F457387

General Info

Members Datasets Scaffolds Average Seq Length
512 258 1024 193

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100782220|Ga0070683_1007822201
Length 196
Sequence MKLFNAGILTLVASATLAAQQPAGPVTDPVTSVLRTRTMGLQRSLAQAFDSIPESKFSYKPTPVQLTIGYVAQHLASDNYFFCNNFGAMKATIADEDRQTPDSVKATWPKAKLVTKLKESFTFCEQAFAQLTDATIAQEYDAPGPNGTTRKAIRAGSVVGHALDMADHYSQIANYMRLNGLTPPTALPRPGRGGNH

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
173 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
174 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
175 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
176 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
177 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
178 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
180 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
181 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
182 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
183 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
184 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
185 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
186 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
188 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
189 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
190 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
191 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
195 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
196 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
197 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
198 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
199 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
200 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
201 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
202 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
203 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
204 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
205 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
206 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
207 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
208 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
209 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
210 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
211 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
212 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
213 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
214 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
215 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
216 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
217 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
218 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
219 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
220 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
221 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
222 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
223 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
224 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
225 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
226 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
227 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
228 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
229 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
230 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
231 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
232 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
233 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
234 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
235 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
236 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
237 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
238 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
239 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
240 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
241 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
242 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
243 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
244 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
245 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
246 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
247 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
