F457455

General Info

Members Datasets Scaffolds Average Seq Length
512 217 491 230

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0042260|Ga0395899_0042260_666_1481
Length 271
Sequence LITPASYFPLRKFPDFEAFILNLDARRNSQSAVLQATGVESHMNAPFIDLSVHHDPKGLSDRVAFGFTKALRWCADTFFAERYGHRAVVLETVAAVPGMVGATINHLHCLRRICDDKGWIRTLMDEAENERMHLMTFIEISKPTLFERAVIIGAQWIFYCFFFALYLISSKTAHRVVGYFEEEAVVSYTHYLAEIDEGRSENVPAPAIARRYWGLPDGATLRDVVLVVRADEAHHRDVNHGFANELAGLPQGSVAACPPHHELRPQWKEAA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
3 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
4 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
5 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
6 2643221584 Caulobacter sp. Root656 Isolate Unclassified
7 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
8 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
9 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
10 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
11 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
12 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
13 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
14 2818991435 Caulobacter henricii 536 Isolate Unclassified
15 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
16 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
17 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
18 2851153111 Caulobacter radicis 736 Isolate Unclassified
19 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
20 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
21 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
22 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
23 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
24 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
25 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
26 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
27 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
28 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
29 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
30 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
31 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
32 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
33 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
34 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
35 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
36 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
37 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
38 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
39 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
40 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
41 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
42 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
43 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
44 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
45 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
46 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
47 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
48 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
49 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
91 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
143 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
155 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
156 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
157 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
158 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
159 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
162 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
163 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
164 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
165 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
166 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
167 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
168 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
169 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
170 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
171 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
172 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
173 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
180 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
181 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
182 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
183 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
184 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
185 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
186 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
187 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
188 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
189 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
199 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
200 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
201 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
202 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
203 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
204 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
206 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
207 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
208 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
209 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
210 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
211 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
212 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
213 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
214 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
215 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
216 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
217 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.7
Metatranscriptomes 0.2
Isolates 4.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.91
Nodule 0
Rhizoplane 1.56
Rhizosphere 80.27
Stem 0
Stem Tuber 0
Unclassified 6.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_125707 2162886007 Bacteria 1024
2 JGI24736J21556_1002109 3300001904 Bacteria 3530
3 JGI24736J21556_1024664 3300001904 Bacteria 937
4 JGI24740J21852_10000027 3300001979 Bacteria 48883
5 JGI24740J21852_10021828 3300001979 Bacteria 2213
6 JGI24740J21852_10026321 3300001979 Bacteria 1950
7 JGI24740J21852_10081356 3300001979 Bacteria 848
8 JGI24739J22299_10000020 3300001989 Bacteria 47202
9 JGI24739J22299_10032479 3300001989 Bacteria 1795
10 JGI24737J22298_10002299 3300001990 Bacteria 6796
11 JGI24737J22298_10007374 3300001990 Bacteria 3716
12 JGI24737J22298_10007815 3300001990 Bacteria 3604
13 JGI24737J22298_10028340 3300001990 Bacteria 1761
14 JGI24735J21928_10000290 3300002067 Bacteria 17505
15 JGI24735J21928_10001619 3300002067 Bacteria 7970
16 JGI24735J21928_10001814 3300002067 Bacteria 7503
17 JGI24735J21928_10012552 3300002067 Bacteria 2676
18 JGI24738J21930_10001336 3300002075 Bacteria 6862
19 JGI24738J21930_10003333 3300002075 Bacteria 4074
20 JGI24738J21930_10020607 3300002075 Bacteria 1370
21 rootH1_10012575 3300003316 Bacteria 2012
22 rootH1_10041342 3300003316 Bacteria 1606
23 rootH1_10046413 3300003316 Bacteria 4214
24 rootL2_10073984 3300003322 Bacteria 1533
25 Ga0055542_1000040 3300003762 Bacteria 214035
26 Ga0055529_1000037 3300003763 Bacteria 237307
27 Ga0055526_1049969 3300003771 Bacteria 962
28 Ga0055537_1001312 3300003773 Bacteria 10199
29 Ga0055537_1002388 3300003773 Bacteria 6341
30 Ga0055524_1000199 3300003775 Bacteria 66009
31 Ga0055524_1004481 3300003775 Bacteria 6442
32 Ga0055536_1000665 3300003781 Bacteria 23126
33 Ga0055536_1000669 3300003781 Bacteria 23058
