMNAPIKKLASKEPTTAWQVRLETPADAAQIETLNADSFGPGRFAKSAYRLREGVAPVAALSFVAMEKMPEGGDVLRGSVRFWPIRVGGHDELLLGPLAVQGDQRGRGIGIALMQAGIAAAQRGSWRAILLVGDEAYYTKVGFSRLPPGRVKFPGPVDQNRILGLSLKAGELLTLSGEVRRAQIDEPVCAVGAGVG

Samples

Sample ID Description Type Environment
1 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
75 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
122 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
123 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
124 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
125 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
126 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
127 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
128 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
129 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
130 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
131 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
132 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
133 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
134 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
135 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
136 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
137 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
138 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
139 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
140 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
145 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
146 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
147 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
148 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
149 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
150 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
151 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
152 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
153 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
154 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
155 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
156 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
157 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
160 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
161 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
162 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
163 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
164 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
178 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
179 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
180 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
183 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
184 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
185 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
186 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
187 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
191 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
192 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
193 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
194 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
195 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
196 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
197 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
198 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
199 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
200 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
201 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.92
Nodule 0
Rhizoplane 0.19
Rhizosphere 96.1
Stem 0
Stem Tuber 0
Unclassified 0.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000246 3300003214 Bacteria 73461
2 JGI25153J46596_10000294 3300003215 Bacteria 37351
3 rootH1_10014299 3300003323 Bacteria 2001
4 Ga0070658_10010177 3300005327 Bacteria 7545
5 Ga0070658_10050899 3300005327 Bacteria 3357
6 Ga0070658_10397818 3300005327 Unclassified 1183
7 Ga0070658_10657869 3300005327 Bacteria 909
8 Ga0070683_100101904 3300005329 Bacteria 2704
9 Ga0070683_101059011 3300005329 Unclassified 779
10 Ga0070670_100120307 3300005331 Bacteria 2265
11 Ga0070670_100146237 3300005331 Unclassified 2045
12 Ga0068869_100002752 3300005334 Bacteria 10645
13 Ga0070666_10012463 3300005335 Bacteria 5363
14 Ga0070666_10028380 3300005335 Bacteria 3672
15 Ga0070666_10422639 3300005335 Bacteria 960
16 Ga0070680_100008036 3300005336 Bacteria 8058
17 Ga0070680_100042149 3300005336 Bacteria 3703
18 Ga0068868_100026354 3300005338 Bacteria 4430
19 Ga0068868_100102667 3300005338 Bacteria 2316
20 Ga0068868_100625310 3300005338 Unclassified 956
21 Ga0070660_100081179 3300005339 Bacteria 2545
22 Ga0070660_100231457 3300005339 Bacteria 1504
23 Ga0070689_101564916 3300005340 Unclassified 598
24 Ga0070691_10240942 3300005341 Bacteria 966
25 Ga0070691_10279022 3300005341 Bacteria 906
26 Ga0070661_100475010 3300005344 Bacteria 998
27 Ga0070675_100022802 3300005354 Bacteria 5002
28 Ga0070675_100348362 3300005354 Bacteria 1313
29 Ga0070675_100795348 3300005354 Bacteria 864
30 Ga0070674_100174923 3300005356 Bacteria 1640
31 Ga0070673_100023157 3300005364 Bacteria 4534
32 Ga0070673_100421174 3300005364 Bacteria 1197
33 Ga0070659_100007350 3300005366 Bacteria 8004
34 Ga0070667_100349329 3300005367 Unclassified 1339
35 Ga0070667_101392506 3300005367 Unclassified 658
36 Ga0070678_100026830 3300005456 Bacteria 3901
37 Ga0070678_100075056 3300005456 Unclassified 2543
38 Ga0070678_100097350 3300005456 Bacteria 2272
39 Ga0070678_100117450 3300005456 Bacteria 2092
40 Ga0070678_100822415 3300005456 Unclassified 845
41 Ga0070662_100158384 3300005457 Bacteria 1769
42 Ga0070681_10000002 3300005458 Bacteria 821814
43 Ga0070681_10072908 3300005458 Unclassified 3396
44 Ga0070681_10114350 3300005458 Bacteria 2637
45 Ga0070681_10590658 3300005458 Bacteria 1025
46 Ga0068867_100007823 3300005459 Bacteria 7559
47 Ga0068867_100025496 3300005459 Bacteria 4242
48 Ga0068867_100254207 3300005459 Bacteria 1430
49 Ga0070685_10254739 3300005466 Bacteria 1164
50 Ga0070679_100003052 3300005530 Bacteria 15301
51 Ga0070679_100008672 3300005530 Bacteria 9582
52 Ga0070679_100160226 3300005530 Bacteria 2225
53 Ga0070684_100350592 3300005535 Bacteria 1358
54 Ga0070684_100442522 3300005535 Bacteria 1201
55 Ga0068853_100004051 3300005539 Bacteria 11281
56 Ga0068853_100189179 3300005539 Unclassified 1869
57 Ga0068853_100323585 3300005539 Bacteria 1430
58 Ga0068853_100411583 3300005539 Bacteria 1267
59 Ga0068853_100466725 3300005539 Bacteria 1189
60 Ga0070693_100186856 3300005547 Unclassified 1338
61 Ga0070665_100003422 3300005548 Bacteria 16956
62 Ga0070665_100011805 3300005548 Bacteria 8823
63 Ga0070665_100021713 3300005548 Bacteria 6455
64 Ga0070665_100077506 3300005548 Bacteria 3330
65 Ga0070665_100094145 3300005548 Bacteria 3001
66 Ga0070665_100345200 3300005548 Bacteria 1494
67 Ga0070665_100503472 3300005548 Unclassified 1222
68 Ga0068855_100019385 3300005563 Bacteria 8172
69 Ga0068855_100045570 3300005563 Bacteria 5187
70 Ga0068855_100083869 3300005563 Bacteria 3691
71 Ga0068855_100157761 3300005563 Bacteria 2577
72 Ga0068855_101676123 3300005563 Unclassified 649
73 Ga0070664_100129958 3300005564 Unclassified 2212
74 Ga0068857_100110071 3300005577 Bacteria 2475
75 Ga0068857_100263307 3300005577 Unclassified 1583
76 Ga0068857_101514095 3300005577 Unclassified 654
77 Ga0068854_100609518 3300005578 Bacteria 933
78 Ga0068856_100024019 3300005614 Bacteria 5930
79 Ga0068856_100055973 3300005614 Bacteria 3892
80 Ga0070702_100054976 3300005615 Bacteria 2293
81 Ga0068852_100100185 3300005616 Bacteria 2613