248 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
249 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
250 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
251 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
252 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
253 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
254 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
255 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
256 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
257 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
258 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.24
Metatranscriptomes 1.76
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.52
Rhizosphere 95.7
Stem 0
Stem Tuber 0
Unclassified 15.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100782220 3300005329 Bacteria 914
2 JGI24738J21930_10049101 3300002075 Bacteria 859
3 Ga0058862_11805288 3300004803 Bacteria 867
4 Ga0058862_12694904 3300004803 Unclassified 711
5 Ga0065712_10082520 3300005290 Bacteria 2909
6 Ga0065712_10268144 3300005290 Bacteria 922
7 Ga0065715_10036861 3300005293 Unclassified 1304
8 Ga0065715_10267256 3300005293 Bacteria 1113
9 Ga0065707_10479966 3300005295 Bacteria 774
10 Ga0070658_10029467 3300005327 Bacteria 4409
11 Ga0070658_10570089 3300005327 Bacteria 980
12 Ga0070658_11104423 3300005327 Bacteria 690
13 Ga0070676_10013451 3300005328 Bacteria 4485
14 Ga0070676_10018961 3300005328 Bacteria 3820
15 Ga0070676_10096314 3300005328 Bacteria 1821
16 Ga0070676_10352003 3300005328 Bacteria 1013
17 Ga0070683_100004894 3300005329 Bacteria 11104
18 Ga0070683_100036844 3300005329 Bacteria 4476
19 Ga0070670_100079215 3300005331 Bacteria 2823
20 Ga0070670_100114407 3300005331 Bacteria 2326
21 Ga0068869_100289679 3300005334 Bacteria 1319
22 Ga0070666_10315806 3300005335 Bacteria 1114
23 Ga0070666_10324813 3300005335 Bacteria 1098
24 Ga0070680_100005062 3300005336 Bacteria 9945
25 Ga0070680_100011293 3300005336 Bacteria 6908
26 Ga0070680_100036784 3300005336 Unclassified 3955
27 Ga0070680_100038440 3300005336 Bacteria 3870
28 Ga0070680_100074181 3300005336 Bacteria 2799
29 Ga0070682_100003383 3300005337 Bacteria 8847
30 Ga0070682_100057701 3300005337 Bacteria 2447
31 Ga0070682_100324248 3300005337 Bacteria 1139
32 Ga0068868_100005089 3300005338 Bacteria 9227
33 Ga0068868_100027433 3300005338 Bacteria 4345
34 Ga0068868_100196024 3300005338 Unclassified 1682
35 Ga0070660_100045023 3300005339 Bacteria 3376
36 Ga0070660_100211400 3300005339 Bacteria 1575
37 Ga0070660_100259370 3300005339 Bacteria 1419
38 Ga0070660_100272927 3300005339 Bacteria 1382
39 Ga0070689_100043164 3300005340 Bacteria 3464
40 Ga0070689_100105508 3300005340 Bacteria 2235
41 Ga0070687_100006169 3300005343 Bacteria 4897
42 Ga0070687_100098617 3300005343 Bacteria 1631
43 Ga0070661_100030034 3300005344 Bacteria 3924
44 Ga0070661_100084200 3300005344 Unclassified 2349
45 Ga0070661_100142401 3300005344 Bacteria 1808
46 Ga0070661_100795277 3300005344 Bacteria 776
47 Ga0070692_10017855 3300005345 Bacteria 3400
48 Ga0070692_10035857 3300005345 Bacteria 2514
49 Ga0070692_10049339 3300005345 Bacteria 2183
50 Ga0070668_100013091 3300005347 Bacteria 6181
51 Ga0070668_100249756 3300005347 Bacteria 1472
52 Ga0070669_100032610 3300005353 Bacteria 3763
53 Ga0070669_100049393 3300005353 Bacteria 3071
54 Ga0070669_100201592 3300005353 Bacteria 1566
55 Ga0070675_100050349 3300005354 Bacteria 3420
56 Ga0070675_100315247 3300005354 Bacteria 1381
57 Ga0070671_100081385 3300005355 Bacteria 2707
58 Ga0070671_100101378 3300005355 Bacteria 2415
59 Ga0070674_100348415 3300005356 Bacteria 1195
60 Ga0070673_100033125 3300005364 Bacteria 3897
61 Ga0070673_100069757 3300005364 Unclassified 2818
62 Ga0070673_100502563 3300005364 Bacteria 1097
63 Ga0070688_100025578 3300005365 Bacteria 3496
64 Ga0070659_100144920 3300005366 Bacteria 1935
65 Ga0070659_100460202 3300005366 Bacteria 1080
66 Ga0070659_100586017 3300005366 Unclassified 957
67 Ga0070667_100187944 3300005367 Bacteria 1829
68 Ga0070667_100194902 3300005367 Bacteria 1796
69 Ga0070667_100425216 3300005367 Bacteria 1211
70 Ga0070709_10006509 3300005434 Bacteria 6368
71 Ga0070714_100077074 3300005435 Unclassified 2895
72 Ga0070713_100032495 3300005436 Bacteria 4169
73 Ga0070710_10559152 3300005437 Unclassified 791
74 Ga0070711_100207623 3300005439 Bacteria 1515
75 Ga0070711_100378539 3300005439 Bacteria 1144
76 Ga0070705_100351048 3300005440 Unclassified 1075
77 Ga0070694_100094129 3300005444 Bacteria 2107