34 Ga0055528_1024521 3300003790 Bacteria 1805
35 Ga0055530_10003810 3300003791 Bacteria 8291
36 Ga0055530_10006017 3300003791 Bacteria 5562
37 Ga0055531_10000274 3300003794 Bacteria 53225
38 Ga0055531_10007650 3300003794 Bacteria 5850
39 Ga0055531_10008986 3300003794 Bacteria 5169
40 Ga0055531_10035590 3300003794 Bacteria 1555
41 Ga0065165_1000452 3300005262 Bacteria 64313
42 Ga0065165_1097762 3300005262 Bacteria 739
43 Ga0065704_10071643 3300005289 Bacteria 10403
44 Ga0070658_10001448 3300005327 Bacteria 20245
45 Ga0070658_10001594 3300005327 Bacteria 19164
46 Ga0070658_10035126 3300005327 Bacteria 4036
47 Ga0070658_10082384 3300005327 Bacteria 2644
48 Ga0070658_10104042 3300005327 Bacteria 2348
49 Ga0070658_10389788 3300005327 Bacteria 1196
50 Ga0070658_10402806 3300005327 Bacteria 1175
51 Ga0070666_10003680 3300005335 Bacteria 9291
52 Ga0070666_10043132 3300005335 Bacteria 3020
53 Ga0070680_100015212 3300005336 Bacteria 6029
54 Ga0070682_100529759 3300005337 Bacteria 918
55 Ga0068868_100193314 3300005338 Bacteria 1693
56 Ga0070660_100002668 3300005339 Bacteria 12258
57 Ga0070660_100017287 3300005339 Bacteria 5254
58 Ga0070660_100030175 3300005339 Bacteria 4066
59 Ga0070660_100094585 3300005339 Bacteria 2361
60 Ga0070661_100000034 3300005344 Bacteria 111603
61 Ga0070661_100005833 3300005344 Bacteria 8469
62 Ga0070661_100017372 3300005344 Bacteria 5104
63 Ga0070661_100023097 3300005344 Bacteria 4456
64 Ga0070661_100024865 3300005344 Bacteria 4298
65 Ga0070661_100657826 3300005344 Bacteria 851
66 Ga0070671_100031919 3300005355 Bacteria 4354
67 Ga0070671_100042885 3300005355 Bacteria 3762
68 Ga0070671_100242813 3300005355 Bacteria 1529
69 Ga0070659_100001323 3300005366 Bacteria 17889
70 Ga0070659_100084369 3300005366 Bacteria 2540
71 Ga0070659_100293201 3300005366 Bacteria 1355
72 Ga0070667_100016917 3300005367 Bacteria 6035
73 Ga0070663_100004400 3300005455 Bacteria 8278
74 Ga0070663_100069757 3300005455 Bacteria 2554
75 Ga0070663_100104766 3300005455 Bacteria 2116
76 Ga0070663_100294737 3300005455 Bacteria 1296
77 Ga0070662_100007810 3300005457 Bacteria 6950
78 Ga0070662_100027734 3300005457 Bacteria 3935
79 Ga0070662_100240827 3300005457 Bacteria 1451
80 Ga0070662_100261586 3300005457 Bacteria 1394
81 Ga0070681_10044455 3300005458 Bacteria 4446
82 Ga0068867_100053956 3300005459 Bacteria 2969
83 Ga0070679_100158069 3300005530 Bacteria 2241
84 Ga0068853_100000413 3300005539 Bacteria 29440
85 Ga0068853_100024740 3300005539 Bacteria 5037
86 Ga0068853_100027433 3300005539 Bacteria 4784
87 Ga0068853_100048829 3300005539 Bacteria 3636
88 Ga0070693_100202157 3300005547 Bacteria 1291
89 Ga0070665_100002091 3300005548 Bacteria 22383
90 Ga0070665_100064968 3300005548 Plasmid 3660
91 Ga0070665_100243409 3300005548 Bacteria 1799
92 Ga0068855_100010205 3300005563 Bacteria 11321
93 Ga0068855_100016025 3300005563 Bacteria 9016
94 Ga0068855_100028902 3300005563 Bacteria 6633
95 Ga0068855_100039453 3300005563 Bacteria 5606
96 Ga0068855_100107503 3300005563 Bacteria 3205
97 Ga0068855_100922965 3300005563 Bacteria 921
98 Ga0070664_100167815 3300005564 Bacteria 1946
99 Ga0070664_100243469 3300005564 Bacteria 1615
100 Ga0068857_100001206 3300005577 Bacteria 20155
101 Ga0068857_100033862 3300005577 Bacteria 4519
102 Ga0068857_100037123 3300005577 Bacteria 4316
103 Ga0068854_100462220 3300005578 Bacteria 1062
104 Ga0068856_100007329 3300005614 Bacteria 10767
105 Ga0068856_100012003 3300005614 Bacteria 8392
106 Ga0068856_100013223 3300005614 Bacteria 7993
107 Ga0068856_100155097 3300005614 Bacteria 2300
108 Ga0068856_100294488 3300005614 Bacteria 1640
109 Ga0068856_100589882 3300005614 Bacteria 1132
110 Ga0068852_100000368 3300005616 Bacteria 30413
111 Ga0068852_100003523 3300005616 Bacteria 10950
112 Ga0068852_100090300 3300005616 Bacteria 2739
113 Ga0068852_100439871 3300005616 Bacteria 1289
114 Ga0068864_100016656 3300005618 Bacteria 6123
115 Ga0068851_10041154 3300005834 Bacteria 2323
116 Ga0068851_10066236 3300005834 Bacteria 1861
117 Ga0068851_10189014 3300005834 Bacteria 1144
118 Ga0068863_100194241 3300005841 Bacteria 1951
119 Ga0068858_100580708 3300005842 Bacteria 1086
120 Ga0068858_100828598 3300005842 Bacteria 903
121 Ga0068862_100001106 3300005844 Bacteria 25606
122 Ga0081455_10002267 3300005937 Bacteria 22933
123 Ga0075367_10115559 3300006178 Bacteria 1650
124 Ga0075369_10001529 3300006186 Bacteria 7921
125 Ga0075366_10027861 3300006195 Bacteria 3315
126 Ga0075366_10115049 3300006195 Bacteria 1620
127 Ga0105251_10000071 3300009011 Bacteria 97636
128 Ga0105240_10038327 3300009093 Bacteria 6148
129 Ga0105240_10496560 3300009093 Bacteria 1358
130 Ga0105241_10037405 3300009174 Bacteria 3656
131 Ga0105241_10272549 3300009174 Bacteria 1442
132 Ga0105241_10294951 3300009174 Bacteria 1389
133 Ga0105248_10028435 3300009177 Bacteria 6228
134 Ga0105248_10041910 3300009177 Bacteria 5133
135 Ga0105237_10108970 3300009545 Bacteria 2761
136 Ga0105237_10323223 3300009545 Bacteria 1547
137 Ga0105238_10018476 3300009551 Bacteria 7095
138 Ga0105238_10063479 3300009551 Bacteria 3694
139 Ga0105238_10083405 3300009551 Bacteria 3185
140 Ga0105238_10288399 3300009551 Bacteria 1623
141 Ga0105239_10009809 3300010375 Bacteria 10759
142 Ga0105239_10029878 3300010375 Bacteria 5993
143 Ga0157373_10028700 3300013100 Bacteria 4013
144 Ga0157373_10111139 3300013100 Bacteria 1927
145 Ga0157371_10007636 3300013102 Bacteria 8721
146 Ga0157371_10034275 3300013102 Bacteria 3642
147 Ga0157371_10181981 3300013102 Bacteria 1503
148 Ga0157371_10199714 3300013102 Bacteria 1433
149 Ga0157371_10210079 3300013102 Bacteria 1396
150 Ga0157370_10023720 3300013104 Bacteria 6088
151 Ga0157370_10101193 3300013104 Bacteria 2699
152 Ga0157370_10104298 3300013104 Bacteria 2654
153 Ga0157369_10001977 3300013105 Bacteria 24695
154 Ga0157369_10038853 3300013105 Bacteria 5203
155 Ga0157369_10091477 3300013105 Bacteria 3247
156 Ga0157369_10125841 3300013105 Bacteria 2717
157 Ga0157369_10304427 3300013105 Bacteria 1658
158 Ga0157369_10370888 3300013105 Bacteria 1486
159 Ga0157369_11162393 3300013105 Bacteria 788
160 Ga0157374_10213828 3300013296 Bacteria 1891
161 Ga0157374_10901652 3300013296 Bacteria 902
162 Ga0163162_10015972 3300013306 Bacteria 7338
163 Ga0157372_10007103 3300013307 Bacteria 11935
164 Ga0157372_10029840 3300013307 Bacteria 5959
165 Ga0157372_10045170 3300013307 Bacteria 4885
166 Ga0157372_10056162 3300013307 Bacteria 4399
167 Ga0157372_10083822 3300013307 Bacteria 3611
168 Ga0157372_10143048 3300013307 Bacteria 2758
169 Ga0157372_10238061 3300013307 Bacteria 2112
170 Ga0163163_10119589 3300014325 Bacteria 2668
171 Ga0183365_10008 3300015684 Bacteria 74681
172 Ga0209148_1000011 3300025254 Bacteria 1196503
173 Ga0209565_1000010 3300025263 Bacteria 687724
174 Ga0209565_1000183 3300025263 Bacteria 76983
175 Ga0209455_1000006 3300025272 Bacteria 1196503
176 Ga0209455_1021089 3300025272 Bacteria 1273
177 Ga0209673_1001029 3300025273 Bacteria 33050
178 Ga0209673_1003411 3300025273 Bacteria 9415
179 Ga0209675_1005636 3300025291 Bacteria 5183
180 Ga0209676_1000243 3300025292 Bacteria 117113
181 Ga0209676_1000311 3300025292 Bacteria 95478
182 Ga0209564_1012585 3300025295 Bacteria 3675
183 Ga0209564_1027806 3300025295 Bacteria 1827
184 Ga0209758_1002141 3300025297 Bacteria 20813
185 Ga0209758_1004255 3300025297 Bacteria 12107
186 Ga0209050_1000244 3300025298 Bacteria 117105
187 Ga0209050_1000375 3300025298 Bacteria 84503
188 Ga0209256_1000034 3300025299 Bacteria 388475
189 Ga0209256_1001520 3300025299 Bacteria 23400
190 Ga0209256_1011996 3300025299 Bacteria 3387
191 Ga0209256_1014992 3300025299 Bacteria 2743
192 Ga0209051_1000966 3300025303 Bacteria 28138
193 Ga0209257_1000140 3300025304 Bacteria 201515
194 Ga0209257_1000352 3300025304 Bacteria 94530
195 Ga0209257_1000485 3300025304 Bacteria 71633