82 Ga0068859_100244734 3300005617 Bacteria 1883
83 Ga0068864_100060697 3300005618 Bacteria 3274
84 Ga0068866_10013577 3300005718 Bacteria 3578
85 Ga0068861_100088160 3300005719 Bacteria 2443
86 Ga0068851_10297758 3300005834 Unclassified 927
87 Ga0068870_10540166 3300005840 Unclassified 783
88 Ga0068863_100152245 3300005841 Bacteria 2213
89 Ga0068858_100011968 3300005842 Bacteria 8178
90 Ga0068858_100332264 3300005842 Unclassified 1454
91 Ga0068858_101066766 3300005842 Bacteria 793
92 Ga0068860_100091335 3300005843 Bacteria 2901
93 Ga0068860_100203595 3300005843 Bacteria 1919
94 Ga0097621_100000601 3300006237 Bacteria 25372
95 Ga0097621_100588576 3300006237 Unclassified 1016
96 Ga0068871_100000907 3300006358 Bacteria 19735
97 Ga0068871_100015391 3300006358 Bacteria 5723
98 Ga0068871_100016095 3300006358 Bacteria 5620
99 Ga0068871_100106017 3300006358 Bacteria 2359
100 Ga0068871_100126554 3300006358 Unclassified 2163
101 Ga0068871_100220518 3300006358 Bacteria 1643
102 Ga0068871_100271864 3300006358 Bacteria 1480
103 Ga0068871_100907200 3300006358 Unclassified 817
104 Ga0068871_101328095 3300006358 Unclassified 677
105 Ga0068865_100005059 3300006881 Bacteria 7980
106 Ga0068865_100043551 3300006881 Bacteria 3068
107 Ga0097620_100244753 3300006931 Bacteria 1883
108 Ga0097620_100548394 3300006931 Unclassified 1251
109 Ga0105240_10000944 3300009093 Bacteria 51695
110 Ga0105240_10007670 3300009093 Bacteria 15626
111 Ga0105240_10037488 3300009093 Bacteria 6230
112 Ga0105240_10054577 3300009093 Bacteria 5007
113 Ga0105240_10059571 3300009093 Bacteria 4764
114 Ga0105240_10064622 3300009093 Bacteria 4546
115 Ga0105240_10066709 3300009093 Bacteria 4463
116 Ga0105240_10118255 3300009093 Bacteria 3194
117 Ga0105240_10173197 3300009093 Bacteria 2554
118 Ga0105240_10314878 3300009093 Bacteria 1786
119 Ga0105240_10405285 3300009093 Unclassified 1535
120 Ga0105240_10525093 3300009093 Bacteria 1313
121 Ga0105240_11077383 3300009093 Unclassified 856
122 Ga0105245_10045689 3300009098 Bacteria 3911
123 Ga0105245_10103864 3300009098 Bacteria 2634
124 Ga0105245_10147096 3300009098 Bacteria 2224
125 Ga0105243_10005024 3300009148 Bacteria 10375
126 Ga0105243_10441617 3300009148 Bacteria 1218
127 Ga0105241_10045392 3300009174 Bacteria 3334
128 Ga0105241_10060766 3300009174 Bacteria 2908
129 Ga0105241_10089334 3300009174 Bacteria 2427
130 Ga0105241_10129191 3300009174 Unclassified 2044
131 Ga0105241_10406461 3300009174 Bacteria 1195
132 Ga0105241_10899802 3300009174 Unclassified 822
133 Ga0105242_10016461 3300009176 Bacteria 5749
134 Ga0105242_10104576 3300009176 Bacteria 2404
135 Ga0105242_10147231 3300009176 Bacteria 2050
136 Ga0105248_11027074 3300009177 Unclassified 931
137 Ga0105248_11079454 3300009177 Bacteria 907
138 Ga0105237_10043043 3300009545 Bacteria 4551
139 Ga0105237_10055622 3300009545 Bacteria 3963
140 Ga0105237_10228801 3300009545 Unclassified 1860
141 Ga0105237_10242701 3300009545 Bacteria 1803
142 Ga0105237_10307899 3300009545 Bacteria 1587
143 Ga0105237_10317411 3300009545 Bacteria 1561
144 Ga0105238_10024027 3300009551 Bacteria 6215
145 Ga0105238_10043257 3300009551 Bacteria 4557
146 Ga0105238_10056832 3300009551 Bacteria 3925
147 Ga0105238_10186070 3300009551 Bacteria 2053
148 Ga0105238_10218780 3300009551 Unclassified 1880
149 Ga0105238_10725340 3300009551 Bacteria 1007
150 Ga0105238_11194392 3300009551 Bacteria 785
151 Ga0105249_10143393 3300009553 Bacteria 2293
152 Ga0105239_10033641 3300010375 Bacteria 5629
153 Ga0105239_10039521 3300010375 Bacteria 5169
154 Ga0105239_10044417 3300010375 Bacteria 4872
155 Ga0105239_10103494 3300010375 Bacteria 3151
156 Ga0105239_10143458 3300010375 Bacteria 2662
157 Ga0105239_10250163 3300010375 Bacteria 1990
158 Ga0105239_10325411 3300010375 Unclassified 1734
159 Ga0105239_10679120 3300010375 Bacteria 1177
160 Ga0105246_10005529 3300011119 Bacteria 7709
161 Ga0105246_10049952 3300011119 Bacteria 2867
162 Ga0105246_10338317 3300011119 Bacteria 1229
163 Ga0157370_10020128 3300013104 Bacteria 6671
164 Ga0157370_10037949 3300013104 Bacteria 4663
165 Ga0157370_10070406 3300013104 Bacteria 3301
166 Ga0157369_10043961 3300013105 Bacteria 4865
167 Ga0157369_10133461 3300013105 Bacteria 2630
168 Ga0157374_10053100 3300013296 Bacteria 3777
169 Ga0157374_10283493 3300013296 Bacteria 1636
170 Ga0157374_10734537 3300013296 Archaea 1001
171 Ga0157378_10009234 3300013297 Bacteria 8589
172 Ga0157378_10108788 3300013297 Unclassified 2538
173 Ga0157378_10112632 3300013297 Bacteria 2496
174 Ga0157378_10228564 3300013297 Bacteria 1772
175 Ga0163162_10015306 3300013306 Bacteria 7493
176 Ga0163162_10034372 3300013306 Bacteria 5045
177 Ga0163162_10072712 3300013306 Bacteria 3494
178 Ga0163162_10513663 3300013306 Bacteria 1328
179 Ga0163162_11387702 3300013306 Unclassified 799
180 Ga0157372_10080881 3300013307 Bacteria 3677
181 Ga0157375_10005889 3300013308 Bacteria 10679
182 Ga0163163_10000004 3300014325 Bacteria 416569
183 Ga0163163_10055440 3300014325 Bacteria 3917
184 Ga0163163_10214214 3300014325 Unclassified 1975
185 Ga0163163_10263055 3300014325 Bacteria 1776
186 Ga0157380_10271098 3300014326 Bacteria 1547
187 Ga0157379_10075711 3300014968 Bacteria 3014
188 Ga0157379_10134332 3300014968 Bacteria 2228
189 Ga0157376_10071265 3300014969 Bacteria 2953
190 Ga0157376_10394010 3300014969 Bacteria 1337
191 Ga0157376_11013008 3300014969 Bacteria 853
192 Ga0157376_11354632 3300014969 Unclassified 742
193 Ga0163161_10098901 3300017792 Bacteria 2169
194 Ga0209563_119814 3300025230 Bacteria 766
195 Ga0209233_1000006 3300025261 Bacteria 1473685
196 Ga0209758_1000008 3300025297 Bacteria 1215263
197 Ga0207642_10031733 3300025899 Bacteria 2216
198 Ga0207688_10104969 3300025901 Bacteria 1635
199 Ga0207680_10148840 3300025903 Unclassified 1559
200 Ga0207645_10011614 3300025907 Bacteria 6007
201 Ga0207645_10128853 3300025907 Bacteria 1646
202 Ga0207705_10018936 3300025909 Bacteria 4923
203 Ga0207654_10189159 3300025911 Bacteria 1348
204 Ga0207654_10210383 3300025911 Bacteria 1285
205 Ga0207654_10266344 3300025911 Bacteria 1154
206 Ga0207707_10000002 3300025912 Bacteria 1142054
207 Ga0207707_10124483 3300025912 Bacteria 2254
208 Ga0207707_10173589 3300025912 Unclassified 1883
209 Ga0207707_10182482 3300025912 Bacteria 1832
210 Ga0207707_10445543 3300025912 Bacteria 1108
211 Ga0207695_10003125 3300025913 Bacteria 23683
212 Ga0207695_10010451 3300025913 Bacteria 11350
213 Ga0207695_10034506 3300025913 Bacteria 5501
214 Ga0207695_10080195 3300025913 Bacteria 3306
215 Ga0207695_10148601 3300025913 Unclassified 2284
216 Ga0207695_10181127 3300025913 Bacteria 2028
217 Ga0207695_10266849 3300025913 Bacteria 1608
218 Ga0207695_10425642 3300025913 Bacteria 1212
219 Ga0207671_10019806 3300025914 Bacteria 5136
220 Ga0207671_10033525 3300025914 Bacteria 3819
221 Ga0207671_10037542 3300025914 Bacteria 3592
222 Ga0207671_10359944 3300025914 Bacteria 1154
223 Ga0207671_10430820 3300025914 Unclassified 1049
224 Ga0207660_10032707 3300025917 Bacteria 3592
225 Ga0207660_10180883 3300025917 Bacteria 1637
226 Ga0207657_10017562 3300025919 Bacteria 6855
227 Ga0207657_10020087 3300025919 Bacteria 6325
228 Ga0207657_10138079 3300025919 Bacteria 1993
229 Ga0207649_10067833 3300025920 Unclassified 2266
230 Ga0207652_10000664 3300025921 Bacteria 33707
231 Ga0207652_10074685 3300025921 Bacteria 2952
232 Ga0207652_10192338 3300025921 Bacteria 1835
233 Ga0207694_10025713 3300025924 Bacteria 4475
234 Ga0207694_10119660 3300025924 Bacteria 2101
235 Ga0207694_10398158 3300025924 Unclassified 1145
236 Ga0207694_10709834 3300025924 Bacteria 848
237 Ga0207694_11137962 3300025924 Bacteria 660
238 Ga0207650_10226759 3300025925 Unclassified 1506