78 Ga0070708_100301520 3300005445 Unclassified 1509
79 Ga0070678_100635280 3300005456 Bacteria 956
80 Ga0070662_100002509 3300005457 Bacteria 11314
81 Ga0070662_100086328 3300005457 Unclassified 2347
82 Ga0070662_100336090 3300005457 Bacteria 1235
83 Ga0070681_10005288 3300005458 Bacteria 12466
84 Ga0070681_10032261 3300005458 Bacteria 5256
85 Ga0070681_10040065 3300005458 Bacteria 4697
86 Ga0070681_10320002 3300005458 Unclassified 1461
87 Ga0070681_10649531 3300005458 Bacteria 970
88 Ga0070681_11094989 3300005458 Bacteria 717
89 Ga0068867_100498000 3300005459 Unclassified 1047
90 Ga0070685_10024292 3300005466 Bacteria 3327
91 Ga0070707_100889884 3300005468 Bacteria 855
92 Ga0070698_100089054 3300005471 Bacteria 3070
93 Ga0070679_100000849 3300005530 Bacteria 26631
94 Ga0070679_100000924 3300005530 Bacteria 25545
95 Ga0070679_100119720 3300005530 Bacteria 2618
96 Ga0070679_100186032 3300005530 Bacteria 2047
97 Ga0070679_100572111 3300005530 Bacteria 1073
98 Ga0070684_100014515 3300005535 Bacteria 6384
99 Ga0070684_100031372 3300005535 Bacteria 4523
100 Ga0070684_100080391 3300005535 Bacteria 2883
101 Ga0070684_100192763 3300005535 Bacteria 1855
102 Ga0070684_101631132 3300005535 Unclassified 608
103 Ga0068853_100035957 3300005539 Bacteria 4209
104 Ga0068853_100084429 3300005539 Unclassified 2782
105 Ga0068853_100392645 3300005539 Bacteria 1297
106 Ga0070672_100022251 3300005543 Bacteria 4652
107 Ga0070672_100083250 3300005543 Unclassified 2567
108 Ga0070672_100152005 3300005543 Bacteria 1915
109 Ga0070672_100189514 3300005543 Bacteria 1716
110 Ga0070672_100304510 3300005543 Bacteria 1352
111 Ga0070695_100038304 3300005545 Bacteria 3025
112 Ga0070695_100477381 3300005545 Unclassified 960
113 Ga0070693_100143332 3300005547 Bacteria 1506
114 Ga0070693_100336666 3300005547 Bacteria 1029
115 Ga0068855_100029834 3300005563 Bacteria 6521
116 Ga0068855_100080434 3300005563 Bacteria 3778
117 Ga0068855_100527857 3300005563 Bacteria 1280
118 Ga0068855_100668142 3300005563 Bacteria 1114
119 Ga0068855_101198345 3300005563 Unclassified 790
120 Ga0070664_100019957 3300005564 Bacteria 5518
121 Ga0070664_100021751 3300005564 Bacteria 5289
122 Ga0070664_100040541 3300005564 Bacteria 3926
123 Ga0070664_100091212 3300005564 Bacteria 2638
124 Ga0070664_100718733 3300005564 Bacteria 931
125 Ga0070664_100722842 3300005564 Unclassified 929
126 Ga0068857_100062866 3300005577 Bacteria 3300
127 Ga0068857_100087308 3300005577 Bacteria 2790
128 Ga0068857_100608802 3300005577 Bacteria 1033
129 Ga0068857_101004581 3300005577 Bacteria 803
130 Ga0068854_100984065 3300005578 Bacteria 746
131 Ga0068856_100117120 3300005614 Bacteria 2665
132 Ga0068856_100253135 3300005614 Bacteria 1776
133 Ga0068856_100331828 3300005614 Bacteria 1538
134 Ga0068856_100373527 3300005614 Bacteria 1445
135 Ga0068856_101010910 3300005614 Bacteria 850
136 Ga0070702_100224073 3300005615 Bacteria 1259
137 Ga0068852_100078029 3300005616 Bacteria 2929
138 Ga0068852_100307941 3300005616 Bacteria 1535
139 Ga0068859_100056418 3300005617 Bacteria 3953
140 Ga0068864_100094531 3300005618 Unclassified 2642
141 Ga0068864_100521946 3300005618 Unclassified 1145
142 Ga0068864_101181975 3300005618 Bacteria 763
143 Ga0068861_100005314 3300005719 Bacteria 8694
144 Ga0068851_10036170 3300005834 Bacteria 2472
145 Ga0068851_10169288 3300005834 Unclassified 1205
146 Ga0068870_10121928 3300005840 Bacteria 1503
147 Ga0068863_100717219 3300005841 Bacteria 994
148 Ga0068858_100220520 3300005842 Bacteria 1796
149 Ga0068860_100095776 3300005843 Bacteria 2829
150 Ga0068860_101015362 3300005843 Bacteria 848
151 Ga0068862_100996261 3300005844 Bacteria 828
152 Ga0070717_10209377 3300006028 Bacteria 1711
153 Ga0070716_100163792 3300006173 Unclassified 1444
154 Ga0070712_100071417 3300006175 Bacteria 2484
155 Ga0070712_100764066 3300006175 Unclassified 828
156 Ga0075428_100344926 3300006844 Bacteria 1599
157 Ga0075430_100229952 3300006846 Bacteria 1538
158 Ga0075430_100525167 3300006846 Unclassified 976
159 Ga0075431_100284515 3300006847 Bacteria 1674
160 Ga0075431_100514863 3300006847 Bacteria 1186
161 Ga0075433_10051219 3300006852 Unclassified 3595
162 Ga0075433_10070216 3300006852 Bacteria 3078
163 Ga0075434_100035242 3300006871 Unclassified 4946
164 Ga0075434_100048997 3300006871 Bacteria 4192
165 Ga0075434_100069542 3300006871 Unclassified 3510
166 Ga0075434_100867223 3300006871 Bacteria 918
167 Ga0075436_100020475 3300006914 Unclassified 4541
168 Ga0075436_100172277 3300006914 Bacteria 1528
169 Ga0097620_100056418 3300006931 Bacteria 3953