196 Ga0209257_1007082 3300025304 Bacteria 6920
197 Ga0207656_10011531 3300025321 Bacteria 3340
198 Ga0207656_10072115 3300025321 Bacteria 1537
199 Ga0207713_1001241 3300025735 Bacteria 21135
200 Ga0207680_10013166 3300025903 Bacteria 4239
201 Ga0207680_10028110 3300025903 Bacteria 3142
202 Ga0207647_10000037 3300025904 Bacteria 97521
203 Ga0207647_10000089 3300025904 Bacteria 69909
204 Ga0207647_10139584 3300025904 Bacteria 1420
205 Ga0207705_10000664 3300025909 Bacteria 28582
206 Ga0207705_10001737 3300025909 Bacteria 17260
207 Ga0207705_10010255 3300025909 Bacteria 6816
208 Ga0207705_10036403 3300025909 Bacteria 3522
209 Ga0207705_10176892 3300025909 Bacteria 1609
210 Ga0207705_10229146 3300025909 Bacteria 1413
211 Ga0207654_10089627 3300025911 Bacteria 1872
212 Ga0207695_10040423 3300025913 Bacteria 5001
213 Ga0207695_10105291 3300025913 Bacteria 2809
214 Ga0207660_10201307 3300025917 Bacteria 1555
215 Ga0207657_10006404 3300025919 Bacteria 12216
216 Ga0207657_10008069 3300025919 Bacteria 10737
217 Ga0207657_10010870 3300025919 Bacteria 9055
218 Ga0207657_10063260 3300025919 Bacteria 3164
219 Ga0207657_10265549 3300025919 Bacteria 1365
220 Ga0207649_10000045 3300025920 Bacteria 112787
221 Ga0207649_10003549 3300025920 Bacteria 8527
222 Ga0207649_10044223 3300025920 Bacteria 2726
223 Ga0207649_10051368 3300025920 Bacteria 2552
224 Ga0207649_10056054 3300025920 Bacteria 2459
225 Ga0207652_10704929 3300025921 Bacteria 900
226 Ga0207694_10013363 3300025924 Bacteria 6183
227 Ga0207694_10200600 3300025924 Bacteria 1623
228 Ga0207644_10027649 3300025931 Bacteria 3920
229 Ga0207644_10028583 3300025931 Bacteria 3862
230 Ga0207644_10028758 3300025931 Bacteria 3851
231 Ga0207690_10000856 3300025932 Bacteria 19516
232 Ga0207690_10001355 3300025932 Bacteria 15367
233 Ga0207690_10008364 3300025932 Bacteria 6141
234 Ga0207706_10001571 3300025933 Bacteria 22653
235 Ga0207706_10018875 3300025933 Bacteria 6202
236 Ga0207706_10107046 3300025933 Bacteria 2460
237 Ga0207706_10236668 3300025933 Bacteria 1596
238 Ga0207711_10006753 3300025941 Bacteria 9647
239 Ga0207711_10092217 3300025941 Bacteria 2666
240 Ga0207661_10019746 3300025944 Bacteria 5030
241 Ga0207679_10005153 3300025945 Bacteria 8184
242 Ga0207679_10123032 3300025945 Bacteria 2069
243 Ga0207679_10161911 3300025945 Bacteria 1833
244 Ga0207667_10032217 3300025949 Bacteria 5650
245 Ga0207667_10122290 3300025949 Bacteria 2682
246 Ga0207667_10144506 3300025949 Bacteria 2449
247 Ga0207667_10166080 3300025949 Bacteria 2269
248 Ga0207667_10843155 3300025949 Bacteria 911
249 Ga0207640_10179119 3300025981 Bacteria 1587
250 Ga0207658_10028982 3300025986 Bacteria 3904
251 Ga0207677_10250137 3300026023 Bacteria 1439
252 Ga0207703_10751267 3300026035 Bacteria 929
253 Ga0207639_10000445 3300026041 Bacteria 28582
254 Ga0207639_10004048 3300026041 Bacteria 9888
255 Ga0207639_10022718 3300026041 Bacteria 4521
256 Ga0207678_10005785 3300026067 Bacteria 11025
257 Ga0207678_10030212 3300026067 Bacteria 4730
258 Ga0207678_10044600 3300026067 Bacteria 3835
259 Ga0207678_10126925 3300026067 Bacteria 2176
260 Ga0207702_10002427 3300026078 Bacteria 17713
261 Ga0207702_10005581 3300026078 Bacteria 10984
262 Ga0207702_10009289 3300026078 Bacteria 8260
263 Ga0207702_10055667 3300026078 Bacteria 3355
264 Ga0207702_10084403 3300026078 Bacteria 2765
265 Ga0207702_10125030 3300026078 Bacteria 2307
266 Ga0207702_10230719 3300026078 Bacteria 1730
267 Ga0207641_10148378 3300026088 Bacteria 2122
268 Ga0207648_10103384 3300026089 Bacteria 2498
269 Ga0207676_10003457 3300026095 Bacteria 11180
270 Ga0207683_10561126 3300026121 Bacteria 1056
271 Ga0207698_10000614 3300026142 Bacteria 20756
272 Ga0207698_10013859 3300026142 Bacteria 5337
273 Ga0207698_10014516 3300026142 Bacteria 5240
274 Ga0207698_10019451 3300026142 Bacteria 4650
275 Ga0207698_10103402 3300026142 Bacteria 2367
276 Ga0207698_10281456 3300026142 Bacteria 1539
277 Ga0268266_10002857 3300028379 Bacteria 17994
278 Ga0268266_10261803 3300028379 Bacteria 1603
279 Ga0268266_10380905 3300028379 Bacteria 1330
280 Ga0268265_10000784 3300028380 Bacteria 30408
281 Ga0316177_1033916 3300030731 Bacteria 1638
282 Ga0307408_100024214 3300031548 Bacteria 4143
283 Ga0307408_100038556 3300031548 Bacteria 3372
284 Ga0307408_100047097 3300031548 Bacteria 3086
285 Ga0307408_100120803 3300031548 Bacteria 2029
286 Ga0307408_100218653 3300031548 Bacteria 1553
287 Ga0307408_100706150 3300031548 Bacteria 907
288 Ga0307405_10025238 3300031731 Bacteria 3408
289 Ga0307405_10026351 3300031731 Bacteria 3353
290 Ga0307405_10146591 3300031731 Bacteria 1654
291 Ga0307405_10201370 3300031731 Bacteria 1446
292 Ga0307405_10258902 3300031731 Bacteria 1298
293 Ga0307405_10439453 3300031731 Bacteria 1031
294 Ga0307405_10458362 3300031731 Bacteria 1012
295 Ga0307405_10634952 3300031731 Bacteria 876
296 Ga0307405_10839849 3300031731 Bacteria 772
297 Ga0307413_10000169 3300031824 Bacteria 18243
298 Ga0307413_10005741 3300031824 Bacteria 5578
299 Ga0307413_10005818 3300031824 Bacteria 5555
300 Ga0307413_10019394 3300031824 Bacteria 3593
301 Ga0307413_10028379 3300031824 Bacteria 3116
302 Ga0307413_10061284 3300031824 Bacteria 2320
303 Ga0307413_10082599 3300031824 Bacteria 2064
304 Ga0307413_10130794 3300031824 Bacteria 1717
305 Ga0307413_10315866 3300031824 Bacteria 1191
306 Ga0307410_10082023 3300031852 Bacteria 2267
307 Ga0307410_10086948 3300031852 Bacteria 2209
308 Ga0307410_10121351 3300031852 Bacteria 1906
309 Ga0307410_10121926 3300031852 Bacteria 1902
310 Ga0307410_10129672 3300031852 Bacteria 1851
311 Ga0307410_10210900 3300031852 Bacteria 1488
312 Ga0307410_10263743 3300031852 Bacteria 1344
313 Ga0307410_10291926 3300031852 Bacteria 1283
314 Ga0307410_10325220 3300031852 Bacteria 1221
315 Ga0307410_10906534 3300031852 Bacteria 755
316 Ga0307406_10013294 3300031901 Bacteria 4713
317 Ga0307406_10028191 3300031901 Bacteria 3391
318 Ga0307406_10042999 3300031901 Bacteria 2824
319 Ga0307406_10140476 3300031901 Bacteria 1709
320 Ga0307406_10384518 3300031901 Bacteria 1107
321 Ga0307407_10005143 3300031903 Bacteria 5642
322 Ga0307407_10048947 3300031903 Bacteria 2409
323 Ga0307407_10056753 3300031903 Bacteria 2269
324 Ga0307407_10149643 3300031903 Bacteria 1515
325 Ga0307407_10216079 3300031903 Bacteria 1293
326 Ga0307407_10249542 3300031903 Bacteria 1215
327 Ga0307412_10014674 3300031911 Bacteria 4628
328 Ga0307412_10020916 3300031911 Bacteria 3988
329 Ga0307412_10032634 3300031911 Bacteria 3302
330 Ga0307412_10039600 3300031911 Bacteria 3044
331 Ga0307412_10101886 3300031911 Bacteria 2032
332 Ga0307412_10144568 3300031911 Bacteria 1746
333 Ga0307409_100000287 3300031995 Bacteria 20454
334 Ga0307409_100016601 3300031995 Bacteria 4877
335 Ga0307409_100017773 3300031995 Bacteria 4753
336 Ga0307409_100018502 3300031995 Bacteria 4687
337 Ga0307409_100052776 3300031995 Bacteria 3119
338 Ga0307409_100062773 3300031995 Bacteria 2910
339 Ga0307409_100098254 3300031995 Bacteria 2420
340 Ga0307409_100172809 3300031995 Bacteria 1904
341 Ga0307409_100281913 3300031995 Bacteria 1536
342 Ga0307409_100455758 3300031995 Bacteria 1235
343 Ga0307409_100575914 3300031995 Bacteria 1109
344 Ga0307409_100659418 3300031995 Bacteria 1041
345 Ga0307416_100014682 3300032002 Bacteria 5380
346 Ga0307416_100072139 3300032002 Bacteria 2872
347 Ga0307416_100102359 3300032002 Bacteria 2497
348 Ga0307416_100123357 3300032002 Bacteria 2315
349 Ga0307416_100146647 3300032002 Bacteria 2156
350 Ga0307416_100178751 3300032002 Bacteria 1986
351 Ga0307416_100417377 3300032002 Bacteria 1385
352 Ga0307416_100923636 3300032002 Bacteria 974
353 Ga0307414_10000136 3300032004 Bacteria 49913
354 Ga0307414_10000612 3300032004 Bacteria 18284
355 Ga0307414_10003224 3300032004 Bacteria 8687