239 Ga0207659_10146348 3300025926 Bacteria 1840
240 Ga0207659_10172499 3300025926 Bacteria 1707
241 Ga0207659_10702716 3300025926 Bacteria 866
242 Ga0207687_10008920 3300025927 Bacteria 6556
243 Ga0207687_10020517 3300025927 Bacteria 4384
244 Ga0207687_10056857 3300025927 Bacteria 2745
245 Ga0207644_10254356 3300025931 Unclassified 1403
246 Ga0207690_10325961 3300025932 Bacteria 1208
247 Ga0207686_10222505 3300025934 Bacteria 1364
248 Ga0207686_10751967 3300025934 Unclassified 778
249 Ga0207709_10007087 3300025935 Bacteria 6264
250 Ga0207709_10420559 3300025935 Unclassified 1026
251 Ga0207669_10067957 3300025937 Bacteria 2223
252 Ga0207669_10398217 3300025937 Unclassified 1078
253 Ga0207704_10051358 3300025938 Bacteria 2493
254 Ga0207704_10137288 3300025938 Bacteria 1704
255 Ga0207704_10599621 3300025938 Bacteria 901
256 Ga0207691_10677929 3300025940 Bacteria 870
257 Ga0207689_10023830 3300025942 Bacteria 5135
258 Ga0207689_10630390 3300025942 Unclassified 903
259 Ga0207661_10018512 3300025944 Bacteria 5175
260 Ga0207661_10330912 3300025944 Bacteria 1371
261 Ga0207661_10992732 3300025944 Unclassified 773
262 Ga0207667_10005901 3300025949 Bacteria 14915
263 Ga0207667_10027571 3300025949 Bacteria 6180
264 Ga0207667_10117953 3300025949 Bacteria 2735
265 Ga0207667_10133829 3300025949 Bacteria 2553
266 Ga0207667_10168934 3300025949 Bacteria 2248
267 Ga0207667_10206229 3300025949 Bacteria 2015
268 Ga0207667_10620704 3300025949 Unclassified 1089
269 Ga0207651_10257247 3300025960 Bacteria 1432
270 Ga0207712_10024089 3300025961 Bacteria 4026
271 Ga0207668_11175680 3300025972 Unclassified 689
272 Ga0207640_10862283 3300025981 Bacteria 789
273 Ga0207658_10093077 3300025986 Bacteria 2343
274 Ga0207677_10010149 3300026023 Bacteria 5321
275 Ga0207703_10049077 3300026035 Bacteria 3411
276 Ga0207703_10116398 3300026035 Unclassified 2288
277 Ga0207703_10752848 3300026035 Unclassified 928
278 Ga0207639_10057032 3300026041 Bacteria 2997
279 Ga0207639_10075570 3300026041 Bacteria 2650
280 Ga0207639_10181857 3300026041 Bacteria 1789
281 Ga0207639_10185902 3300026041 Bacteria 1771
282 Ga0207639_10193976 3300026041 Bacteria 1737
283 Ga0207702_10089075 3300026078 Bacteria 2698
284 Ga0207648_10032657 3300026089 Bacteria 4594
285 Ga0207676_10097213 3300026095 Unclassified 2432
286 Ga0207676_10809637 3300026095 Bacteria 914
287 Ga0207676_11633845 3300026095 Unclassified 642
288 Ga0207674_10058668 3300026116 Bacteria 3898
289 Ga0207674_10181308 3300026116 Bacteria 2057
290 Ga0207674_10338197 3300026116 Bacteria 1455
291 Ga0207674_10886021 3300026116 Bacteria 860
292 Ga0207675_100158342 3300026118 Bacteria 2159
293 Ga0207683_10040965 3300026121 Bacteria 4043
294 Ga0207683_10150480 3300026121 Bacteria 2100
295 Ga0207683_10178397 3300026121 Bacteria 1926
296 Ga0207683_10459614 3300026121 Bacteria 1174
297 Ga0207698_10072142 3300026142 Bacteria 2744
298 Ga0268266_10000746 3300028379 Bacteria 43523
299 Ga0268266_10010539 3300028379 Bacteria 8070
300 Ga0268266_10075666 3300028379 Bacteria 2924
301 Ga0268266_10161497 3300028379 Bacteria 2027
302 Ga0268266_10325506 3300028379 Bacteria 1439
303 Ga0268266_10349492 3300028379 Bacteria 1389
304 Ga0268266_10402672 3300028379 Bacteria 1294
305 Ga0268266_10472519 3300028379 Bacteria 1194
306 Ga0268265_11600879 3300028380 Unclassified 656
307 Ga0268264_10341534 3300028381 Unclassified 1422
308 Ga0268264_10739613 3300028381 Bacteria 979
309 Ga0265318_10000519 3300028577 Bacteria 27654
310 Ga0265338_10012930 3300028800 Bacteria 9479
311 Ga0265338_10270154 3300028800 Bacteria 1246
312 Ga0265330_10045261 3300031235 Bacteria 1941
313 Ga0265330_10166202 3300031235 Unclassified 936
314 Ga0265332_10021163 3300031238 Bacteria 2874
315 Ga0265332_10065513 3300031238 Bacteria 1551
316 Ga0265328_10026642 3300031239 Bacteria 2172
317 Ga0265320_10065948 3300031240 Bacteria 1717
318 Ga0265325_10001143 3300031241 Bacteria 19061
319 Ga0265325_10008988 3300031241 Bacteria 5866
320 Ga0265325_10017633 3300031241 Bacteria 3967
321 Ga0265325_10030398 3300031241 Bacteria 2897
322 Ga0265329_10048867 3300031242 Bacteria 1349
323 Ga0265329_10065912 3300031242 Unclassified 1146
324 Ga0265340_10000118 3300031247 Bacteria 38702
325 Ga0265340_10091195 3300031247 Bacteria 1424
326 Ga0265340_10125126 3300031247 Bacteria 1181
327 Ga0265340_10236827 3300031247 Bacteria 815
328 Ga0265339_10014252 3300031249 Bacteria 4796
329 Ga0265339_10014352 3300031249 Bacteria 4775
330 Ga0265339_10134618 3300031249 Bacteria 1261
331 Ga0265339_10233168 3300031249 Bacteria 896
332 Ga0265331_10025833 3300031250 Bacteria 2960
333 Ga0265331_10136367 3300031250 Bacteria 1117
334 Ga0265327_10313443 3300031251 Bacteria 689
335 Ga0265316_10007233 3300031344 Bacteria 10487
336 Ga0265316_10268385 3300031344 Unclassified 1249
337 Ga0265316_10271048 3300031344 Bacteria 1242
338 Ga0265316_10429254 3300031344 Unclassified 949
339 Ga0265313_10003958 3300031595 Bacteria 11638
340 Ga0265313_10005315 3300031595 Bacteria 9518
341 Ga0265313_10006228 3300031595 Bacteria 8520
342 Ga0265314_10001117 3300031711 Bacteria 30997
343 Ga0265314_10009777 3300031711 Bacteria 8057
344 Ga0265314_10026047 3300031711 Bacteria 4401
345 Ga0265314_10051064 3300031711 Bacteria 2882
346 Ga0265314_10098217 3300031711 Bacteria 1889
347 Ga0265314_10111590 3300031711 Bacteria 1737
348 Ga0265314_10441384 3300031711 Bacteria 695
349 Ga0265342_10008633 3300031712 Bacteria 7282
350 Ga0265342_10019152 3300031712 Bacteria 4415
351 Ga0265342_10021450 3300031712 Bacteria 4124
352 Ga0265342_10038624 3300031712 Bacteria 2905
353 Ga0265342_10040740 3300031712 Bacteria 2816
354 Ga0265342_10101320 3300031712 Bacteria 1640
355 Ga0307516_10217257 3300031730 Bacteria 1623
356 Ga0373929_0019734 3300035085 Bacteria 1353
357 Ga0373936_0487375 3300035113 Unclassified 572
358 Ga0395899_0020624 3300037312 Bacteria 4996
359 Ga0395900_0025803 3300037418 Bacteria 6015
360 Ga0395898_0290672 3300037466 Unclassified 1559
361 Ga0436365_0983973 3300039437 Bacteria 9092
362 Ga0466961_0262986 3300044693 Bacteria 1058
363 Ga0466957_0764370 3300044842 Unclassified 685
364 Ga0466958_0610020 3300045836 Unclassified 710
365 Ga0495592_0168790 3300046454 Bacteria 1500
366 Ga0495606_0092150 3300046507 Unclassified 1862
367 Ga0495606_0179072 3300046507 Unclassified 1224
368 Ga0495616_0163564 3300046513 Bacteria 999
369 Ga0495665_0130642 3300046531 Bacteria 1315
370 Ga0495609_0101199 3300046538 Unclassified 1248
371 Ga0495656_0061536 3300046615 Bacteria 1640
372 Ga0495625_0291623 3300046660 Bacteria 1047
373 Ga0495599_0078268 3300046678 Bacteria 2065
374 Ga0495589_0038245 3300046794 Bacteria 2403
375 Ga0495604_0191038 3300047317 Bacteria 1427
376 Ga0495672_0200548 3300047320 Unclassified 998
377 Ga0495672_0210267 3300047320 Bacteria 967
378 Ga0495680_0265240 3300047322 Bacteria 1214
379 Ga0495685_174416 3300047447 Unclassified 694
380 Ga0495593_0198600 3300047673 Bacteria 1008
381 Ga0495602_0291698 3300048088 Bacteria 1197
382 Ga0496115_0348068 3300048918 Bacteria 1209
383 Ga0496121_0000323 3300048924 Bacteria 100188
384 Ga0501031_0005195 3300049568 Bacteria 8488
385 Ga0501032_0009717 3300049569 Bacteria 6965
386 Ga0501032_0036613 3300049569 Bacteria 3349
387 Ga0501032_0105145 3300049569 Bacteria 1870
388 Ga0501032_0160797 3300049569 Bacteria 1475
389 Ga0501033_0003476 3300049570 Bacteria 12923
390 Ga0501033_0017001 3300049570 Bacteria 5498
391 Ga0501033_0039318 3300049570 Bacteria 3533
392 Ga0501033_0042796 3300049570 Bacteria 3376
393 Ga0501033_0045562 3300049570 Bacteria 3264
394 Ga0501033_0064898 3300049570 Bacteria 2686
395 Ga0501033_0075352 3300049570 Bacteria 2476
396 Ga0501033_0139845 3300049570 Bacteria 1750
397 Ga0501033_0275161 3300049570 Unclassified 1189