170 Ga0075435_100657327 3300007076 Bacteria 910
171 Ga0099795_10180048 3300007788 Bacteria 882
172 Ga0105240_10056502 3300009093 Bacteria 4910
173 Ga0105240_10101594 3300009093 Bacteria 3497
174 Ga0105240_10159342 3300009093 Unclassified 2682
175 Ga0105240_10350905 3300009093 Bacteria 1674
176 Ga0111539_10504138 3300009094 Bacteria 1410
177 Ga0105245_10062655 3300009098 Bacteria 3356
178 Ga0105245_10117124 3300009098 Bacteria 2485
179 Ga0105245_10164620 3300009098 Bacteria 2107
180 Ga0105245_10383652 3300009098 Bacteria 1400
181 Ga0114129_10359743 3300009147 Bacteria 1926
182 Ga0114129_10449822 3300009147 Unclassified 1689
183 Ga0114129_10901481 3300009147 Bacteria 1120
184 Ga0105243_10026465 3300009148 Unclassified 4440
185 Ga0105241_10098166 3300009174 Bacteria 2324
186 Ga0105241_10259069 3300009174 Bacteria 1478
187 Ga0105241_11636277 3300009174 Bacteria 624
188 Ga0105248_10143691 3300009177 Bacteria 2692
189 Ga0105248_10214836 3300009177 Bacteria 2166
190 Ga0105248_10232280 3300009177 Bacteria 2076
191 Ga0105248_10800766 3300009177 Bacteria 1064
192 Ga0105237_10257022 3300009545 Bacteria 1749
193 Ga0105238_10180217 3300009551 Bacteria 2089
194 Ga0105249_10022811 3300009553 Bacteria 5611
195 Ga0099796_10011988 3300010159 Bacteria 2434
196 Ga0105246_10073753 3300011119 Bacteria 2410
197 Ga0157373_10031285 3300013100 Bacteria 3831
198 Ga0157373_10173711 3300013100 Bacteria 1516
199 Ga0157371_10053156 3300013102 Bacteria 2876
200 Ga0157371_10190631 3300013102 Bacteria 1468
201 Ga0157371_10970206 3300013102 Bacteria 647
202 Ga0157370_10058146 3300013104 Bacteria 3675
203 Ga0157370_10154523 3300013104 Bacteria 2135
204 Ga0157370_10380534 3300013104 Bacteria 1300
205 Ga0157370_11055963 3300013104 Archaea 734
206 Ga0157369_10121268 3300013105 Bacteria 2774
207 Ga0157369_10438145 3300013105 Bacteria 1354
208 Ga0157369_10588454 3300013105 Bacteria 1149
209 Ga0157369_10647769 3300013105 Bacteria 1089
210 Ga0157374_10240675 3300013296 Bacteria 1779
211 Ga0157374_10737990 3300013296 Bacteria 999
212 Ga0157378_10696978 3300013297 Bacteria 1035
213 Ga0163162_10161625 3300013306 Bacteria 2361
214 Ga0163162_10170061 3300013306 Bacteria 2304
215 Ga0163162_10358685 3300013306 Bacteria 1591
216 Ga0163162_11003775 3300013306 Unclassified 944
217 Ga0157372_10017597 3300013307 Bacteria 7671
218 Ga0157372_10029542 3300013307 Bacteria 5987
219 Ga0157372_10060717 3300013307 Bacteria 4230
220 Ga0157372_10076520 3300013307 Bacteria 3779
221 Ga0157372_10096729 3300013307 Unclassified 3365
222 Ga0157372_10162572 3300013307 Bacteria 2581
223 Ga0157372_10239713 3300013307 Bacteria 2104
224 Ga0157375_10042309 3300013308 Bacteria 4409
225 Ga0157375_10178631 3300013308 Bacteria 2274
226 Ga0157375_10180000 3300013308 Bacteria 2265
227 Ga0157375_10254361 3300013308 Bacteria 1918
228 Ga0157380_10025942 3300014326 Bacteria 4447
229 Ga0182008_10366921 3300014497 Unclassified 767
230 Ga0157377_10159001 3300014745 Unclassified 1403
231 Ga0157377_10522350 3300014745 Bacteria 833
232 Ga0157376_10008238 3300014969 Bacteria 7507
233 Ga0163161_10096416 3300017792 Bacteria 2195
234 Ga0163161_10613722 3300017792 Unclassified 898
235 Ga0197907_10968816 3300020069 Bacteria 1569
236 Ga0206356_10083565 3300020070 Bacteria 885
237 Ga0206356_11886982 3300020070 Bacteria 1651
238 Ga0206352_10162365 3300020078 Bacteria 645
239 Ga0206354_10517450 3300020081 Bacteria 1920
240 Ga0206353_10466252 3300020082 Bacteria 2290
241 Ga0207697_10043215 3300025315 Bacteria 1853
242 Ga0207692_10252625 3300025898 Unclassified 1057
243 Ga0207688_10217434 3300025901 Bacteria 1150
244 Ga0207699_10076104 3300025906 Unclassified 2066
245 Ga0207699_10816253 3300025906 Unclassified 686
246 Ga0207645_10007222 3300025907 Bacteria 7869
247 Ga0207645_10044550 3300025907 Bacteria 2839
248 Ga0207645_10102342 3300025907 Bacteria 1849
249 Ga0207645_10216589 3300025907 Bacteria 1262
250 Ga0207643_10025311 3300025908 Bacteria 3280
251 Ga0207705_10055378 3300025909 Bacteria 2859
252 Ga0207705_10232127 3300025909 Bacteria 1404
253 Ga0207705_10714137 3300025909 Bacteria 779
254 Ga0207684_10356627 3300025910 Bacteria 1258
255 Ga0207654_10085251 3300025911 Bacteria 1912
256 Ga0207707_10022800 3300025912 Bacteria 5474
257 Ga0207707_10151622 3300025912 Bacteria 2026
258 Ga0207707_10283200 3300025912 Bacteria 1435
259 Ga0207695_10019729 3300025913 Bacteria 7751
260 Ga0207695_10126688 3300025913 Unclassified 2515
261 Ga0207695_10145292 3300025913 Bacteria 2317
262 Ga0207695_10273352 3300025913 Bacteria 1585