356 Ga0307414_10011412 3300032004 Bacteria 5208
357 Ga0307414_10015083 3300032004 Bacteria 4656
358 Ga0307414_10015215 3300032004 Bacteria 4639
359 Ga0307414_10031147 3300032004 Bacteria 3495
360 Ga0307414_10035484 3300032004 Bacteria 3319
361 Ga0307414_10054843 3300032004 Bacteria 2787
362 Ga0307414_10069268 3300032004 Bacteria 2535
363 Ga0307414_10087175 3300032004 Bacteria 2305
364 Ga0307414_10090166 3300032004 Bacteria 2274
365 Ga0307414_10096987 3300032004 Bacteria 2207
366 Ga0307414_10105200 3300032004 Bacteria 2133
367 Ga0307414_10135015 3300032004 Bacteria 1922
368 Ga0307414_10220351 3300032004 Bacteria 1557
369 Ga0307414_10258250 3300032004 Bacteria 1452
370 Ga0307414_10276219 3300032004 Bacteria 1409
371 Ga0307414_10289585 3300032004 Bacteria 1380
372 Ga0307414_10315087 3300032004 Bacteria 1329
373 Ga0307414_10401571 3300032004 Bacteria 1190
374 Ga0307411_10007126 3300032005 Bacteria 5663
375 Ga0307411_10030466 3300032005 Bacteria 3307
376 Ga0307411_10032200 3300032005 Bacteria 3237
377 Ga0307411_10032839 3300032005 Bacteria 3212
378 Ga0307411_10044775 3300032005 Bacteria 2841
379 Ga0307411_10057314 3300032005 Bacteria 2573
380 Ga0307411_10058692 3300032005 Bacteria 2547
381 Ga0307411_10061306 3300032005 Bacteria 2503
382 Ga0307411_10065871 3300032005 Bacteria 2431
383 Ga0307411_10113682 3300032005 Bacteria 1943
384 Ga0307411_10265682 3300032005 Bacteria 1357
385 Ga0307411_10946145 3300032005 Bacteria 768
386 Ga0307415_100010621 3300032126 Bacteria 5222
387 Ga0307415_100026300 3300032126 Bacteria 3668
388 Ga0307415_100222409 3300032126 Bacteria 1514
389 Ga0307415_100367063 3300032126 Bacteria 1217
390 Ga0307415_100460511 3300032126 Bacteria 1102
391 Ga0307415_100490790 3300032126 Bacteria 1071
392 Ga0307415_100582707 3300032126 Bacteria 992
393 Ga0307415_100680063 3300032126 Bacteria 926
394 Ga0395899_0000004 3300037312 Bacteria 874267
395 Ga0395899_0042260 3300037312 Bacteria 3403
396 Ga0395899_0066979 3300037312 Bacteria 2636
397 Ga0395899_0311974 3300037312 Bacteria 1062
398 Ga0395900_0002600 3300037418 Bacteria 19734
399 Ga0395900_0099133 3300037418 Bacteria 2993
400 Ga0395898_0008564 3300037466 Bacteria 10797
401 Ga0395905_0021040 3300037471 Bacteria 6176
402 Ga0395905_0159554 3300037471 Bacteria 2120
403 Ga0395901_0000041 3300038443 Bacteria 202314
404 Ga0395901_0034991 3300038443 Bacteria 5189
405 Ga0451855_0487244 3300041511 Bacteria 829
406 Ga0451853_0847209 3300041512 Bacteria 1651
407 Ga0439448_0004472 3300042005 Bacteria 3946
408 Ga0439455_0003562 3300042012 Bacteria 2991
409 Ga0439434_0062970 3300042435 Bacteria 1162
410 Ga0466966_0130252 3300044684 Bacteria 1541
411 Ga0466967_0062114 3300045976 Bacteria 3316
412 Ga0466967_0383100 3300045976 Bacteria 1366
413 Ga0466967_0559673 3300045976 Bacteria 1126
414 Ga0495638_0001674 3300046460 Bacteria 19617
415 Ga0495610_0000140 3300046512 Bacteria 80219
416 Ga0495632_0008473 3300046519 Bacteria 6305
417 Ga0495643_0000530 3300046522 Bacteria 47567
418 Ga0495643_0166806 3300046522 Bacteria 1079
419 Ga0495663_0147666 3300046525 Bacteria 801
420 Ga0495597_0136101 3300046542 Bacteria 1016
421 Ga0495597_0167267 3300046542 Bacteria 894
422 Ga0495668_0012154 3300046616 Bacteria 5117
423 Ga0495668_0029095 3300046616 Bacteria 3123
424 Ga0495668_0058792 3300046616 Bacteria 2121
425 Ga0495668_0127971 3300046616 Bacteria 1390
426 Ga0495625_0006044 3300046660 Bacteria 10871
427 Ga0495625_0017213 3300046660 Bacteria 5659
428 Ga0495625_0203808 3300046660 Bacteria 1304
429 Ga0495671_0045933 3300046692 Bacteria 2185
430 Ga0495672_0001651 3300047320 Bacteria 21680
431 Ga0495681_0048405 3300047470 Bacteria 2015
432 Ga0496100_0000293 3300048903 Bacteria 25054
433 Ga0496101_0017412 3300048904 Bacteria 4873
434 Ga0496106_0000047 3300048909 Bacteria 100449
435 Ga0496107_0000232 3300048910 Bacteria 29452
436 Ga0496112_0039446 3300048915 Bacteria 4615
437 Ga0496113_0012694 3300048916 Bacteria 5671
438 Ga0496115_0002259 3300048918 Bacteria 13788
439 Ga0496115_0168721 3300048918 Bacteria 1810
440 Ga0496116_0000193 3300048919 Bacteria 122203
441 Ga0496117_0001656 3300048920 Bacteria 31249
442 Ga0496118_0000156 3300048921 Bacteria 121630
443 Ga0496121_0048856 3300048924 Bacteria 3595
444 Ga0496122_0002269 3300048925 Bacteria 27812
445 Ga0496123_0002799 3300048926 Bacteria 20724
446 Ga0496124_0004163 3300048927 Bacteria 17070
447 Ga0496124_0031367 3300048927 Bacteria 4705
448 Ga0496125_0083807 3300048928 Bacteria 2423
449 Ga0496126_0013485 3300048929 Bacteria 8306
450 Ga0495678_117122 3300049459 Bacteria 900
451 Ga0501338_00613 3300049554 Bacteria 1674
452 Ga0501032_0000528 3300049569 Bacteria 31113
453 Ga0501033_0000301 3300049570 Bacteria 47011
454 Ga0501033_0013032 3300049570 Bacteria 6339
455 Ga0501034_0001509 3300049571 Bacteria 30551
456 Ga0501034_0021564 3300049571 Bacteria 6563
457 Ga0501034_0024553 3300049571 Bacteria 6131
458 Ga0501034_0621895 3300049571 Bacteria 984
459 Ga0501036_0051321 3300049572 Bacteria 3492
460 Ga0501037_0018202 3300049573 Bacteria 5176
461 Ga0501037_0019208 3300049573 Bacteria 5037
462 Ga0501039_0046918 3300049575 Bacteria 3338
463 Ga0501043_0021143 3300049579 Bacteria 5101
464 Ga0501047_0037679 3300049581 Bacteria 4676
465 Ga0501047_0503674 3300049581 Bacteria 1038
466 Ga0501238_000340 3300049671 Bacteria 6025
467 Ga0501238_000665 3300049671 Bacteria 3882
468 Ga0501249_062857 3300049679 Bacteria 862
469 Ga0501241_013002 3300049758 Bacteria 1511
470 Ga0501262_013084 3300049759 Bacteria 1067
471 Ga0501267_003308 3300049764 Bacteria 1466
472 Ga0501270_037767 3300049767 Bacteria 828
473 Ga0501035_0000446 3300049822 Bacteria 46153
474 Ga0501035_0152305 3300049822 Bacteria 2006
475 Ga0501044_0000534 3300049823 Bacteria 46195
476 Ga0501044_0002769 3300049823 Bacteria 19965
477 Ga0501044_0590109 3300049823 Bacteria 1005
478 nmdc:mga03683_201850_c1 3300050489 Bacteria 913
479 nmdc:mga0k408_100830_c1 3300050493 Bacteria 1702
480 nmdc:mga0k408_51868_c1 3300050493 Bacteria 2377
481 nmdc:mga06z11_90415_c1 3300050494 Bacteria 1661
482 nmdc:mga0sz30_1196_c1 3300050516 Bacteria 9315
483 Ga0500644_0002884 3300053088 Bacteria 4269
484 Ga0500556_0000688 3300053104 Bacteria 20792
485 Ga0500608_000143 3300053122 Bacteria 29514
486 Ga0500658_0001096 3300053134 Bacteria 11076
487 Ga0500622_0028226 3300053156 Bacteria 2954
488 Ga0500645_003371 3300053730 Bacteria 6535
489 Ga0500645_003613 3300053730 Bacteria 6193
490 Ga0500609_000458 3300053731 Bacteria 6075
491 Ga0500596_000936 3300053735 Bacteria 5817

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_0621895 Ga0501034_0621895_39_704 218
2 3300037312 Ga0395899_0311974 Ga0395899_0311974_123_812 219
3 3300037418 Ga0395900_0002600 Ga0395900_0002600_2747_3436 219
4 3300038443 Ga0395901_0000041 Ga0395901_0000041_180089_180778 219
5 iso_pu_bacteria 2582581280 2585154554 222
6 iso_pu_bacteria 2582581293 2585198557 222
7 iso_pu_bacteria 2643221545 2643750374 222
8 iso_pu_bacteria 2643221552 2643780317 222
9 iso_pu_bacteria 2643221584 2643932157 222
10 iso_pu_bacteria 2643221614 2644085453 222
11 iso_pu_bacteria 2643221661 2644343005 222
12 iso_pu_bacteria 2643221666 2644366305 222
13 iso_pu_bacteria 2643221691 2644507263 222
14 iso_pu_bacteria 2791355048 2792462227 222
15 iso_pu_bacteria 2818991435 2819538345 222
16 iso_pu_bacteria 2818991454 2819649405 222
17 iso_pu_bacteria 2848297114 2848298946 222
18 iso_pu_bacteria 2849573788 2849574418 222
19 iso_pu_bacteria 2851153111 2851156462 222
20 iso_pu_bacteria 2884960567 2884964057 222
21 iso_pu_bacteria 2895880812 2895886226 222
22 iso_pu_bacteria 2928531327 2928533459 222
23 iso_pu_bacteria 2928968154 2928972079 222
24 3300005842 Ga0068858_100580708 Ga0068858_1005807082 224
25 3300005844 Ga0068862_100001106 Ga0068862_10000110612 225
26 3300028380 Ga0268265_10000784 Ga0268265_1000078427 225