398 Ga0501034_0028753 3300049571 Bacteria 5656
399 Ga0501034_0032152 3300049571 Bacteria 5330
400 Ga0501034_0174479 3300049571 Bacteria 2116
401 Ga0501034_0214878 3300049571 Bacteria 1877
402 Ga0501034_0253913 3300049571 Bacteria 1702
403 Ga0501034_0416934 3300049571 Bacteria 1264
404 Ga0501034_0552130 3300049571 Bacteria 1061
405 Ga0501034_0644036 3300049571 Bacteria 962
406 Ga0501036_0003735 3300049572 Bacteria 12201
407 Ga0501036_0271978 3300049572 Bacteria 1418
408 Ga0501036_0797112 3300049572 Bacteria 778
409 Ga0501037_0004280 3300049573 Bacteria 10351
410 Ga0501037_0009721 3300049573 Bacteria 7059
411 Ga0501037_0083534 3300049573 Bacteria 2314
412 Ga0501037_0099446 3300049573 Bacteria 2100
413 Ga0501037_0114178 3300049573 Bacteria 1944
414 Ga0501037_0324640 3300049573 Bacteria 1065
415 Ga0501037_0342341 3300049573 Bacteria 1033
416 Ga0501038_0030130 3300049574 Bacteria 4804
417 Ga0501038_0099559 3300049574 Bacteria 2423
418 Ga0501038_0141051 3300049574 Bacteria 1971
419 Ga0501038_0143171 3300049574 Bacteria 1954
420 Ga0501038_0230107 3300049574 Bacteria 1476
421 Ga0501038_0270816 3300049574 Bacteria 1339
422 Ga0501038_0668866 3300049574 Bacteria 780
423 Ga0501039_0000235 3300049575 Bacteria 40369
424 Ga0501039_0137088 3300049575 Bacteria 1922
425 Ga0501039_0386135 3300049575 Bacteria 1100
426 Ga0501042_0011508 3300049578 Bacteria 5974
427 Ga0501043_0009738 3300049579 Bacteria 7532
428 Ga0501043_0019916 3300049579 Bacteria 5268
429 Ga0501043_0028228 3300049579 Bacteria 4405
430 Ga0501043_0031640 3300049579 Bacteria 4159
431 Ga0501043_0326180 3300049579 Bacteria 1170
432 Ga0501043_0635203 3300049579 Unclassified 785
433 Ga0501046_0002599 3300049580 Bacteria 16880
434 Ga0501046_0003531 3300049580 Bacteria 14318
435 Ga0501046_0027547 3300049580 Bacteria 4635
436 Ga0501046_0070365 3300049580 Bacteria 2720
437 Ga0501046_0253831 3300049580 Bacteria 1294
438 Ga0501047_0000620 3300049581 Bacteria 37494
439 Ga0501047_0003534 3300049581 Bacteria 14761
440 Ga0501047_0009003 3300049581 Bacteria 9426
441 Ga0501047_0009079 3300049581 Bacteria 9391
442 Ga0501047_0012067 3300049581 Bacteria 8177
443 Ga0501047_0017660 3300049581 Bacteria 6835
444 Ga0501047_0026051 3300049581 Bacteria 5623
445 Ga0501047_0043985 3300049581 Bacteria 4313
446 Ga0501047_0080559 3300049581 Bacteria 3129
447 Ga0501047_0147491 3300049581 Bacteria 2229
448 Ga0501047_0213187 3300049581 Bacteria 1789
449 Ga0501047_0580328 3300049581 Bacteria 944
450 Ga0501048_0007549 3300049582 Bacteria 8241
451 Ga0501048_0846863 3300049582 Bacteria 657
452 Ga0501067_0003957 3300049583 Bacteria 8181
453 Ga0501067_0011528 3300049583 Bacteria 4898
454 Ga0501068_0128524 3300049584 Unclassified 1583
455 Ga0501069_0027017 3300049585 Bacteria 3145
456 Ga0501069_0175132 3300049585 Bacteria 1239
457 Ga0501070_0008501 3300049586 Bacteria 8674
458 Ga0501070_0040822 3300049586 Bacteria 3868
459 Ga0501070_0184156 3300049586 Bacteria 1718
460 Ga0501072_0019701 3300049588 Bacteria 5218
461 Ga0501073_0005147 3300049589 Bacteria 9814
462 Ga0501073_0021936 3300049589 Bacteria 4600
463 Ga0501073_0057842 3300049589 Bacteria 2710
464 Ga0501074_0001672 3300049590 Bacteria 15092
465 Ga0501074_0170879 3300049590 Bacteria 1551
466 Ga0501074_0262430 3300049590 Bacteria 1228
467 Ga0501077_0193773 3300049593 Bacteria 1291
468 Ga0501079_0021710 3300049741 Bacteria 4913
469 Ga0501080_0041160 3300049742 Bacteria 4306
470 Ga0501080_0095255 3300049742 Bacteria 2764
471 Ga0501080_0138106 3300049742 Bacteria 2254
472 Ga0501080_0171492 3300049742 Unclassified 2001
473 Ga0501080_0268033 3300049742 Bacteria 1555
474 Ga0501080_0296976 3300049742 Bacteria 1466
475 Ga0501080_0314948 3300049742 Bacteria 1418
476 Ga0501080_0320061 3300049742 Bacteria 1404
477 Ga0501083_0003376 3300049744 Bacteria 11178
478 Ga0501083_0154557 3300049744 Bacteria 1502
479 Ga0501035_0002862 3300049822 Bacteria 16665
480 Ga0501035_0008997 3300049822 Bacteria 9288
481 Ga0501035_0064531 3300049822 Bacteria 3254
482 Ga0501035_0067452 3300049822 Bacteria 3175
483 Ga0501035_0067975 3300049822 Bacteria 3160
484 Ga0501035_0084222 3300049822 Bacteria 2804
485 Ga0501035_0146644 3300049822 Bacteria 2049
486 Ga0501035_0164337 3300049822 Unclassified 1920
487 Ga0501035_0270236 3300049822 Bacteria 1439
488 Ga0501035_0360357 3300049822 Bacteria 1215
489 Ga0501035_0459531 3300049822 Bacteria 1052
490 Ga0501035_0532005 3300049822 Bacteria 964
491 Ga0501044_0006605 3300049823 Bacteria 12796
492 Ga0501044_0010918 3300049823 Bacteria 9858
493 Ga0501044_0025382 3300049823 Bacteria 6281
494 Ga0501044_0039593 3300049823 Bacteria 4916
495 Ga0501044_0046320 3300049823 Bacteria 4503
496 Ga0501044_0052580 3300049823 Bacteria 4196
497 Ga0501044_0082894 3300049823 Bacteria 3243
498 Ga0501044_0103652 3300049823 Bacteria 2859
499 Ga0501044_0175213 3300049823 Bacteria 2114
500 Ga0501044_0546486 3300049823 Bacteria 1056
501 Ga0501045_0003135 3300049824 Bacteria 11309
502 Ga0500643_000123 3300053087 Bacteria 80567
503 Ga0500572_057245 3300053111 Unclassified 1177
504 Ga0500593_110351 3300053117 Bacteria 1131
505 Ga0500594_0150875 3300053118 Unclassified 747
506 Ga0500595_000109 3300053119 Bacteria 55874
507 Ga0500559_0034988 3300053136 Bacteria 2167
508 Ga0500568_0008212 3300053139 Bacteria 5054
509 Ga0500568_0056413 3300053139 Bacteria 1531
510 Ga0500573_0000060 3300053140 Bacteria 68257
511 Ga0500645_067378 3300053730 Unclassified 1030
512 Ga0501084_0000302 3300054114 Bacteria 37305
513 Ga0501082_0001845 3300060353 Bacteria 18647

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035113 Ga0373936_0487375 Ga0373936_0487375_41_517 158
2 3300049572 Ga0501036_0797112 Ga0501036_0797112_278_763 161
3 3300025960 Ga0207651_10257247 Ga0207651_102572472 166
4 3300049570 Ga0501033_0045562 Ga0501033_0045562_1388_1900 170
5 3300049571 Ga0501034_0552130 Ga0501034_0552130_307_819 170
6 3300049581 Ga0501047_0003534 Ga0501047_0003534_13126_13638 170
7 3300049822 Ga0501035_0164337 Ga0501035_0164337_415_927 170
8 3300049823 Ga0501044_0175213 Ga0501044_0175213_44_556 170
9 3300005539 Ga0068853_100004051 Ga0068853_10000405114 175
10 3300049569 Ga0501032_0105145 Ga0501032_0105145_925_1452 175
11 3300049570 Ga0501033_0139845 Ga0501033_0139845_1024_1551 175
12 3300049571 Ga0501034_0028753 Ga0501034_0028753_236_763 175
13 3300049573 Ga0501037_0083534 Ga0501037_0083534_1126_1653 175
14 3300049574 Ga0501038_0141051 Ga0501038_0141051_589_1116 175
15 3300049575 Ga0501039_0137088 Ga0501039_0137088_390_917 175
16 3300049579 Ga0501043_0031640 Ga0501043_0031640_2964_3491 175
17 3300049581 Ga0501047_0026051 Ga0501047_0026051_997_1524 175
18 3300049585 Ga0501069_0175132 Ga0501069_0175132_289_816 175
19 3300049586 Ga0501070_0040822 Ga0501070_0040822_2707_3234 175
20 3300049590 Ga0501074_0262430 Ga0501074_0262430_49_576 175
21 3300049742 Ga0501080_0095255 Ga0501080_0095255_582_1109 175
22 3300049822 Ga0501035_0084222 Ga0501035_0084222_1221_1748 175
23 3300049823 Ga0501044_0052580 Ga0501044_0052580_758_1285 175
24 3300005842 Ga0068858_100011968 Ga0068858_1000119683 176
25 3300026035 Ga0207703_10049077 Ga0207703_100490773 176
26 3300003215 JGI25153J46596_10000294 JGI25153J46596_100002949 177
27 3300003323 rootH1_10014299 rootH1_100142992 177
28 3300005336 Ga0070680_100008036 Ga0070680_1000080369 177
29 3300005458 Ga0070681_10000002 Ga0070681_10000002115 177
30 3300005530 Ga0070679_100003052 Ga0070679_1000030528 177
31 3300005548 Ga0070665_100345200 Ga0070665_1003452002 177
32 3300005616 Ga0068852_100100185 Ga0068852_1001001854 177
33 3300006358 Ga0068871_101328095 Ga0068871_1013280951 177
34 3300009174 Ga0105241_10060766 Ga0105241_100607663 177
35 3300010375 Ga0105239_10033641 Ga0105239_100336415 177