263 Ga0207695_10672137 3300025913 Bacteria 916
264 Ga0207671_10224073 3300025914 Bacteria 1474
265 Ga0207693_10011220 3300025915 Bacteria 7253
266 Ga0207693_10071008 3300025915 Bacteria 2725
267 Ga0207663_10146289 3300025916 Unclassified 1652
268 Ga0207663_10489664 3300025916 Unclassified 954
269 Ga0207663_10871220 3300025916 Bacteria 719
270 Ga0207660_10002771 3300025917 Bacteria 11494
271 Ga0207660_10031219 3300025917 Bacteria 3666
272 Ga0207660_10060889 3300025917 Bacteria 2716
273 Ga0207660_10273196 3300025917 Bacteria 1339
274 Ga0207662_10023518 3300025918 Bacteria 3541
275 Ga0207662_10032357 3300025918 Bacteria 3044
276 Ga0207662_10301622 3300025918 Bacteria 1065
277 Ga0207657_10054896 3300025919 Bacteria 3443
278 Ga0207657_10061141 3300025919 Unclassified 3231
279 Ga0207657_10242990 3300025919 Bacteria 1437
280 Ga0207657_10256271 3300025919 Bacteria 1393
281 Ga0207657_10332439 3300025919 Bacteria 1200
282 Ga0207649_10041800 3300025920 Bacteria 2792
283 Ga0207649_10313681 3300025920 Bacteria 1150
284 Ga0207652_10011216 3300025921 Bacteria 7220
285 Ga0207652_10054085 3300025921 Bacteria 3450
286 Ga0207652_10137898 3300025921 Bacteria 2179
287 Ga0207652_10214996 3300025921 Bacteria 1731
288 Ga0207652_11002099 3300025921 Unclassified 734
289 Ga0207681_10031980 3300025923 Bacteria 3441
290 Ga0207681_10135136 3300025923 Bacteria 1829
291 Ga0207681_10154809 3300025923 Bacteria 1721
292 Ga0207694_10128891 3300025924 Bacteria 2026
293 Ga0207694_10381559 3300025924 Bacteria 1170
294 Ga0207650_10042556 3300025925 Bacteria 3332
295 Ga0207650_10185492 3300025925 Bacteria 1659
296 Ga0207659_10099101 3300025926 Bacteria 2193
297 Ga0207659_10361695 3300025926 Bacteria 1206
298 Ga0207659_10392887 3300025926 Bacteria 1159
299 Ga0207687_10057665 3300025927 Bacteria 2729
300 Ga0207687_10060296 3300025927 Bacteria 2676
301 Ga0207687_10417418 3300025927 Bacteria 1107
302 Ga0207687_10440610 3300025927 Bacteria 1079
303 Ga0207664_10283334 3300025929 Bacteria 1454
304 Ga0207664_11086550 3300025929 Unclassified 715
305 Ga0207644_10095279 3300025931 Bacteria 2226
306 Ga0207690_10113476 3300025932 Bacteria 1956
307 Ga0207690_10182906 3300025932 Bacteria 1580
308 Ga0207690_10851576 3300025932 Bacteria 755
309 Ga0207706_10002334 3300025933 Bacteria 18527
310 Ga0207706_10114619 3300025933 Bacteria 2371
311 Ga0207706_10491252 3300025933 Bacteria 1060
312 Ga0207706_11018142 3300025933 Bacteria 695
313 Ga0207670_10188666 3300025936 Bacteria 1558
314 Ga0207670_10531866 3300025936 Bacteria 958
315 Ga0207669_10182185 3300025937 Bacteria 1507
316 Ga0207665_10410272 3300025939 Unclassified 1033
317 Ga0207691_10001754 3300025940 Bacteria 21343
318 Ga0207691_10005499 3300025940 Bacteria 12242
319 Ga0207691_10012606 3300025940 Bacteria 8103
320 Ga0207691_10055364 3300025940 Bacteria 3615
321 Ga0207691_10227133 3300025940 Bacteria 1617
322 Ga0207691_10344744 3300025940 Bacteria 1275
323 Ga0207711_10352965 3300025941 Bacteria 1362
324 Ga0207711_10370371 3300025941 Bacteria 1328
325 Ga0207689_10048725 3300025942 Bacteria 3495
326 Ga0207689_10486754 3300025942 Bacteria 1033
327 Ga0207661_10020932 3300025944 Bacteria 4897
328 Ga0207661_10100709 3300025944 Bacteria 2425
329 Ga0207661_10269461 3300025944 Unclassified 1519
330 Ga0207661_10741019 3300025944 Bacteria 904
331 Ga0207661_11038191 3300025944 Bacteria 755
332 Ga0207679_10074035 3300025945 Bacteria 2579
333 Ga0207679_10112605 3300025945 Bacteria 2151
334 Ga0207679_10194920 3300025945 Bacteria 1688
335 Ga0207679_10298293 3300025945 Bacteria 1388
336 Ga0207679_10689460 3300025945 Bacteria 926
337 Ga0207667_10038844 3300025949 Bacteria 5077
338 Ga0207667_10145634 3300025949 Bacteria 2438
339 Ga0207667_10629179 3300025949 Bacteria 1080
340 Ga0207651_10050263 3300025960 Bacteria 2830
341 Ga0207651_10153150 3300025960 Bacteria 1797
342 Ga0207712_10006045 3300025961 Bacteria 7638
343 Ga0207668_10395316 3300025972 Bacteria 1167
344 Ga0207640_10728769 3300025981 Bacteria 853
345 Ga0207658_10269495 3300025986 Bacteria 1455
346 Ga0207677_10055138 3300026023 Bacteria 2716
347 Ga0207677_10065974 3300026023 Bacteria 2528
348 Ga0207639_10053584 3300026041 Bacteria 3079
349 Ga0207639_10169776 3300026041 Bacteria 1846
350 Ga0207639_10214133 3300026041 Bacteria 1660
351 Ga0207708_10549375 3300026075 Bacteria 974
352 Ga0207702_10736399 3300026078 Bacteria 973
353 Ga0207641_10061867 3300026088 Bacteria 3193
354 Ga0207676_10212088 3300026095 Bacteria 1719
355 Ga0207676_10434874 3300026095 Bacteria 1234
356 Ga0207674_10023368 3300026116 Bacteria 6624