27 3300031824 Ga0307413_10130794 Ga0307413_101307941 225
28 3300031852 Ga0307410_10263743 Ga0307410_102637432 225
29 3300031903 Ga0307407_10056753 Ga0307407_100567532 225
30 3300031995 Ga0307409_100098254 Ga0307409_1000982542 225
31 3300032004 Ga0307414_10069268 Ga0307414_100692683 225
32 3300032005 Ga0307411_10058692 Ga0307411_100586921 225
33 3300032126 Ga0307415_100680063 Ga0307415_1006800631 225
34 3300037312 Ga0395899_0000004 Ga0395899_0000004_249264_249947 225
35 iso_pu_bacteria 2739367664 2739652392 225
36 iso_pu_bacteria 2739367865 2740030865 225
37 3300001904 JGI24736J21556_1024664 JGI24736J21556_10246641 226
38 3300001979 JGI24740J21852_10021828 JGI24740J21852_100218281 226
39 3300001979 JGI24740J21852_10026321 JGI24740J21852_100263213 226
40 3300001979 JGI24740J21852_10081356 JGI24740J21852_100813561 226
41 3300001989 JGI24739J22299_10000020 JGI24739J22299_1000002027 226
42 3300001989 JGI24739J22299_10032479 JGI24739J22299_100324793 226
43 3300001990 JGI24737J22298_10002299 JGI24737J22298_100022993 226
44 3300001990 JGI24737J22298_10007374 JGI24737J22298_100073743 226
45 3300001990 JGI24737J22298_10007815 JGI24737J22298_100078153 226
46 3300001990 JGI24737J22298_10028340 JGI24737J22298_100283403 226
47 3300002067 JGI24735J21928_10001619 JGI24735J21928_100016196 226
48 3300002067 JGI24735J21928_10001814 JGI24735J21928_100018144 226
49 3300002067 JGI24735J21928_10012552 JGI24735J21928_100125523 226
50 3300002075 JGI24738J21930_10001336 JGI24738J21930_100013363 226
51 3300002075 JGI24738J21930_10003333 JGI24738J21930_100033334 226
52 3300002075 JGI24738J21930_10020607 JGI24738J21930_100206072 226
53 3300003316 rootH1_10012575 rootH1_100125751 226
54 3300003316 rootH1_10041342 rootH1_100413422 226
55 3300003322 rootL2_10073984 rootL2_100739842 226
56 3300003762 Ga0055542_1000040 Ga0055542_1000040113 226
57 3300003763 Ga0055529_1000037 Ga0055529_1000037108 226
58 3300003771 Ga0055526_1049969 Ga0055526_10499691 226
59 3300003773 Ga0055537_1001312 Ga0055537_10013128 226
60 3300003773 Ga0055537_1002388 Ga0055537_10023885 226
61 3300003775 Ga0055524_1000199 Ga0055524_100019959 226
62 3300003775 Ga0055524_1004481 Ga0055524_10044816 226
63 3300003781 Ga0055536_1000665 Ga0055536_100066516 226
64 3300003781 Ga0055536_1000669 Ga0055536_100066916 226
65 3300003790 Ga0055528_1024521 Ga0055528_10245212 226
66 3300003791 Ga0055530_10003810 Ga0055530_100038107 226
67 3300003791 Ga0055530_10006017 Ga0055530_100060174 226
68 3300003794 Ga0055531_10000274 Ga0055531_1000027421 226
69 3300003794 Ga0055531_10007650 Ga0055531_100076504 226
70 3300003794 Ga0055531_10008986 Ga0055531_100089863 226
71 3300003794 Ga0055531_10035590 Ga0055531_100355901 226
72 3300005262 Ga0065165_1000452 Ga0065165_100045253 226
73 3300005327 Ga0070658_10001448 Ga0070658_100014487 226
74 3300005327 Ga0070658_10001594 Ga0070658_100015943 226
75 3300005327 Ga0070658_10035126 Ga0070658_100351264 226
76 3300005327 Ga0070658_10082384 Ga0070658_100823843 226
77 3300005327 Ga0070658_10104042 Ga0070658_101040422 226
78 3300005327 Ga0070658_10402806 Ga0070658_104028061 226
79 3300005335 Ga0070666_10003680 Ga0070666_100036807 226
80 3300005335 Ga0070666_10043132 Ga0070666_100431325 226
81 3300005336 Ga0070680_100015212 Ga0070680_1000152123 226
82 3300005337 Ga0070682_100529759 Ga0070682_1005297592 226
83 3300005338 Ga0068868_100193314 Ga0068868_1001933143 226
84 3300005339 Ga0070660_100002668 Ga0070660_1000026687 226
85 3300005339 Ga0070660_100017287 Ga0070660_1000172873 226
86 3300005339 Ga0070660_100030175 Ga0070660_1000301753 226
87 3300005344 Ga0070661_100005833 Ga0070661_1000058338 226
88 3300005344 Ga0070661_100017372 Ga0070661_1000173726 226
89 3300005344 Ga0070661_100023097 Ga0070661_1000230976 226
90 3300005344 Ga0070661_100024865 Ga0070661_1000248653 226
91 3300005344 Ga0070661_100657826 Ga0070661_1006578261 226
92 3300005355 Ga0070671_100031919 Ga0070671_1000319196 226
93 3300005355 Ga0070671_100042885 Ga0070671_1000428854 226
94 3300005355 Ga0070671_100242813 Ga0070671_1002428131 226
95 3300005366 Ga0070659_100001323 Ga0070659_1000013235 226
96 3300005366 Ga0070659_100084369 Ga0070659_1000843693 226
97 3300005366 Ga0070659_100293201 Ga0070659_1002932012 226
98 3300005367 Ga0070667_100016917 Ga0070667_1000169175 226
99 3300005455 Ga0070663_100004400 Ga0070663_1000044006 226
100 3300005455 Ga0070663_100069757 Ga0070663_1000697573 226
101 3300005455 Ga0070663_100104766 Ga0070663_1001047663 226
102 3300005455 Ga0070663_100294737 Ga0070663_1002947372 226
103 3300005457 Ga0070662_100007810 Ga0070662_1000078105 226
104 3300005457 Ga0070662_100027734 Ga0070662_1000277344 226
105 3300005457 Ga0070662_100240827 Ga0070662_1002408272 226
106 3300005457 Ga0070662_100261586 Ga0070662_1002615862 226
107 3300005458 Ga0070681_10044455 Ga0070681_100444554 226
108 3300005459 Ga0068867_100053956 Ga0068867_1000539563 226
109 3300005530 Ga0070679_100158069 Ga0070679_1001580693 226
110 3300005539 Ga0068853_100000413 Ga0068853_10000041330 226
111 3300005539 Ga0068853_100027433 Ga0068853_1000274337 226
112 3300005547 Ga0070693_100202157 Ga0070693_1002021572 226
113 3300005548 Ga0070665_100002091 Ga0070665_1000020913 226
114 3300005548 Ga0070665_100243409 Ga0070665_1002434091 226
115 3300005563 Ga0068855_100010205 Ga0068855_1000102059 226
116 3300005563 Ga0068855_100039453 Ga0068855_1000394532 226
117 3300005563 Ga0068855_100107503 Ga0068855_1001075035 226
118 3300005563 Ga0068855_100922965 Ga0068855_1009229651 226
119 3300005564 Ga0070664_100167815 Ga0070664_1001678153 226
120 3300005564 Ga0070664_100243469 Ga0070664_1002434691 226
121 3300005577 Ga0068857_100001206 Ga0068857_1000012065 226
122 3300005577 Ga0068857_100037123 Ga0068857_1000371232 226
123 3300005614 Ga0068856_100007329 Ga0068856_1000073299 226
124 3300005614 Ga0068856_100012003 Ga0068856_10001200313 226
125 3300005614 Ga0068856_100013223 Ga0068856_1000132238 226
126 3300005614 Ga0068856_100155097 Ga0068856_1001550973 226
127 3300005614 Ga0068856_100294488 Ga0068856_1002944882 226
128 3300005616 Ga0068852_100000368 Ga0068852_1000003685 226
129 3300005616 Ga0068852_100003523 Ga0068852_1000035235 226
130 3300005616 Ga0068852_100439871 Ga0068852_1004398711 226
131 3300005834 Ga0068851_10066236 Ga0068851_100662363 226
132 3300005841 Ga0068863_100194241 Ga0068863_1001942412 226
133 3300005842 Ga0068858_100828598 Ga0068858_1008285981 226
134 3300005937 Ga0081455_10002267 Ga0081455_100022678 226
135 3300006178 Ga0075367_10115559 Ga0075367_101155592 226
136 3300006186 Ga0075369_10001529 Ga0075369_100015297 226
137 3300006195 Ga0075366_10027861 Ga0075366_100278614 226
138 3300006195 Ga0075366_10115049 Ga0075366_101150492 226
139 3300009174 Ga0105241_10037405 Ga0105241_100374052 226
140 3300009177 Ga0105248_10041910 Ga0105248_100419102 226
141 3300009551 Ga0105238_10063479 Ga0105238_100634792 226
142 3300009551 Ga0105238_10288399 Ga0105238_102883993 226
143 3300013100 Ga0157373_10028700 Ga0157373_100287002 226
144 3300013100 Ga0157373_10111139 Ga0157373_101111391 226
145 3300013102 Ga0157371_10007636 Ga0157371_100076364 226
146 3300013102 Ga0157371_10034275 Ga0157371_100342752 226
147 3300013102 Ga0157371_10181981 Ga0157371_101819812 226
148 3300013102 Ga0157371_10210079 Ga0157371_102100792 226
149 3300013104 Ga0157370_10101193 Ga0157370_101011932 226
150 3300013105 Ga0157369_10038853 Ga0157369_100388536 226
151 3300013105 Ga0157369_10091477 Ga0157369_100914771 226
152 3300013105 Ga0157369_10125841 Ga0157369_101258414 226
153 3300013105 Ga0157369_10370888 Ga0157369_103708882 226
154 3300013105 Ga0157369_11162393 Ga0157369_111623931 226
155 3300013296 Ga0157374_10213828 Ga0157374_102138281 226
156 3300013296 Ga0157374_10901652 Ga0157374_109016521 226
157 3300013307 Ga0157372_10007103 Ga0157372_1000710310 226