36 3300025230 Ga0209563_119814 Ga0209563_1198141 177
37 3300025297 Ga0209758_1000008 Ga0209758_1000008638 177
38 3300025911 Ga0207654_10189159 Ga0207654_101891592 177
39 3300025912 Ga0207707_10000002 Ga0207707_10000002837 177
40 3300025917 Ga0207660_10032707 Ga0207660_100327076 177
41 3300025921 Ga0207652_10000664 Ga0207652_1000066429 177
42 3300026035 Ga0207703_10752848 Ga0207703_107528482 177
43 3300026142 Ga0207698_10072142 Ga0207698_100721422 177
44 3300028379 Ga0268266_10349492 Ga0268266_103494922 177
45 3300031711 Ga0265314_10111590 Ga0265314_101115901 177
46 3300044693 Ga0466961_0262986 Ga0466961_0262986_349_894 177
47 3300049571 Ga0501034_0174479 Ga0501034_0174479_958_1497 177
48 3300049581 Ga0501047_0009003 Ga0501047_0009003_5475_6014 177
49 3300049583 Ga0501067_0003957 Ga0501067_0003957_7299_7838 177
50 3300049586 Ga0501070_0184156 Ga0501070_0184156_632_1171 177
51 3300049588 Ga0501072_0019701 Ga0501072_0019701_4257_4796 177
52 3300049589 Ga0501073_0005147 Ga0501073_0005147_1229_1768 177
53 3300049590 Ga0501074_0170879 Ga0501074_0170879_629_1168 177
54 3300049742 Ga0501080_0138106 Ga0501080_0138106_1646_2185 177
55 3300009093 Ga0105240_10000944 Ga0105240_1000094442 178
56 3300009174 Ga0105241_10045392 Ga0105241_100453924 178
57 3300009545 Ga0105237_10055622 Ga0105237_100556224 178
58 3300009551 Ga0105238_10218780 Ga0105238_102187803 178
59 3300010375 Ga0105239_10143458 Ga0105239_101434582 178
60 3300014969 Ga0157376_11013008 Ga0157376_110130082 178
61 3300025913 Ga0207695_10003125 Ga0207695_1000312514 178
62 3300028800 Ga0265338_10270154 Ga0265338_102701542 178
63 3300031241 Ga0265325_10017633 Ga0265325_100176331 178
64 3300031241 Ga0265325_10030398 Ga0265325_100303982 178
65 3300031247 Ga0265340_10000118 Ga0265340_1000011839 178
66 3300031249 Ga0265339_10014252 Ga0265339_100142525 178
67 3300031251 Ga0265327_10313443 Ga0265327_103134431 178
68 3300031344 Ga0265316_10007233 Ga0265316_100072337 178
69 3300031344 Ga0265316_10268385 Ga0265316_102683852 178
70 3300031595 Ga0265313_10006228 Ga0265313_100062286 178
71 3300031711 Ga0265314_10098217 Ga0265314_100982173 178
72 3300031712 Ga0265342_10008633 Ga0265342_100086334 178
73 3300031712 Ga0265342_10021450 Ga0265342_100214504 178
74 3300049569 Ga0501032_0036613 Ga0501032_0036613_1506_2069 178
75 3300049570 Ga0501033_0003476 Ga0501033_0003476_853_1416 178
76 3300049570 Ga0501033_0042796 Ga0501033_0042796_1756_2295 178
77 3300049571 Ga0501034_0253913 Ga0501034_0253913_357_893 178
78 3300049573 Ga0501037_0009721 Ga0501037_0009721_404_967 178
79 3300049574 Ga0501038_0143171 Ga0501038_0143171_119_682 178
80 3300049575 Ga0501039_0386135 Ga0501039_0386135_393_956 178
81 3300049579 Ga0501043_0028228 Ga0501043_0028228_1499_2062 178
82 3300049580 Ga0501046_0027547 Ga0501046_0027547_814_1377 178
83 3300049581 Ga0501047_0147491 Ga0501047_0147491_1434_1997 178
84 3300049742 Ga0501080_0268033 Ga0501080_0268033_967_1530 178
85 3300049822 Ga0501035_0002862 Ga0501035_0002862_5348_5911 178
86 3300049823 Ga0501044_0010918 Ga0501044_0010918_2892_3455 178
87 3300005327 Ga0070658_10397818 Ga0070658_103978182 179
88 3300005327 Ga0070658_10657869 Ga0070658_106578692 179
89 3300005339 Ga0070660_100231457 Ga0070660_1002314572 179
90 3300005341 Ga0070691_10240942 Ga0070691_102409422 179
91 3300005366 Ga0070659_100007350 Ga0070659_10000735010 179
92 3300005458 Ga0070681_10114350 Ga0070681_101143505 179
93 3300005539 Ga0068853_100189179 Ga0068853_1001891793 179
94 3300005539 Ga0068853_100411583 Ga0068853_1004115832 179
95 3300005548 Ga0070665_100011805 Ga0070665_1000118053 179
96 3300005563 Ga0068855_100045570 Ga0068855_1000455706 179
97 3300005563 Ga0068855_100157761 Ga0068855_1001577612 179
98 3300006358 Ga0068871_100220518 Ga0068871_1002205181 179
99 3300006881 Ga0068865_100043551 Ga0068865_1000435512 179
100 3300009093 Ga0105240_10007670 Ga0105240_100076704 179
101 3300009093 Ga0105240_10037488 Ga0105240_100374888 179
102 3300009093 Ga0105240_10066709 Ga0105240_100667092 179
103 3300009093 Ga0105240_10314878 Ga0105240_103148782 179
104 3300009093 Ga0105240_10525093 Ga0105240_105250932 179
105 3300009174 Ga0105241_10089334 Ga0105241_100893342 179
106 3300009545 Ga0105237_10043043 Ga0105237_100430436 179
107 3300009545 Ga0105237_10242701 Ga0105237_102427011 179
108 3300009545 Ga0105237_10307899 Ga0105237_103078992 179
109 3300009551 Ga0105238_10056832 Ga0105238_100568327 179
110 3300010375 Ga0105239_10039521 Ga0105239_100395211 179
111 3300010375 Ga0105239_10044417 Ga0105239_100444173 179
112 3300010375 Ga0105239_10250163 Ga0105239_102501632 179
113 3300010375 Ga0105239_10679120 Ga0105239_106791202 179
114 3300013104 Ga0157370_10037949 Ga0157370_100379497 179
115 3300013296 Ga0157374_10734537 Ga0157374_107345371 179
116 3300013306 Ga0163162_10072712 Ga0163162_100727122 179
117 3300014325 Ga0163163_10263055 Ga0163163_102630553 179
118 3300014969 Ga0157376_11354632 Ga0157376_113546321 179
119 3300025911 Ga0207654_10266344 Ga0207654_102663442 179
120 3300025912 Ga0207707_10445543 Ga0207707_104455432 179
121 3300025913 Ga0207695_10010451 Ga0207695_100104519 179
122 3300025913 Ga0207695_10425642 Ga0207695_104256421 179
123 3300025914 Ga0207671_10019806 Ga0207671_100198067 179
124 3300025914 Ga0207671_10359944 Ga0207671_103599442 179
125 3300025914 Ga0207671_10430820 Ga0207671_104308202 179
126 3300025919 Ga0207657_10138079 Ga0207657_101380792 179
127 3300025924 Ga0207694_10025713 Ga0207694_100257132 179
128 3300025927 Ga0207687_10008920 Ga0207687_100089203 179
129 3300025932 Ga0207690_10325961 Ga0207690_103259612 179
130 3300025938 Ga0207704_10051358 Ga0207704_100513584 179
131 3300025949 Ga0207667_10005901 Ga0207667_100059016 179
132 3300025949 Ga0207667_10117953 Ga0207667_101179532 179
133 3300025949 Ga0207667_10133829 Ga0207667_101338293 179
134 3300026041 Ga0207639_10057032 Ga0207639_100570322 179
135 3300026041 Ga0207639_10185902 Ga0207639_101859022 179
136 3300028379 Ga0268266_10010539 Ga0268266_100105395 179
137 3300028577 Ga0265318_10000519 Ga0265318_1000051926 179
138 3300031235 Ga0265330_10166202 Ga0265330_101662022 179
139 3300031238 Ga0265332_10021163 Ga0265332_100211632 179
140 3300031239 Ga0265328_10026642 Ga0265328_100266422 179
141 3300031240 Ga0265320_10065948 Ga0265320_100659481 179
142 3300031241 Ga0265325_10001143 Ga0265325_100011436 179
143 3300031241 Ga0265325_10008988 Ga0265325_100089883 179
144 3300031242 Ga0265329_10048867 Ga0265329_100488672 179
145 3300031242 Ga0265329_10065912 Ga0265329_100659122 179
146 3300031247 Ga0265340_10091195 Ga0265340_100911952 179
147 3300031247 Ga0265340_10236827 Ga0265340_102368272 179
148 3300031249 Ga0265339_10014352 Ga0265339_100143526 179
149 3300031249 Ga0265339_10134618 Ga0265339_101346181 179
150 3300031249 Ga0265339_10233168 Ga0265339_102331682 179
151 3300031250 Ga0265331_10025833 Ga0265331_100258332 179
152 3300031250 Ga0265331_10136367 Ga0265331_101363672 179
153 3300031344 Ga0265316_10271048 Ga0265316_102710481 179
154 3300031344 Ga0265316_10429254 Ga0265316_104292542 179
155 3300031595 Ga0265313_10003958 Ga0265313_1000395811 179
156 3300031595 Ga0265313_10005315 Ga0265313_100053155 179
157 3300031711 Ga0265314_10001117 Ga0265314_1000111729 179
158 3300031711 Ga0265314_10009777 Ga0265314_100097776 179
159 3300031711 Ga0265314_10026047 Ga0265314_100260477 179
160 3300031711 Ga0265314_10051064 Ga0265314_100510642 179
161 3300031711 Ga0265314_10441384 Ga0265314_104413841 179
162 3300031712 Ga0265342_10019152 Ga0265342_100191527 179
163 3300031712 Ga0265342_10038624 Ga0265342_100386242 179
164 3300031712 Ga0265342_10040740 Ga0265342_100407404 179
165 3300031712 Ga0265342_10101320 Ga0265342_101013202 179