357 Ga0207674_10051404 3300026116 Bacteria 4206
358 Ga0207674_10630069 3300026116 Bacteria 1035
359 Ga0207675_100001703 3300026118 Bacteria 22024
360 Ga0207683_10463014 3300026121 Bacteria 1169
361 Ga0207698_10735811 3300026142 Bacteria 984
362 Ga0207698_10903693 3300026142 Bacteria 890
363 Ga0209968_1004560 3300027526 Bacteria 2078
364 Ga0268265_10573486 3300028380 Bacteria 1074
365 Ga0268264_11191058 3300028381 Bacteria 771
366 Ga0307408_100073577 3300031548 Bacteria 2533
367 Ga0265314_10016377 3300031711 Bacteria 5856
368 Ga0307406_10001255 3300031901 Bacteria 14229
369 Ga0307412_10587763 3300031911 Bacteria 941
370 Ga0307409_100147018 3300031995 Bacteria 2039
371 Ga0307416_100216842 3300032002 Bacteria 1831
372 Ga0307416_101049236 3300032002 Bacteria 919
373 Ga0307411_10094709 3300032005 Bacteria 2094
374 Ga0307415_100357788 3300032126 Bacteria 1231
375 Ga0307510_10019078 3300033180 Bacteria 8045
376 Ga0373959_0009442 3300034820 Bacteria 1683
377 Ga0373926_0033646 3300035083 Bacteria 1813
378 Ga0373934_0058851 3300035086 Unclassified 1529
379 Ga0373940_0007645 3300035088 Unclassified 2446
380 Ga0373949_0069155 3300035090 Bacteria 922
381 Ga0373923_0429536 3300035111 Bacteria 639
382 Ga0373941_0019304 3300035115 Bacteria 1896
383 Ga0373956_0137045 3300035119 Bacteria 1148
384 Ga0373943_0030607 3300035170 Bacteria 2549
385 Ga0373943_0117154 3300035170 Bacteria 1412
386 Ga0373943_0317142 3300035170 Unclassified 888
387 Ga0373946_0089470 3300035171 Bacteria 1362
388 Ga0373955_0127860 3300035172 Bacteria 1481
389 Ga0373942_0023901 3300035207 Bacteria 1564
390 Ga0373931_0731350 3300035691 Unclassified 655
391 Ga0373935_0198299 3300035692 Bacteria 1386
392 Ga0373927_0031000 3300035695 Bacteria 3487
393 Ga0373927_0171340 3300035695 Unclassified 1423
394 Ga0373933_0126375 3300035724 Bacteria 1605
395 Ga0373947_0137547 3300035725 Bacteria 1564
396 Ga0373947_0144959 3300035725 Bacteria 1526
397 Ga0373937_0001376 3300036401 Bacteria 20333
398 Ga0373937_0186224 3300036401 Unclassified 1950
399 Ga0373937_0508202 3300036401 Bacteria 1145
400 Ga0373937_0626897 3300036401 Bacteria 1020
401 Ga0265778_021477 3300036457 Unclassified 800
402 Ga0373925_0241049 3300037068 Bacteria 1448
403 Ga0395900_1149221 3300037418 Bacteria 693
404 Ga0395905_0772811 3300037471 Bacteria 863
405 Ga0436364_1402506 3300037853 Bacteria 8849
406 Ga0451800_0471053 3300041459 Bacteria 651
407 Ga0451839_1501793 3300041496 Bacteria 643
408 Ga0451853_1055004 3300041512 Bacteria 1498
409 Ga0466963_0063909 3300044694 Bacteria 2465
410 Ga0466963_0589576 3300044694 Bacteria 785
411 Ga0466964_0280107 3300044706 Bacteria 833
412 Ga0451576_0144476 3300045051 Bacteria 2481
413 Ga0451576_1850476 3300045051 Unclassified 623
414 Ga0466967_0148716 3300045976 Unclassified 2187
415 Ga0466967_0259246 3300045976 Bacteria 1663
416 Ga0495651_0045312 3300046462 Bacteria 3408
417 Ga0495651_0449998 3300046462 Bacteria 832
418 Ga0495580_0015003 3300046472 Bacteria 5864
419 Ga0495580_0514303 3300046472 Bacteria 798
420 Ga0495582_0012115 3300046473 Bacteria 4751
421 Ga0495639_0138127 3300046475 Bacteria 1170
422 Ga0495594_0009314 3300046499 Bacteria 5072
423 Ga0495594_0041807 3300046499 Unclassified 2509
424 Ga0495596_0066125 3300046500 Bacteria 1406
425 Ga0495608_0062296 3300046511 Bacteria 2451
426 Ga0495628_0052025 3300046516 Bacteria 3236
427 Ga0495628_0180235 3300046516 Bacteria 1598
428 Ga0495628_0187839 3300046516 Unclassified 1561
429 Ga0495630_0107846 3300046517 Bacteria 2109
430 Ga0495630_0264696 3300046517 Bacteria 1313
431 Ga0495663_0183186 3300046525 Bacteria 726
432 Ga0495663_0196147 3300046525 Bacteria 703
433 Ga0495666_0136011 3300046526 Bacteria 1147
434 Ga0495652_0200316 3300046529 Bacteria 1515
435 Ga0495652_0263037 3300046529 Bacteria 1272
436 Ga0495665_0339284 3300046531 Bacteria 766
437 Ga0495640_0074598 3300046533 Bacteria 2268
438 Ga0495640_0142709 3300046533 Bacteria 1543
439 Ga0495586_0226453 3300046535 Unclassified 1063
440 Ga0495587_0011026 3300046536 Bacteria 5732
441 Ga0495587_0406451 3300046536 Bacteria 756
442 Ga0495621_0085958 3300046539 Bacteria 1179
443 Ga0495645_0011746 3300046543 Bacteria 6167
444 Ga0495667_0000491 3300046559 Bacteria 25240
445 Ga0495667_0012032 3300046559 Bacteria 5861
446 Ga0495667_0183443 3300046559 Bacteria 1342
447 Ga0495634_0070647 3300046642 Bacteria 2301
448 Ga0495635_0067640 3300046663 Bacteria 2450
449 Ga0495635_0175277 3300046663 Bacteria 1458
450 Ga0495657_0131823 3300046675 Bacteria 1565
451 Ga0495599_0099647 3300046678 Bacteria 1811