158 3300013307 Ga0157372_10029840 Ga0157372_100298402 226
159 3300013307 Ga0157372_10056162 Ga0157372_100561622 226
160 3300013307 Ga0157372_10083822 Ga0157372_100838221 226
161 3300013307 Ga0157372_10238061 Ga0157372_102380612 226
162 3300014325 Ga0163163_10119589 Ga0163163_101195893 226
163 3300025254 Ga0209148_1000011 Ga0209148_10000111009 226
164 3300025263 Ga0209565_1000010 Ga0209565_1000010180 226
165 3300025263 Ga0209565_1000183 Ga0209565_100018312 226
166 3300025272 Ga0209455_1000006 Ga0209455_1000006183 226
167 3300025273 Ga0209673_1001029 Ga0209673_100102929 226
168 3300025273 Ga0209673_1003411 Ga0209673_10034112 226
169 3300025291 Ga0209675_1005636 Ga0209675_10056364 226
170 3300025292 Ga0209676_1000243 Ga0209676_1000243102 226
171 3300025292 Ga0209676_1000311 Ga0209676_100031165 226
172 3300025295 Ga0209564_1012585 Ga0209564_10125853 226
173 3300025295 Ga0209564_1027806 Ga0209564_10278062 226
174 3300025297 Ga0209758_1002141 Ga0209758_100214119 226
175 3300025297 Ga0209758_1004255 Ga0209758_100425511 226
176 3300025298 Ga0209050_1000244 Ga0209050_1000244102 226
177 3300025298 Ga0209050_1000375 Ga0209050_100037565 226
178 3300025299 Ga0209256_1000034 Ga0209256_100003436 226
179 3300025299 Ga0209256_1001520 Ga0209256_10015204 226
180 3300025299 Ga0209256_1011996 Ga0209256_10119964 226
181 3300025299 Ga0209256_1014992 Ga0209256_10149922 226
182 3300025303 Ga0209051_1000966 Ga0209051_10009662 226
183 3300025304 Ga0209257_1000140 Ga0209257_100014022 226
184 3300025304 Ga0209257_1000352 Ga0209257_100035281 226
185 3300025304 Ga0209257_1000485 Ga0209257_100048535 226
186 3300025304 Ga0209257_1007082 Ga0209257_10070828 226
187 3300025321 Ga0207656_10011531 Ga0207656_100115314 226
188 3300025903 Ga0207680_10013166 Ga0207680_100131662 226
189 3300025903 Ga0207680_10028110 Ga0207680_100281105 226
190 3300025904 Ga0207647_10000089 Ga0207647_1000008933 226
191 3300025904 Ga0207647_10139584 Ga0207647_101395841 226
192 3300025909 Ga0207705_10000664 Ga0207705_1000066429 226
193 3300025909 Ga0207705_10001737 Ga0207705_100017375 226
194 3300025909 Ga0207705_10010255 Ga0207705_100102557 226
195 3300025909 Ga0207705_10036403 Ga0207705_100364034 226
196 3300025909 Ga0207705_10176892 Ga0207705_101768922 226
197 3300025909 Ga0207705_10229146 Ga0207705_102291462 226
198 3300025917 Ga0207660_10201307 Ga0207660_102013072 226
199 3300025919 Ga0207657_10006404 Ga0207657_100064048 226
200 3300025919 Ga0207657_10008069 Ga0207657_1000806912 226
201 3300025919 Ga0207657_10010870 Ga0207657_100108706 226
202 3300025919 Ga0207657_10063260 Ga0207657_100632604 226
203 3300025920 Ga0207649_10003549 Ga0207649_100035498 226
204 3300025920 Ga0207649_10044223 Ga0207649_100442234 226
205 3300025920 Ga0207649_10051368 Ga0207649_100513683 226
206 3300025920 Ga0207649_10056054 Ga0207649_100560542 226
207 3300025921 Ga0207652_10704929 Ga0207652_107049292 226
208 3300025924 Ga0207694_10200600 Ga0207694_102006001 226
209 3300025931 Ga0207644_10027649 Ga0207644_100276492 226
210 3300025931 Ga0207644_10028583 Ga0207644_100285835 226
211 3300025931 Ga0207644_10028758 Ga0207644_100287581 226
212 3300025932 Ga0207690_10000856 Ga0207690_100008568 226
213 3300025932 Ga0207690_10001355 Ga0207690_100013554 226
214 3300025932 Ga0207690_10008364 Ga0207690_100083645 226
215 3300025933 Ga0207706_10001571 Ga0207706_100015715 226
216 3300025933 Ga0207706_10018875 Ga0207706_100188754 226
217 3300025933 Ga0207706_10107046 Ga0207706_101070463 226
218 3300025933 Ga0207706_10236668 Ga0207706_102366682 226
219 3300025941 Ga0207711_10006753 Ga0207711_100067539 226
220 3300025944 Ga0207661_10019746 Ga0207661_100197463 226
221 3300025945 Ga0207679_10005153 Ga0207679_100051538 226
222 3300025945 Ga0207679_10123032 Ga0207679_101230322 226
223 3300025945 Ga0207679_10161911 Ga0207679_101619113 226
224 3300025949 Ga0207667_10032217 Ga0207667_100322176 226
225 3300025949 Ga0207667_10122290 Ga0207667_101222904 226
226 3300025949 Ga0207667_10144506 Ga0207667_101445062 226
227 3300025949 Ga0207667_10843155 Ga0207667_108431551 226
228 3300025986 Ga0207658_10028982 Ga0207658_100289824 226
229 3300026023 Ga0207677_10250137 Ga0207677_102501373 226
230 3300026035 Ga0207703_10751267 Ga0207703_107512672 226
231 3300026041 Ga0207639_10000445 Ga0207639_1000044529 226
232 3300026041 Ga0207639_10004048 Ga0207639_100040485 226
233 3300026067 Ga0207678_10005785 Ga0207678_100057856 226
234 3300026067 Ga0207678_10030212 Ga0207678_100302123 226
235 3300026067 Ga0207678_10044600 Ga0207678_100446004 226
236 3300026067 Ga0207678_10126925 Ga0207678_101269252 226
237 3300026078 Ga0207702_10002427 Ga0207702_1000242714 226
238 3300026078 Ga0207702_10005581 Ga0207702_100055818 226
239 3300026078 Ga0207702_10009289 Ga0207702_100092896 226
240 3300026078 Ga0207702_10084403 Ga0207702_100844032 226
241 3300026078 Ga0207702_10230719 Ga0207702_102307192 226
242 3300026088 Ga0207641_10148378 Ga0207641_101483782 226
243 3300026089 Ga0207648_10103384 Ga0207648_101033842 226
244 3300026142 Ga0207698_10000614 Ga0207698_100006144 226
245 3300026142 Ga0207698_10013859 Ga0207698_100138593 226
246 3300026142 Ga0207698_10014516 Ga0207698_100145165 226
247 3300026142 Ga0207698_10019451 Ga0207698_100194515 226
248 3300026142 Ga0207698_10281456 Ga0207698_102814562 226
249 3300028379 Ga0268266_10002857 Ga0268266_100028579 226
250 3300028379 Ga0268266_10261803 Ga0268266_102618033 226
251 3300030731 Ga0316177_1033916 Ga0316177_10339162 226
252 3300031548 Ga0307408_100024214 Ga0307408_1000242145 226
253 3300031548 Ga0307408_100706150 Ga0307408_1007061501 226
254 3300031731 Ga0307405_10026351 Ga0307405_100263511 226
255 3300031731 Ga0307405_10146591 Ga0307405_101465912 226
256 3300031731 Ga0307405_10439453 Ga0307405_104394531 226
257 3300031731 Ga0307405_10634952 Ga0307405_106349521 226
258 3300031824 Ga0307413_10000169 Ga0307413_1000016921 226
259 3300031824 Ga0307413_10005818 Ga0307413_100058184 226
260 3300031824 Ga0307413_10028379 Ga0307413_100283791 226
261 3300031824 Ga0307413_10315866 Ga0307413_103158662 226
262 3300031852 Ga0307410_10082023 Ga0307410_100820231 226
263 3300031852 Ga0307410_10121351 Ga0307410_101213511 226
264 3300031852 Ga0307410_10129672 Ga0307410_101296721 226
265 3300031852 Ga0307410_10210900 Ga0307410_102109001 226
266 3300031852 Ga0307410_10325220 Ga0307410_103252202 226
267 3300031852 Ga0307410_10906534 Ga0307410_109065341 226
268 3300031901 Ga0307406_10042999 Ga0307406_100429992 226
269 3300031901 Ga0307406_10140476 Ga0307406_101404763 226
270 3300031903 Ga0307407_10005143 Ga0307407_100051432 226
271 3300031903 Ga0307407_10249542 Ga0307407_102495422 226
272 3300031911 Ga0307412_10014674 Ga0307412_100146743 226
273 3300031911 Ga0307412_10032634 Ga0307412_100326343 226
274 3300031911 Ga0307412_10039600 Ga0307412_100396003 226
275 3300031995 Ga0307409_100000287 Ga0307409_10000028719 226
276 3300031995 Ga0307409_100018502 Ga0307409_1000185023 226
277 3300031995 Ga0307409_100052776 Ga0307409_1000527763 226
278 3300031995 Ga0307409_100062773 Ga0307409_1000627732 226
279 3300031995 Ga0307409_100575914 Ga0307409_1005759142 226
280 3300032002 Ga0307416_100072139 Ga0307416_1000721395 226
281 3300032002 Ga0307416_100123357 Ga0307416_1001233572 226
282 3300032002 Ga0307416_100146647 Ga0307416_1001466472 226
283 3300032004 Ga0307414_10000136 Ga0307414_1000013630 226
284 3300032004 Ga0307414_10000612 Ga0307414_1000061217 226
285 3300032004 Ga0307414_10003224 Ga0307414_100032242 226
286 3300032004 Ga0307414_10011412 Ga0307414_100114125 226
287 3300032004 Ga0307414_10015083 Ga0307414_100150834 226
288 3300032004 Ga0307414_10031147 Ga0307414_100311471 226
289 3300032004 Ga0307414_10087175 Ga0307414_100871753 226
290 3300032004 Ga0307414_10090166 Ga0307414_100901663 226
291 3300032004 Ga0307414_10105200 Ga0307414_101052002 226