166 3300037312 Ga0395899_0020624 Ga0395899_0020624_750_1340 179
167 3300039437 Ga0436365_0983973 Ga0436365_0983973_5714_6253 179
168 3300046513 Ga0495616_0163564 Ga0495616_0163564_103_678 179
169 3300046531 Ga0495665_0130642 Ga0495665_0130642_121_672 179
170 3300046678 Ga0495599_0078268 Ga0495599_0078268_894_1445 179
171 3300047317 Ga0495604_0191038 Ga0495604_0191038_216_767 179
172 3300047322 Ga0495680_0265240 Ga0495680_0265240_115_666 179
173 3300048088 Ga0495602_0291698 Ga0495602_0291698_442_993 179
174 3300049568 Ga0501031_0005195 Ga0501031_0005195_4615_5163 179
175 3300049569 Ga0501032_0009717 Ga0501032_0009717_5711_6259 179
176 3300049569 Ga0501032_0160797 Ga0501032_0160797_516_1058 179
177 3300049570 Ga0501033_0017001 Ga0501033_0017001_3178_3726 179
178 3300049570 Ga0501033_0039318 Ga0501033_0039318_1068_1613 179
179 3300049570 Ga0501033_0064898 Ga0501033_0064898_2095_2640 179
180 3300049570 Ga0501033_0075352 Ga0501033_0075352_1781_2332 179
181 3300049570 Ga0501033_0275161 Ga0501033_0275161_288_827 179
182 3300049571 Ga0501034_0032152 Ga0501034_0032152_2254_2802 179
183 3300049571 Ga0501034_0214878 Ga0501034_0214878_1263_1802 179
184 3300049572 Ga0501036_0003735 Ga0501036_0003735_7837_8385 179
185 3300049572 Ga0501036_0271978 Ga0501036_0271978_328_870 179
186 3300049573 Ga0501037_0004280 Ga0501037_0004280_3574_4122 179
187 3300049573 Ga0501037_0099446 Ga0501037_0099446_250_795 179
188 3300049573 Ga0501037_0114178 Ga0501037_0114178_1364_1906 179
189 3300049573 Ga0501037_0324640 Ga0501037_0324640_184_735 179
190 3300049573 Ga0501037_0342341 Ga0501037_0342341_255_794 179
191 3300049574 Ga0501038_0030130 Ga0501038_0030130_2602_3150 179
192 3300049574 Ga0501038_0099559 Ga0501038_0099559_164_715 179
193 3300049574 Ga0501038_0230107 Ga0501038_0230107_455_994 179
194 3300049574 Ga0501038_0270816 Ga0501038_0270816_348_890 179
195 3300049574 Ga0501038_0668866 Ga0501038_0668866_207_752 179
196 3300049575 Ga0501039_0000235 Ga0501039_0000235_28823_29371 179
197 3300049578 Ga0501042_0011508 Ga0501042_0011508_611_1159 179
198 3300049579 Ga0501043_0009738 Ga0501043_0009738_3786_4334 179
199 3300049579 Ga0501043_0019916 Ga0501043_0019916_3254_3796 179
200 3300049579 Ga0501043_0326180 Ga0501043_0326180_144_689 179
201 3300049579 Ga0501043_0635203 Ga0501043_0635203_123_674 179
202 3300049580 Ga0501046_0002599 Ga0501046_0002599_2182_2721 179
203 3300049580 Ga0501046_0003531 Ga0501046_0003531_8893_9441 179
204 3300049580 Ga0501046_0253831 Ga0501046_0253831_594_1145 179
205 3300049581 Ga0501047_0000620 Ga0501047_0000620_23955_24494 179
206 3300049581 Ga0501047_0009079 Ga0501047_0009079_4664_5215 179
207 3300049581 Ga0501047_0012067 Ga0501047_0012067_1491_2036 179
208 3300049581 Ga0501047_0017660 Ga0501047_0017660_4761_5309 179
209 3300049581 Ga0501047_0213187 Ga0501047_0213187_519_1064 179
210 3300049581 Ga0501047_0580328 Ga0501047_0580328_35_586 179
211 3300049582 Ga0501048_0007549 Ga0501048_0007549_1335_1883 179
212 3300049582 Ga0501048_0846863 Ga0501048_0846863_99_644 179
213 3300049583 Ga0501067_0011528 Ga0501067_0011528_1995_2543 179
214 3300049584 Ga0501068_0128524 Ga0501068_0128524_251_799 179
215 3300049585 Ga0501069_0027017 Ga0501069_0027017_1889_2437 179
216 3300049586 Ga0501070_0008501 Ga0501070_0008501_4309_4857 179
217 3300049589 Ga0501073_0021936 Ga0501073_0021936_622_1170 179
218 3300049590 Ga0501074_0001672 Ga0501074_0001672_13271_13819 179
219 3300049593 Ga0501077_0193773 Ga0501077_0193773_576_1124 179
220 3300049741 Ga0501079_0021710 Ga0501079_0021710_2730_3278 179
221 3300049742 Ga0501080_0041160 Ga0501080_0041160_2607_3155 179
222 3300049742 Ga0501080_0296976 Ga0501080_0296976_364_903 179
223 3300049742 Ga0501080_0320061 Ga0501080_0320061_764_1315 179
224 3300049744 Ga0501083_0003376 Ga0501083_0003376_745_1293 179
225 3300049744 Ga0501083_0154557 Ga0501083_0154557_662_1279 179
226 3300049822 Ga0501035_0008997 Ga0501035_0008997_4123_4668 179
227 3300049822 Ga0501035_0064531 Ga0501035_0064531_1786_2334 179
228 3300049822 Ga0501035_0067975 Ga0501035_0067975_721_1260 179
229 3300049822 Ga0501035_0146644 Ga0501035_0146644_298_849 179
230 3300049822 Ga0501035_0270236 Ga0501035_0270236_24_569 179
231 3300049822 Ga0501035_0360357 Ga0501035_0360357_182_721 179
232 3300049822 Ga0501035_0459531 Ga0501035_0459531_447_989 179
233 3300049822 Ga0501035_0532005 Ga0501035_0532005_115_654 179
234 3300049823 Ga0501044_0006605 Ga0501044_0006605_4092_4637 179
235 3300049823 Ga0501044_0025382 Ga0501044_0025382_3819_4370 179
236 3300049823 Ga0501044_0039593 Ga0501044_0039593_2607_3155 179
237 3300049823 Ga0501044_0046320 Ga0501044_0046320_2058_2603 179
238 3300049823 Ga0501044_0082894 Ga0501044_0082894_361_900 179
239 3300049823 Ga0501044_0103652 Ga0501044_0103652_1445_1984 179
240 3300049824 Ga0501045_0003135 Ga0501045_0003135_2168_2716 179
241 3300054114 Ga0501084_0000302 Ga0501084_0000302_30501_31049 179
242 3300060353 Ga0501082_0001845 Ga0501082_0001845_5249_5797 179
243 3300005367 Ga0070667_101392506 Ga0070667_1013925061 180
244 3300026121 Ga0207683_10459614 Ga0207683_104596141 180
245 3300053117 Ga0500593_110351 Ga0500593_110351_373_945 180
246 3300053118 Ga0500594_0150875 Ga0500594_0150875_75_647 180
247 3300053139 Ga0500568_0056413 Ga0500568_0056413_65_637 180
248 3300003214 JGI25165J46597_1000246 JGI25165J46597_100024620 181
249 3300005327 Ga0070658_10010177 Ga0070658_100101772 181
250 3300005327 Ga0070658_10050899 Ga0070658_100508995 181
251 3300005329 Ga0070683_100101904 Ga0070683_1001019041 181
252 3300005329 Ga0070683_101059011 Ga0070683_1010590111 181
253 3300005331 Ga0070670_100120307 Ga0070670_1001203073 181
254 3300005331 Ga0070670_100146237 Ga0070670_1001462372 181
255 3300005334 Ga0068869_100002752 Ga0068869_1000027528 181
256 3300005335 Ga0070666_10012463 Ga0070666_100124637 181
257 3300005335 Ga0070666_10028380 Ga0070666_100283801 181
258 3300005335 Ga0070666_10422639 Ga0070666_104226391 181
259 3300005336 Ga0070680_100042149 Ga0070680_1000421495 181
260 3300005338 Ga0068868_100026354 Ga0068868_1000263544 181
261 3300005338 Ga0068868_100102667 Ga0068868_1001026672 181
262 3300005338 Ga0068868_100625310 Ga0068868_1006253102 181
263 3300005339 Ga0070660_100081179 Ga0070660_1000811792 181
264 3300005340 Ga0070689_101564916 Ga0070689_1015649161 181
265 3300005341 Ga0070691_10279022 Ga0070691_102790222 181
266 3300005344 Ga0070661_100475010 Ga0070661_1004750102 181
267 3300005354 Ga0070675_100022802 Ga0070675_1000228022 181
268 3300005354 Ga0070675_100348362 Ga0070675_1003483621 181
269 3300005354 Ga0070675_100795348 Ga0070675_1007953481 181
270 3300005356 Ga0070674_100174923 Ga0070674_1001749231 181
271 3300005364 Ga0070673_100023157 Ga0070673_1000231572 181
272 3300005364 Ga0070673_100421174 Ga0070673_1004211742 181
273 3300005367 Ga0070667_100349329 Ga0070667_1003493291 181
274 3300005456 Ga0070678_100026830 Ga0070678_1000268304 181
275 3300005456 Ga0070678_100075056 Ga0070678_1000750565 181
276 3300005456 Ga0070678_100097350 Ga0070678_1000973502 181
277 3300005456 Ga0070678_100117450 Ga0070678_1001174501 181
278 3300005456 Ga0070678_100822415 Ga0070678_1008224151 181
279 3300005457 Ga0070662_100158384 Ga0070662_1001583842 181
280 3300005458 Ga0070681_10072908 Ga0070681_100729085 181
281 3300005458 Ga0070681_10590658 Ga0070681_105906582 181
282 3300005459 Ga0068867_100007823 Ga0068867_1000078233 181
283 3300005459 Ga0068867_100025496 Ga0068867_1000254961 181
284 3300005459 Ga0068867_100254207 Ga0068867_1002542072 181
285 3300005466 Ga0070685_10254739 Ga0070685_102547391 181
286 3300005530 Ga0070679_100008672 Ga0070679_1000086725 181
287 3300005530 Ga0070679_100160226 Ga0070679_1001602261 181