452 Ga0495599_0380021 3300046678 Unclassified 843
453 Ga0495623_0001665 3300046679 Bacteria 14953
454 Ga0495623_0002061 3300046679 Bacteria 13495
455 Ga0495646_0122807 3300046680 Bacteria 1468
456 Ga0495658_0302735 3300046683 Bacteria 1011
457 Ga0495658_0380929 3300046683 Unclassified 898
458 Ga0495658_0420291 3300046683 Unclassified 853
459 Ga0495624_0180700 3300046690 Unclassified 1286
460 Ga0495600_0043260 3300046809 Bacteria 2937
461 Ga0495581_0035842 3300047315 Bacteria 2870
462 Ga0495581_0044324 3300047315 Bacteria 2572
463 Ga0495581_0435381 3300047315 Bacteria 764
464 Ga0495674_0039794 3300047319 Bacteria 4211
465 Ga0495674_0903287 3300047319 Bacteria 682
466 Ga0495680_0088533 3300047322 Unclassified 2326
467 Ga0495680_0490500 3300047322 Unclassified 835
468 Ga0495675_0007858 3300047444 Bacteria 6590
469 Ga0495675_0073533 3300047444 Bacteria 2156
470 Ga0495675_0408640 3300047444 Bacteria 790
471 Ga0495685_027511 3300047447 Bacteria 1956
472 Ga0495684_0007214 3300047471 Bacteria 8628
473 Ga0495684_0076980 3300047471 Unclassified 2533
474 Ga0495593_0105397 3300047673 Bacteria 1443
475 Ga0495602_0105733 3300048088 Bacteria 2299
476 Ga0495602_0139258 3300048088 Bacteria 1923
477 Ga0495615_0013723 3300048090 Bacteria 1698
478 Ga0496104_0007032 3300048907 Bacteria 9923
479 Ga0496104_0075664 3300048907 Bacteria 3206
480 Ga0496104_0418364 3300048907 Bacteria 1252
481 Ga0496105_0113393 3300048908 Bacteria 2237
482 Ga0496105_0270248 3300048908 Unclassified 1373
483 Ga0496108_0012356 3300048911 Bacteria 6948
484 Ga0496108_0020167 3300048911 Bacteria 5479
485 Ga0496109_0001037 3300048912 Bacteria 22996
486 Ga0496110_0016385 3300048913 Bacteria 6188
487 Ga0496110_0546863 3300048913 Bacteria 1052
488 Ga0496111_0060108 3300048914 Bacteria 2754
489 Ga0496111_0166469 3300048914 Bacteria 1637
490 Ga0496112_0000129 3300048915 Bacteria 47173
491 Ga0496112_0602443 3300048915 Unclassified 1030
492 Ga0496113_0000062 3300048916 Bacteria 46801
493 Ga0496113_0019996 3300048916 Bacteria 4697
494 Ga0496114_0710435 3300048917 Bacteria 881
495 Ga0501233_148257 3300049668 Bacteria 653
496 Ga0501259_117018 3300049688 Bacteria 630
497 nmdc:mga05p37_765358_c1 3300050507 Bacteria 1062
498 nmdc:mga0qj67_14306_c1 3300050509 Bacteria 5997
499 nmdc:mga0qj67_308841_c1 3300050509 Bacteria 1281
500 nmdc:mga0qj67_419901_c1 3300050509 Unclassified 1078
501 nmdc:mga06r32_466744_c1 3300050510 Bacteria 1241
502 nmdc:mga06r32_774190_c1 3300050510 Unclassified 921
503 nmdc:mga06r32_811228_c1 3300050510 Unclassified 896
504 nmdc:mga0n895_285393_c1 3300050512 Bacteria 1674
505 nmdc:mga0n895_78054_c1 3300050512 Unclassified 3295
506 nmdc:mga08x19_161116_c1 3300050514 Bacteria 1524
507 nmdc:mga08x19_397546_c1 3300050514 Unclassified 966
508 nmdc:mga0a205_111590_c1 3300050515 Bacteria 2633
509 nmdc:mga0a205_548652_c1 3300050515 Unclassified 1011
510 nmdc:mga0a205_99831_c1 3300050515 Unclassified 2801
511 Ga0495601_0052619 3300053077 Bacteria 2572
512 Ga0495619_0229479 3300053085 Bacteria 1286
513 Ga0070683_100782220
514 JGI24738J21930_10049101
515 Ga0058862_11805288
516 Ga0058862_12694904
517 Ga0065712_10082520
518 Ga0065712_10268144
519 Ga0065715_10036861
520 Ga0065715_10267256
521 Ga0065707_10479966
522 Ga0070658_10029467
523 Ga0070658_10570089
524 Ga0070658_11104423
525 Ga0070676_10013451
526 Ga0070676_10018961
527 Ga0070676_10096314
528 Ga0070676_10352003
529 Ga0070683_100004894
530 Ga0070683_100036844
531 Ga0070670_100079215
532 Ga0070670_100114407
533 Ga0068869_100289679
534 Ga0070666_10315806
535 Ga0070666_10324813
536 Ga0070680_100005062
537 Ga0070680_100011293
538 Ga0070680_100036784
539 Ga0070680_100038440
540 Ga0070680_100074181
541 Ga0070682_100003383
542 Ga0070682_100057701
543 Ga0070682_100324248
544 Ga0068868_100005089
545 Ga0068868_100027433
546 Ga0068868_100196024
547 Ga0070660_100045023
548 Ga0070660_100211400
549 Ga0070660_100259370
550 Ga0070660_100272927
551 Ga0070689_100043164
552 Ga0070689_100105508
553 Ga0070687_100006169
554 Ga0070687_100098617
555 Ga0070661_100030034
556 Ga0070661_100084200
557 Ga0070661_100142401
558 Ga0070661_100795277
559 Ga0070692_10017855
560 Ga0070692_10035857
561 Ga0070692_10049339
562 Ga0070668_100013091
563 Ga0070668_100249756
564 Ga0070669_100032610
565 Ga0070669_100049393
566 Ga0070669_100201592
567 Ga0070675_100050349
568 Ga0070675_100315247
569 Ga0070671_100081385
570 Ga0070671_100101378
571 Ga0070674_100348415
572 Ga0070673_100033125
573 Ga0070673_100069757
574 Ga0070673_100502563
575 Ga0070688_100025578
576 Ga0070659_100144920