292 3300032004 Ga0307414_10258250 Ga0307414_102582502 226
293 3300032004 Ga0307414_10289585 Ga0307414_102895852 226
294 3300032004 Ga0307414_10315087 Ga0307414_103150872 226
295 3300032004 Ga0307414_10401571 Ga0307414_104015712 226
296 3300032005 Ga0307411_10032200 Ga0307411_100322003 226
297 3300032005 Ga0307411_10044775 Ga0307411_100447755 226
298 3300032005 Ga0307411_10057314 Ga0307411_100573142 226
299 3300032005 Ga0307411_10061306 Ga0307411_100613065 226
300 3300032005 Ga0307411_10113682 Ga0307411_101136822 226
301 3300032005 Ga0307411_10946145 Ga0307411_109461451 226
302 3300032126 Ga0307415_100026300 Ga0307415_1000263004 226
303 3300032126 Ga0307415_100460511 Ga0307415_1004605112 226
304 3300037312 Ga0395899_0066979 Ga0395899_0066979_446_1135 226
305 3300037471 Ga0395905_0021040 Ga0395905_0021040_4811_5500 226
306 3300037471 Ga0395905_0159554 Ga0395905_0159554_1110_1799 226
307 3300041511 Ga0451855_0487244 Ga0451855_0487244_102_791 226
308 3300041512 Ga0451853_0847209 Ga0451853_0847209_478_1167 226
309 3300042005 Ga0439448_0004472 Ga0439448_0004472_1801_2490 226
310 3300042012 Ga0439455_0003562 Ga0439455_0003562_1176_1865 226
311 3300042435 Ga0439434_0062970 Ga0439434_0062970_261_950 226
312 3300044684 Ga0466966_0130252 Ga0466966_0130252_608_1345 226
313 3300045976 Ga0466967_0062114 Ga0466967_0062114_1542_2231 226
314 3300045976 Ga0466967_0383100 Ga0466967_0383100_250_939 226
315 3300045976 Ga0466967_0559673 Ga0466967_0559673_271_960 226
316 3300046460 Ga0495638_0001674 Ga0495638_0001674_15919_16608 226
317 3300046512 Ga0495610_0000140 Ga0495610_0000140_78188_78877 226
318 3300046522 Ga0495643_0000530 Ga0495643_0000530_6970_7659 226
319 3300046522 Ga0495643_0166806 Ga0495643_0166806_116_805 226
320 3300046525 Ga0495663_0147666 Ga0495663_0147666_54_743 226
321 3300046542 Ga0495597_0136101 Ga0495597_0136101_103_792 226
322 3300046542 Ga0495597_0167267 Ga0495597_0167267_142_831 226
323 3300046616 Ga0495668_0012154 Ga0495668_0012154_2324_3013 226
324 3300046616 Ga0495668_0029095 Ga0495668_0029095_2091_2780 226
325 3300046616 Ga0495668_0127971 Ga0495668_0127971_392_1081 226
326 3300046660 Ga0495625_0006044 Ga0495625_0006044_7793_8482 226
327 3300046660 Ga0495625_0017213 Ga0495625_0017213_1893_2582 226
328 3300046660 Ga0495625_0203808 Ga0495625_0203808_459_1148 226
329 3300046692 Ga0495671_0045933 Ga0495671_0045933_1453_2142 226
330 3300047320 Ga0495672_0001651 Ga0495672_0001651_5605_6294 226
331 3300047470 Ga0495681_0048405 Ga0495681_0048405_1137_1826 226
332 3300048918 Ga0496115_0168721 Ga0496115_0168721_1100_1789 226
333 3300048927 Ga0496124_0004163 Ga0496124_0004163_13839_14528 226
334 3300048929 Ga0496126_0013485 Ga0496126_0013485_5584_6273 226
335 3300049459 Ga0495678_117122 Ga0495678_117122_82_771 226
336 3300049554 Ga0501338_00613 Ga0501338_00613_949_1638 226
337 3300049569 Ga0501032_0000528 Ga0501032_0000528_18018_18707 226
338 3300049570 Ga0501033_0000301 Ga0501033_0000301_18900_19589 226
339 3300049570 Ga0501033_0013032 Ga0501033_0013032_3922_4626 226
340 3300049571 Ga0501034_0001509 Ga0501034_0001509_17391_18080 226
341 3300049571 Ga0501034_0021564 Ga0501034_0021564_513_1202 226
342 3300049572 Ga0501036_0051321 Ga0501036_0051321_789_1478 226
343 3300049573 Ga0501037_0018202 Ga0501037_0018202_3256_3945 226
344 3300049573 Ga0501037_0019208 Ga0501037_0019208_4000_4704 226
345 3300049575 Ga0501039_0046918 Ga0501039_0046918_2176_2865 226
346 3300049579 Ga0501043_0021143 Ga0501043_0021143_3996_4685 226
347 3300049581 Ga0501047_0037679 Ga0501047_0037679_1999_2688 226
348 3300049581 Ga0501047_0503674 Ga0501047_0503674_310_999 226
349 3300049671 Ga0501238_000340 Ga0501238_000340_2280_2969 226
350 3300049671 Ga0501238_000665 Ga0501238_000665_232_921 226
351 3300049758 Ga0501241_013002 Ga0501241_013002_508_1197 226
352 3300049759 Ga0501262_013084 Ga0501262_013084_258_947 226
353 3300049764 Ga0501267_003308 Ga0501267_003308_676_1365 226
354 3300049767 Ga0501270_037767 Ga0501270_037767_24_713 226
355 3300049822 Ga0501035_0000446 Ga0501035_0000446_18913_19602 226
356 3300049822 Ga0501035_0152305 Ga0501035_0152305_366_1055 226
357 3300049823 Ga0501044_0000534 Ga0501044_0000534_18892_19581 226
358 3300049823 Ga0501044_0002769 Ga0501044_0002769_4551_5255 226
359 3300049823 Ga0501044_0590109 Ga0501044_0590109_212_901 226
360 3300050489 nmdc:mga03683_201850_c1 nmdc:mga03683_201850_c1_31_720 226
361 3300050493 nmdc:mga0k408_51868_c1 nmdc:mga0k408_51868_c1_1180_1869 226
362 3300050494 nmdc:mga06z11_90415_c1 nmdc:mga06z11_90415_c1_714_1403 226
363 3300050516 nmdc:mga0sz30_1196_c1 nmdc:mga0sz30_1196_c1_6110_6799 226
364 3300053088 Ga0500644_0002884 Ga0500644_0002884_2159_2851 226
365 3300053104 Ga0500556_0000688 Ga0500556_0000688_16930_17619 226
366 3300053134 Ga0500658_0001096 Ga0500658_0001096_3764_4453 226
367 3300053156 Ga0500622_0028226 Ga0500622_0028226_634_1326 226
368 3300053730 Ga0500645_003371 Ga0500645_003371_1320_2009 226
369 3300053730 Ga0500645_003613 Ga0500645_003613_593_1282 226
370 3300053731 Ga0500609_000458 Ga0500609_000458_2207_2896 226
371 3300003316 rootH1_10046413 rootH1_100464132 227
372 3300005262 Ga0065165_1097762 Ga0065165_10977621 227
373 3300013102 Ga0157371_10199714 Ga0157371_101997141 227
374 3300013104 Ga0157370_10104298 Ga0157370_101042983 227
375 3300015684 Ga0183365_10008 Ga0183365_1000841 227
376 3300026121 Ga0207683_10561126 Ga0207683_105611262 227
377 3300031548 Ga0307408_100038556 Ga0307408_1000385562 227
378 3300031548 Ga0307408_100120803 Ga0307408_1001208033 227
379 3300031548 Ga0307408_100218653 Ga0307408_1002186532 227
380 3300031731 Ga0307405_10025238 Ga0307405_100252382 227
381 3300031731 Ga0307405_10258902 Ga0307405_102589022 227
382 3300031731 Ga0307405_10458362 Ga0307405_104583621 227
383 3300031824 Ga0307413_10005741 Ga0307413_100057412 227
384 3300031824 Ga0307413_10019394 Ga0307413_100193943 227
385 3300031852 Ga0307410_10086948 Ga0307410_100869482 227
386 3300031901 Ga0307406_10013294 Ga0307406_100132945 227
387 3300031901 Ga0307406_10028191 Ga0307406_100281913 227
388 3300031901 Ga0307406_10384518 Ga0307406_103845182 227
389 3300031903 Ga0307407_10216079 Ga0307407_102160792 227
390 3300031911 Ga0307412_10020916 Ga0307412_100209163 227
391 3300031911 Ga0307412_10101886 Ga0307412_101018862 227
392 3300031995 Ga0307409_100016601 Ga0307409_1000166017 227
393 3300031995 Ga0307409_100017773 Ga0307409_1000177733 227
394 3300031995 Ga0307409_100172809 Ga0307409_1001728092 227
395 3300031995 Ga0307409_100281913 Ga0307409_1002819133 227
396 3300031995 Ga0307409_100659418 Ga0307409_1006594182 227
397 3300032002 Ga0307416_100014682 Ga0307416_1000146824 227
398 3300032002 Ga0307416_100178751 Ga0307416_1001787513 227
399 3300032002 Ga0307416_100417377 Ga0307416_1004173773 227
400 3300032002 Ga0307416_100923636 Ga0307416_1009236361 227
401 3300032004 Ga0307414_10035484 Ga0307414_100354843 227
402 3300032004 Ga0307414_10096987 Ga0307414_100969872 227
403 3300032004 Ga0307414_10135015 Ga0307414_101350152 227
404 3300032004 Ga0307414_10220351 Ga0307414_102203512 227
405 3300032004 Ga0307414_10276219 Ga0307414_102762192 227
406 3300032005 Ga0307411_10007126 Ga0307411_100071264 227
407 3300032005 Ga0307411_10030466 Ga0307411_100304664 227
408 3300032005 Ga0307411_10032839 Ga0307411_100328392 227
409 3300032126 Ga0307415_100010621 Ga0307415_1000106212 227
410 3300032126 Ga0307415_100490790 Ga0307415_1004907902 227
411 3300032126 Ga0307415_100582707 Ga0307415_1005827071 227
412 3300037312 Ga0395899_0042260 Ga0395899_0042260_666_1481 227
413 3300037418 Ga0395900_0099133 Ga0395900_0099133_1796_2611 227
414 3300037466 Ga0395898_0008564 Ga0395898_0008564_1418_2233 227
415 3300038443 Ga0395901_0034991 Ga0395901_0034991_761_1576 227
416 3300046519 Ga0495632_0008473 Ga0495632_0008473_842_1570 227