288 3300005535 Ga0070684_100350592 Ga0070684_1003505922 181
289 3300005535 Ga0070684_100442522 Ga0070684_1004425222 181
290 3300005539 Ga0068853_100323585 Ga0068853_1003235852 181
291 3300005539 Ga0068853_100466725 Ga0068853_1004667252 181
292 3300005547 Ga0070693_100186856 Ga0070693_1001868562 181
293 3300005548 Ga0070665_100003422 Ga0070665_1000034224 181
294 3300005548 Ga0070665_100021713 Ga0070665_1000217138 181
295 3300005548 Ga0070665_100077506 Ga0070665_1000775064 181
296 3300005548 Ga0070665_100094145 Ga0070665_1000941454 181
297 3300005548 Ga0070665_100503472 Ga0070665_1005034722 181
298 3300005563 Ga0068855_100019385 Ga0068855_10001938510 181
299 3300005563 Ga0068855_100083869 Ga0068855_1000838695 181
300 3300005563 Ga0068855_101676123 Ga0068855_1016761231 181
301 3300005564 Ga0070664_100129958 Ga0070664_1001299583 181
302 3300005577 Ga0068857_100110071 Ga0068857_1001100713 181
303 3300005577 Ga0068857_100263307 Ga0068857_1002633072 181
304 3300005577 Ga0068857_101514095 Ga0068857_1015140952 181
305 3300005578 Ga0068854_100609518 Ga0068854_1006095182 181
306 3300005614 Ga0068856_100024019 Ga0068856_1000240195 181
307 3300005614 Ga0068856_100055973 Ga0068856_1000559733 181
308 3300005615 Ga0070702_100054976 Ga0070702_1000549762 181
309 3300005617 Ga0068859_100244734 Ga0068859_1002447342 181
310 3300005618 Ga0068864_100060697 Ga0068864_1000606974 181
311 3300005718 Ga0068866_10013577 Ga0068866_100135773 181
312 3300005719 Ga0068861_100088160 Ga0068861_1000881602 181
313 3300005834 Ga0068851_10297758 Ga0068851_102977582 181
314 3300005840 Ga0068870_10540166 Ga0068870_105401661 181
315 3300005841 Ga0068863_100152245 Ga0068863_1001522452 181
316 3300005842 Ga0068858_100332264 Ga0068858_1003322643 181
317 3300005842 Ga0068858_101066766 Ga0068858_1010667662 181
318 3300005843 Ga0068860_100091335 Ga0068860_1000913351 181
319 3300005843 Ga0068860_100203595 Ga0068860_1002035952 181
320 3300006237 Ga0097621_100000601 Ga0097621_10000060113 181
321 3300006237 Ga0097621_100588576 Ga0097621_1005885761 181
322 3300006358 Ga0068871_100000907 Ga0068871_10000090713 181
323 3300006358 Ga0068871_100015391 Ga0068871_1000153914 181
324 3300006358 Ga0068871_100016095 Ga0068871_1000160957 181
325 3300006358 Ga0068871_100106017 Ga0068871_1001060173 181
326 3300006358 Ga0068871_100126554 Ga0068871_1001265541 181
327 3300006358 Ga0068871_100271864 Ga0068871_1002718642 181
328 3300006358 Ga0068871_100907200 Ga0068871_1009072002 181
329 3300006881 Ga0068865_100005059 Ga0068865_1000050597 181
330 3300006931 Ga0097620_100244753 Ga0097620_1002447532 181
331 3300006931 Ga0097620_100548394 Ga0097620_1005483942 181
332 3300009093 Ga0105240_10054577 Ga0105240_100545775 181
333 3300009093 Ga0105240_10059571 Ga0105240_100595715 181
334 3300009093 Ga0105240_10064622 Ga0105240_100646225 181
335 3300009093 Ga0105240_10118255 Ga0105240_101182553 181
336 3300009093 Ga0105240_10173197 Ga0105240_101731972 181
337 3300009093 Ga0105240_10405285 Ga0105240_104052853 181
338 3300009093 Ga0105240_11077383 Ga0105240_110773832 181
339 3300009098 Ga0105245_10045689 Ga0105245_100456895 181
340 3300009098 Ga0105245_10103864 Ga0105245_101038641 181
341 3300009098 Ga0105245_10147096 Ga0105245_101470962 181
342 3300009148 Ga0105243_10005024 Ga0105243_100050247 181
343 3300009148 Ga0105243_10441617 Ga0105243_104416172 181
344 3300009174 Ga0105241_10129191 Ga0105241_101291913 181
345 3300009174 Ga0105241_10406461 Ga0105241_104064612 181
346 3300009174 Ga0105241_10899802 Ga0105241_108998021 181
347 3300009176 Ga0105242_10016461 Ga0105242_100164617 181
348 3300009176 Ga0105242_10104576 Ga0105242_101045762 181
349 3300009176 Ga0105242_10147231 Ga0105242_101472313 181
350 3300009177 Ga0105248_11027074 Ga0105248_110270742 181
351 3300009177 Ga0105248_11079454 Ga0105248_110794541 181
352 3300009545 Ga0105237_10228801 Ga0105237_102288013 181
353 3300009545 Ga0105237_10317411 Ga0105237_103174112 181
354 3300009551 Ga0105238_10024027 Ga0105238_100240276 181
355 3300009551 Ga0105238_10043257 Ga0105238_100432571 181
356 3300009551 Ga0105238_10186070 Ga0105238_101860702 181
357 3300009551 Ga0105238_10725340 Ga0105238_107253402 181
358 3300009551 Ga0105238_11194392 Ga0105238_111943922 181
359 3300009553 Ga0105249_10143393 Ga0105249_101433932 181
360 3300010375 Ga0105239_10103494 Ga0105239_101034942 181
361 3300010375 Ga0105239_10325411 Ga0105239_103254113 181
362 3300011119 Ga0105246_10005529 Ga0105246_100055292 181
363 3300011119 Ga0105246_10049952 Ga0105246_100499524 181
364 3300011119 Ga0105246_10338317 Ga0105246_103383172 181
365 3300013104 Ga0157370_10020128 Ga0157370_100201288 181
366 3300013104 Ga0157370_10070406 Ga0157370_100704062 181
367 3300013105 Ga0157369_10043961 Ga0157369_100439614 181
368 3300013105 Ga0157369_10133461 Ga0157369_101334613 181
369 3300013296 Ga0157374_10053100 Ga0157374_100531004 181
370 3300013296 Ga0157374_10283493 Ga0157374_102834931 181
371 3300013297 Ga0157378_10009234 Ga0157378_100092344 181
372 3300013297 Ga0157378_10108788 Ga0157378_101087883 181
373 3300013297 Ga0157378_10112632 Ga0157378_101126323 181
374 3300013297 Ga0157378_10228564 Ga0157378_102285643 181
375 3300013306 Ga0163162_10015306 Ga0163162_100153065 181
376 3300013306 Ga0163162_10034372 Ga0163162_100343723 181
377 3300013306 Ga0163162_10513663 Ga0163162_105136633 181
378 3300013306 Ga0163162_11387702 Ga0163162_113877021 181
379 3300013307 Ga0157372_10080881 Ga0157372_100808815 181
380 3300013308 Ga0157375_10005889 Ga0157375_100058891 181
381 3300014325 Ga0163163_10000004 Ga0163163_10000004209 181
382 3300014325 Ga0163163_10055440 Ga0163163_100554405 181
383 3300014325 Ga0163163_10214214 Ga0163163_102142142 181
384 3300014326 Ga0157380_10271098 Ga0157380_102710982 181
385 3300014968 Ga0157379_10075711 Ga0157379_100757114 181
386 3300014968 Ga0157379_10134332 Ga0157379_101343322 181
387 3300014969 Ga0157376_10071265 Ga0157376_100712652 181
388 3300014969 Ga0157376_10394010 Ga0157376_103940102 181
389 3300017792 Ga0163161_10098901 Ga0163161_100989012 181
390 3300025261 Ga0209233_1000006 Ga0209233_1000006358 181
391 3300025899 Ga0207642_10031733 Ga0207642_100317332 181
392 3300025901 Ga0207688_10104969 Ga0207688_101049692 181
393 3300025903 Ga0207680_10148840 Ga0207680_101488402 181
394 3300025907 Ga0207645_10011614 Ga0207645_100116144 181
395 3300025907 Ga0207645_10128853 Ga0207645_101288532 181
396 3300025909 Ga0207705_10018936 Ga0207705_100189363 181
397 3300025911 Ga0207654_10210383 Ga0207654_102103832 181
398 3300025912 Ga0207707_10124483 Ga0207707_101244832 181
399 3300025912 Ga0207707_10173589 Ga0207707_101735892 181
400 3300025912 Ga0207707_10182482 Ga0207707_101824822 181
401 3300025913 Ga0207695_10034506 Ga0207695_100345064 181
402 3300025913 Ga0207695_10080195 Ga0207695_100801952 181
403 3300025913 Ga0207695_10148601 Ga0207695_101486012 181
404 3300025913 Ga0207695_10181127 Ga0207695_101811272 181
405 3300025913 Ga0207695_10266849 Ga0207695_102668492 181
406 3300025914 Ga0207671_10033525 Ga0207671_100335252 181
407 3300025914 Ga0207671_10037542 Ga0207671_100375426 181
408 3300025917 Ga0207660_10180883 Ga0207660_101808832 181
409 3300025919 Ga0207657_10017562 Ga0207657_100175623 181
410 3300025919 Ga0207657_10020087 Ga0207657_100200872 181
411 3300025920 Ga0207649_10067833 Ga0207649_100678332 181
412 3300025921 Ga0207652_10074685 Ga0207652_100746852 181
413 3300025921 Ga0207652_10192338 Ga0207652_101923382 181
414 3300025924 Ga0207694_10119660 Ga0207694_101196601 181
415 3300025924 Ga0207694_10398158 Ga0207694_103981581 181
416 3300025924 Ga0207694_10709834 Ga0207694_107098341 181
417 3300025924 Ga0207694_11137962 Ga0207694_111379622 181
418 3300025925 Ga0207650_10226759 Ga0207650_102267592 181