417 3300046616 Ga0495668_0058792 Ga0495668_0058792_564_1292 227
418 3300048915 Ga0496112_0039446 Ga0496112_0039446_3271_4086 227
419 3300048916 Ga0496113_0012694 Ga0496113_0012694_839_1654 227
420 3300048918 Ga0496115_0002259 Ga0496115_0002259_27_758 227
421 3300049571 Ga0501034_0024553 Ga0501034_0024553_28_732 227
422 3300050493 nmdc:mga0k408_100830_c1 nmdc:mga0k408_100830_c1_399_1127 227
423 3300053122 Ga0500608_000143 Ga0500608_000143_17969_18673 227
424 3300005327 Ga0070658_10389788 Ga0070658_103897881 228
425 3300013105 Ga0157369_10001977 Ga0157369_1000197716 228
426 3300025272 Ga0209455_1021089 Ga0209455_10210891 228
427 3300031548 Ga0307408_100047097 Ga0307408_1000470975 228
428 3300031731 Ga0307405_10839849 Ga0307405_108398491 228
429 3300031824 Ga0307413_10061284 Ga0307413_100612842 228
430 3300031824 Ga0307413_10082599 Ga0307413_100825991 228
431 3300031852 Ga0307410_10121926 Ga0307410_101219263 228
432 3300031852 Ga0307410_10291926 Ga0307410_102919262 228
433 3300031903 Ga0307407_10048947 Ga0307407_100489472 228
434 3300031903 Ga0307407_10149643 Ga0307407_101496432 228
435 3300031911 Ga0307412_10144568 Ga0307412_101445682 228
436 3300031995 Ga0307409_100455758 Ga0307409_1004557581 228
437 3300032002 Ga0307416_100102359 Ga0307416_1001023593 228
438 3300032004 Ga0307414_10015215 Ga0307414_100152154 228
439 3300032004 Ga0307414_10054843 Ga0307414_100548433 228
440 3300032005 Ga0307411_10065871 Ga0307411_100658713 228
441 3300032005 Ga0307411_10265682 Ga0307411_102656823 228
442 3300032126 Ga0307415_100222409 Ga0307415_1002224093 228
443 3300032126 Ga0307415_100367063 Ga0307415_1003670631 228
444 3300049679 Ga0501249_062857 Ga0501249_062857_111_797 228
445 2162886007 SwRhRL2b_contig_125707 SwRhRL2b_0206.00000100 229
446 3300001904 JGI24736J21556_1002109 JGI24736J21556_10021094 229
447 3300001979 JGI24740J21852_10000027 JGI24740J21852_1000002722 229
448 3300002067 JGI24735J21928_10000290 JGI24735J21928_1000029012 229
449 3300005289 Ga0065704_10071643 Ga0065704_1007164314 229
450 3300005339 Ga0070660_100094585 Ga0070660_1000945853 229
451 3300005344 Ga0070661_100000034 Ga0070661_1000000348 229
452 3300005539 Ga0068853_100024740 Ga0068853_1000247408 229
453 3300005539 Ga0068853_100048829 Ga0068853_1000488293 229
454 3300005548 Ga0070665_100064968 Ga0070665_1000649686 229
455 3300005563 Ga0068855_100016025 Ga0068855_10001602511 229
456 3300005563 Ga0068855_100028902 Ga0068855_1000289026 229
457 3300005577 Ga0068857_100033862 Ga0068857_1000338626 229
458 3300005578 Ga0068854_100462220 Ga0068854_1004622201 229
459 3300005614 Ga0068856_100589882 Ga0068856_1005898822 229
460 3300005616 Ga0068852_100090300 Ga0068852_1000903003 229
461 3300005618 Ga0068864_100016656 Ga0068864_1000166564 229
462 3300005834 Ga0068851_10041154 Ga0068851_100411543 229
463 3300005834 Ga0068851_10189014 Ga0068851_101890142 229
464 3300009011 Ga0105251_10000071 Ga0105251_1000007123 229
465 3300009093 Ga0105240_10038327 Ga0105240_100383275 229
466 3300009093 Ga0105240_10496560 Ga0105240_104965602 229
467 3300009174 Ga0105241_10272549 Ga0105241_102725493 229
468 3300009174 Ga0105241_10294951 Ga0105241_102949512 229
469 3300009177 Ga0105248_10028435 Ga0105248_100284355 229
470 3300009545 Ga0105237_10108970 Ga0105237_101089703 229
471 3300009545 Ga0105237_10323223 Ga0105237_103232232 229
472 3300009551 Ga0105238_10018476 Ga0105238_100184768 229
473 3300009551 Ga0105238_10083405 Ga0105238_100834053 229
474 3300010375 Ga0105239_10009809 Ga0105239_100098097 229
475 3300010375 Ga0105239_10029878 Ga0105239_100298788 229
476 3300013104 Ga0157370_10023720 Ga0157370_100237203 229
477 3300013105 Ga0157369_10304427 Ga0157369_103044273 229
478 3300013306 Ga0163162_10015972 Ga0163162_100159725 229
479 3300013307 Ga0157372_10045170 Ga0157372_100451707 229
480 3300013307 Ga0157372_10143048 Ga0157372_101430484 229
481 3300025321 Ga0207656_10072115 Ga0207656_100721152 229
482 3300025735 Ga0207713_1001241 Ga0207713_100124114 229
483 3300025904 Ga0207647_10000037 Ga0207647_1000003751 229
484 3300025911 Ga0207654_10089627 Ga0207654_100896273 229
485 3300025913 Ga0207695_10040423 Ga0207695_100404237 229
486 3300025913 Ga0207695_10105291 Ga0207695_101052915 229
487 3300025919 Ga0207657_10265549 Ga0207657_102655492 229
488 3300025920 Ga0207649_10000045 Ga0207649_100000458 229
489 3300025924 Ga0207694_10013363 Ga0207694_100133635 229
490 3300025941 Ga0207711_10092217 Ga0207711_100922173 229
491 3300025949 Ga0207667_10166080 Ga0207667_101660802 229
492 3300025981 Ga0207640_10179119 Ga0207640_101791193 229
493 3300026041 Ga0207639_10022718 Ga0207639_100227183 229
494 3300026078 Ga0207702_10055667 Ga0207702_100556674 229
495 3300026078 Ga0207702_10125030 Ga0207702_101250303 229
496 3300026095 Ga0207676_10003457 Ga0207676_100034578 229
497 3300026142 Ga0207698_10103402 Ga0207698_101034023 229
498 3300028379 Ga0268266_10380905 Ga0268266_103809051 229
499 3300031731 Ga0307405_10201370 Ga0307405_102013701 229
500 3300048903 Ga0496100_0000293 Ga0496100_0000293_2334_3023 229
501 3300048904 Ga0496101_0017412 Ga0496101_0017412_735_1424 229
502 3300048909 Ga0496106_0000047 Ga0496106_0000047_59110_59799 229
503 3300048910 Ga0496107_0000232 Ga0496107_0000232_881_1570 229
504 3300048919 Ga0496116_0000193 Ga0496116_0000193_18683_19372 229
505 3300048920 Ga0496117_0001656 Ga0496117_0001656_18597_19286 229
506 3300048921 Ga0496118_0000156 Ga0496118_0000156_19025_19714 229
507 3300048924 Ga0496121_0048856 Ga0496121_0048856_1571_2260 229
508 3300048925 Ga0496122_0002269 Ga0496122_0002269_19330_20019 229
509 3300048926 Ga0496123_0002799 Ga0496123_0002799_5223_5912 229
510 3300048927 Ga0496124_0031367 Ga0496124_0031367_3894_4583 229
511 3300048928 Ga0496125_0083807 Ga0496125_0083807_581_1270 229
512 3300053735 Ga0500596_000936 Ga0500596_000936_4594_5283 229

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01786

AOX

Alternative oxidase

47

244

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vv9-assembly1.cif.gz_A crystal structure of cyanide-insensitive alternative oxidase from trypanosoma brucei 0.8638 3 207
3vv9-assembly1.cif.gz_A crystal structure of cyanide-insensitive alternative oxidase from trypanosoma brucei 0.7757 3 207
3e2c-assembly1.cif.gz_B escherichia coli bacterioferritin mutant e128r/e135r 0.6018 16 207
3ghq-assembly1.cif.gz_A crystal structure of e. coli w35f bfr mutant 0.5856 14 207
4zl6-assembly1.cif.gz_F crystal structure of the pmftn variant e44h soaked in iron (3 h) 0.5785 25 207
ID Description Score Start End Superfamily
af_Q8WSV6_55_300_1.20.1260.140 Mainly Alpha;Up-down Bundle;Ferritin;Alternative oxidase 0.9245 6 206 1.20.1260.140
5gn9C00 Mainly Alpha;Up-down Bundle;Ferritin;Alternative oxidase 0.8949 7 207 1.20.1260.140
af_Q4DZM7_84_359_1.20.1260.140 Mainly Alpha;Up-down Bundle;Ferritin;Alternative oxidase 0.887 7 206 1.20.1260.140
af_O82766_85_332_1.20.1260.140 Mainly Alpha;Up-down Bundle;Ferritin;Alternative oxidase 0.881 7 217 1.20.1260.140
af_A0A0R0JTY5_113_314_1.20.1260.140 Mainly Alpha;Up-down Bundle;Ferritin;Alternative oxidase 0.8691 7 217 1.20.1260.140
ID Description Score Start End GO Terms
AF-A0A0B1ZU37-F1-model_v4 Oxidase 0.9928 139 221 GO:0009916
GO:0010230
GO:0016020
GO:0046872
AF-B6CGP5-F1-model_v4 Ubiquinol oxidase (EC 1.10.3.11) 0.9685 77 194 GO:0009916
GO:0016020
GO:0046872
GO:0102721
GO:0106292
AF-A0A433CWE1-F1-model_v4 Alternative oxidase (EC 1.-.-.-) 0.9427 59 207 GO:0005739
GO:0009916
GO:0010230
GO:0016020
GO:0046872
AF-A0A137SPE0-F1-model_v4 Alternative oxidase 2, mitochondrial (EC 1.-.-.-) 0.9402 95 209 GO:0009916
GO:0010230
GO:0016020
GO:0046872
AF-A0A0W0RQ69-F1-model_v4 Oxidase 0.9386 60 206 GO:0009916
GO:0010230
GO:0016020
GO:0046872

Feature Viewer

pLDDT pTM Quality
80.05 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map