419 3300025926 Ga0207659_10146348 Ga0207659_101463482 181
420 3300025926 Ga0207659_10172499 Ga0207659_101724993 181
421 3300025926 Ga0207659_10702716 Ga0207659_107027161 181
422 3300025927 Ga0207687_10020517 Ga0207687_100205176 181
423 3300025927 Ga0207687_10056857 Ga0207687_100568572 181
424 3300025931 Ga0207644_10254356 Ga0207644_102543563 181
425 3300025934 Ga0207686_10222505 Ga0207686_102225052 181
426 3300025934 Ga0207686_10751967 Ga0207686_107519671 181
427 3300025935 Ga0207709_10007087 Ga0207709_100070874 181
428 3300025935 Ga0207709_10420559 Ga0207709_104205591 181
429 3300025937 Ga0207669_10067957 Ga0207669_100679571 181
430 3300025937 Ga0207669_10398217 Ga0207669_103982172 181
431 3300025938 Ga0207704_10137288 Ga0207704_101372882 181
432 3300025938 Ga0207704_10599621 Ga0207704_105996212 181
433 3300025940 Ga0207691_10677929 Ga0207691_106779292 181
434 3300025942 Ga0207689_10023830 Ga0207689_100238302 181
435 3300025942 Ga0207689_10630390 Ga0207689_106303902 181
436 3300025944 Ga0207661_10018512 Ga0207661_100185123 181
437 3300025944 Ga0207661_10330912 Ga0207661_103309122 181
438 3300025944 Ga0207661_10992732 Ga0207661_109927321 181
439 3300025949 Ga0207667_10027571 Ga0207667_100275715 181
440 3300025949 Ga0207667_10168934 Ga0207667_101689343 181
441 3300025949 Ga0207667_10206229 Ga0207667_102062294 181
442 3300025949 Ga0207667_10620704 Ga0207667_106207041 181
443 3300025961 Ga0207712_10024089 Ga0207712_100240893 181
444 3300025972 Ga0207668_11175680 Ga0207668_111756801 181
445 3300025981 Ga0207640_10862283 Ga0207640_108622831 181
446 3300025986 Ga0207658_10093077 Ga0207658_100930774 181
447 3300026023 Ga0207677_10010149 Ga0207677_100101491 181
448 3300026035 Ga0207703_10116398 Ga0207703_101163982 181
449 3300026041 Ga0207639_10075570 Ga0207639_100755704 181
450 3300026041 Ga0207639_10181857 Ga0207639_101818572 181
451 3300026041 Ga0207639_10193976 Ga0207639_101939762 181
452 3300026078 Ga0207702_10089075 Ga0207702_100890754 181
453 3300026089 Ga0207648_10032657 Ga0207648_100326573 181
454 3300026095 Ga0207676_10097213 Ga0207676_100972133 181
455 3300026095 Ga0207676_10809637 Ga0207676_108096372 181
456 3300026095 Ga0207676_11633845 Ga0207676_116338451 181
457 3300026116 Ga0207674_10058668 Ga0207674_100586687 181
458 3300026116 Ga0207674_10181308 Ga0207674_101813083 181
459 3300026116 Ga0207674_10338197 Ga0207674_103381972 181
460 3300026116 Ga0207674_10886021 Ga0207674_108860212 181
461 3300026118 Ga0207675_100158342 Ga0207675_1001583422 181
462 3300026121 Ga0207683_10040965 Ga0207683_100409654 181
463 3300026121 Ga0207683_10150480 Ga0207683_101504804 181
464 3300026121 Ga0207683_10178397 Ga0207683_101783973 181
465 3300028379 Ga0268266_10000746 Ga0268266_1000074615 181
466 3300028379 Ga0268266_10075666 Ga0268266_100756663 181
467 3300028379 Ga0268266_10161497 Ga0268266_101614972 181
468 3300028379 Ga0268266_10325506 Ga0268266_103255061 181
469 3300028379 Ga0268266_10402672 Ga0268266_104026722 181
470 3300028379 Ga0268266_10472519 Ga0268266_104725191 181
471 3300028380 Ga0268265_11600879 Ga0268265_116008791 181
472 3300028381 Ga0268264_10341534 Ga0268264_103415341 181
473 3300028381 Ga0268264_10739613 Ga0268264_107396132 181
474 3300028800 Ga0265338_10012930 Ga0265338_100129308 181
475 3300031235 Ga0265330_10045261 Ga0265330_100452612 181
476 3300031238 Ga0265332_10065513 Ga0265332_100655132 181
477 3300031247 Ga0265340_10125126 Ga0265340_101251262 181
478 3300031730 Ga0307516_10217257 Ga0307516_102172571 181
479 3300035085 Ga0373929_0019734 Ga0373929_0019734_696_1241 181
480 3300037418 Ga0395900_0025803 Ga0395900_0025803_2992_3564 181
481 3300037466 Ga0395898_0290672 Ga0395898_0290672_698_1270 181
482 3300044842 Ga0466957_0764370 Ga0466957_0764370_38_610 181
483 3300045836 Ga0466958_0610020 Ga0466958_0610020_102_674 181
484 3300046454 Ga0495592_0168790 Ga0495592_0168790_505_1065 181
485 3300046507 Ga0495606_0092150 Ga0495606_0092150_156_731 181
486 3300046507 Ga0495606_0179072 Ga0495606_0179072_179_724 181
487 3300046538 Ga0495609_0101199 Ga0495609_0101199_406_966 181
488 3300046615 Ga0495656_0061536 Ga0495656_0061536_152_697 181
489 3300046660 Ga0495625_0291623 Ga0495625_0291623_165_764 181
490 3300046794 Ga0495589_0038245 Ga0495589_0038245_1381_1977 181
491 3300047320 Ga0495672_0200548 Ga0495672_0200548_88_675 181
492 3300047320 Ga0495672_0210267 Ga0495672_0210267_46_633 181
493 3300047447 Ga0495685_174416 Ga0495685_174416_74_619 181
494 3300047673 Ga0495593_0198600 Ga0495593_0198600_107_652 181
495 3300048918 Ga0496115_0348068 Ga0496115_0348068_381_926 181
496 3300048924 Ga0496121_0000323 Ga0496121_0000323_73656_74210 181
497 3300049571 Ga0501034_0416934 Ga0501034_0416934_386_946 181
498 3300049571 Ga0501034_0644036 Ga0501034_0644036_38_610 181
499 3300049580 Ga0501046_0070365 Ga0501046_0070365_53_598 181
500 3300049581 Ga0501047_0043985 Ga0501047_0043985_1844_2428 181
501 3300049581 Ga0501047_0080559 Ga0501047_0080559_1461_2006 181
502 3300049589 Ga0501073_0057842 Ga0501073_0057842_943_1515 181
503 3300049742 Ga0501080_0171492 Ga0501080_0171492_1411_1983 181
504 3300049742 Ga0501080_0314948 Ga0501080_0314948_144_743 181
505 3300049822 Ga0501035_0067452 Ga0501035_0067452_948_1493 181
506 3300049823 Ga0501044_0546486 Ga0501044_0546486_233_805 181
507 3300053087 Ga0500643_000123 Ga0500643_000123_41178_41753 181
508 3300053111 Ga0500572_057245 Ga0500572_057245_285_863 181
509 3300053119 Ga0500595_000109 Ga0500595_000109_14643_15221 181
510 3300053136 Ga0500559_0034988 Ga0500559_0034988_339_920 181
511 3300053139 Ga0500568_0008212 Ga0500568_0008212_373_948 181
512 3300053140 Ga0500573_0000060 Ga0500573_0000060_2621_3166 181
513 3300053730 Ga0500645_067378 Ga0500645_067378_353_928 181

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

39

154

0.71

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

70

156

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rs2-assembly1.cif.gz_A 1.55 angstrom crystal structure of gnat family n-acetyltransferase (yhbs) from escherichia coli in complex with coa 0.8448 5 164
8f51-assembly1.cif.gz_A crystal structure of acetyltransferase eis from m. tuberculosis in complex with mefloquine 0.7977 9 130
8d1r-assembly1.cif.gz_A crystal structure of acetyltransferase eis from mycobacterium tuberculosis in complex with inhibitor sgt520 0.7975 9 130
6p3v-assembly1.cif.gz_A crystal structure of eis from mycobacterium tuberculosis in complex with inhibitor sgt416 0.7967 9 130
6b0u-assembly1.cif.gz_B-2 crystal structure of acetyltransferase eis from mycobacterium tuberculosis in complex with a lys-containing peptide 0.7937 9 130
ID Description Score Start End Superfamily
af_O13738_1_94_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8585 52 127 3.40.630.30
af_Q2G016_1_176_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8456 9 164 3.40.630.30
af_Q0D8A4_1_78_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8282 79 133 3.40.630.30
af_A0A0R0GB23_111_314_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8276 61 129 3.40.630.30
af_Q10R02_113_296_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8179 52 132 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A537RXF1-F1-model_v4 N-acetyltransferase 0.9746 52 168 GO:0016747
AF-A0A7Y4T9Z0-F1-model_v4 N-acetyltransferase 0.9715 8 169 GO:0016747
AF-A0A6S6QMD2-F1-model_v4 N-acetyltransferase 0.9667 8 166 GO:0016747
AF-A0A0P6WAY1-F1-model_v4 N-acetyltransferase domain-containing protein 0.9646 5 166 GO:0016747
AF-A0A212RW70-F1-model_v4 Predicted N-acetyltransferase YhbS 0.9627 8 164 GO:0016747

Feature Viewer

pLDDT pTM Quality
88.41 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map