577 Ga0070659_100460202
578 Ga0070659_100586017
579 Ga0070667_100187944
580 Ga0070667_100194902
581 Ga0070667_100425216
582 Ga0070709_10006509
583 Ga0070714_100077074
584 Ga0070713_100032495
585 Ga0070710_10559152
586 Ga0070711_100207623
587 Ga0070711_100378539
588 Ga0070705_100351048
589 Ga0070694_100094129
590 Ga0070708_100301520
591 Ga0070678_100635280
592 Ga0070662_100002509
593 Ga0070662_100086328
594 Ga0070662_100336090
595 Ga0070681_10005288
596 Ga0070681_10032261
597 Ga0070681_10040065
598 Ga0070681_10320002
599 Ga0070681_10649531
600 Ga0070681_11094989
601 Ga0068867_100498000
602 Ga0070685_10024292
603 Ga0070707_100889884
604 Ga0070698_100089054
605 Ga0070679_100000849
606 Ga0070679_100000924
607 Ga0070679_100119720
608 Ga0070679_100186032
609 Ga0070679_100572111
610 Ga0070684_100014515
611 Ga0070684_100031372
612 Ga0070684_100080391
613 Ga0070684_100192763
614 Ga0070684_101631132
615 Ga0068853_100035957
616 Ga0068853_100084429
617 Ga0068853_100392645
618 Ga0070672_100022251
619 Ga0070672_100083250
620 Ga0070672_100152005
621 Ga0070672_100189514
622 Ga0070672_100304510
623 Ga0070695_100038304
624 Ga0070695_100477381
625 Ga0070693_100143332
626 Ga0070693_100336666
627 Ga0068855_100029834
628 Ga0068855_100080434
629 Ga0068855_100527857
630 Ga0068855_100668142
631 Ga0068855_101198345
632 Ga0070664_100019957
633 Ga0070664_100021751
634 Ga0070664_100040541
635 Ga0070664_100091212
636 Ga0070664_100718733
637 Ga0070664_100722842
638 Ga0068857_100062866
639 Ga0068857_100087308
640 Ga0068857_100608802
641 Ga0068857_101004581
642 Ga0068854_100984065
643 Ga0068856_100117120
644 Ga0068856_100253135
645 Ga0068856_100331828
646 Ga0068856_100373527
647 Ga0068856_101010910
648 Ga0070702_100224073
649 Ga0068852_100078029
650 Ga0068852_100307941
651 Ga0068859_100056418
652 Ga0068864_100094531
653 Ga0068864_100521946
654 Ga0068864_101181975
655 Ga0068861_100005314
656 Ga0068851_10036170
657 Ga0068851_10169288
658 Ga0068870_10121928
659 Ga0068863_100717219
660 Ga0068858_100220520
661 Ga0068860_100095776
662 Ga0068860_101015362
663 Ga0068862_100996261
664 Ga0070717_10209377
665 Ga0070716_100163792
666 Ga0070712_100071417
667 Ga0070712_100764066
668 Ga0075428_100344926
669 Ga0075430_100229952
670 Ga0075430_100525167
671 Ga0075431_100284515
672 Ga0075431_100514863
673 Ga0075433_10051219
674 Ga0075433_10070216
675 Ga0075434_100035242
676 Ga0075434_100048997
677 Ga0075434_100069542
678 Ga0075434_100867223
679 Ga0075436_100020475
680 Ga0075436_100172277
681 Ga0097620_100056418
682 Ga0075435_100657327
683 Ga0099795_10180048
684 Ga0105240_10056502
685 Ga0105240_10101594
686 Ga0105240_10159342
687 Ga0105240_10350905
688 Ga0111539_10504138
689 Ga0105245_10062655
690 Ga0105245_10117124
691 Ga0105245_10164620
692 Ga0105245_10383652
693 Ga0114129_10359743
694 Ga0114129_10449822
695 Ga0114129_10901481
696 Ga0105243_10026465
697 Ga0105241_10098166
698 Ga0105241_10259069
699 Ga0105241_11636277
700 Ga0105248_10143691
701 Ga0105248_10214836
702 Ga0105248_10232280
703 Ga0105248_10800766
704 Ga0105237_10257022
705 Ga0105238_10180217
706 Ga0105249_10022811
707 Ga0099796_10011988
708 Ga0105246_10073753
709 Ga0157373_10031285
710 Ga0157373_10173711
711 Ga0157371_10053156
712 Ga0157371_10190631
713 Ga0157371_10970206
714 Ga0157370_10058146
715 Ga0157370_10154523
716 Ga0157370_10380534
717 Ga0157370_11055963
718 Ga0157369_10121268
719 Ga0157369_10438145
720 Ga0157369_10588454
721 Ga0157369_10647769
722 Ga0157374_10240675
723 Ga0157374_10737990
724 Ga0157378_10696978
725 Ga0163162_10161625
726 Ga0163162_10170061
727 Ga0163162_10358685
728 Ga0163162_11003775
729 Ga0157372_10017597
730 Ga0157372_10029542
731 Ga0157372_10060717
732 Ga0157372_10076520
733 Ga0157372_10096729
734 Ga0157372_10162572
735 Ga0157372_10239713
736 Ga0157375_10042309
737 Ga0157375_10178631
738 Ga0157375_10180000
739 Ga0157375_10254361
740 Ga0157380_10025942
741 Ga0182008_10366921
742 Ga0157377_10159001
743 Ga0157377_10522350
744 Ga0157376_10008238
745 Ga0163161_10096416
746 Ga0163161_10613722
747 Ga0197907_10968816
748 Ga0206356_10083565
749 Ga0206356_11886982
750 Ga0206352_10162365
751 Ga0206354_10517450
752 Ga0206353_10466252
753 Ga0207697_10043215
754 Ga0207692_10252625
755 Ga0207688_10217434
756 Ga0207699_10076104
757 Ga0207699_10816253
758 Ga0207645_10007222
759 Ga0207645_10044550
760 Ga0207645_10102342
761 Ga0207645_10216589
762 Ga0207643_10025311
763 Ga0207705_10055378
764 Ga0207705_10232127
765 Ga0207705_10714137
766 Ga0207684_10356627
767 Ga0207654_10085251
768 Ga0207707_10022800
769 Ga0207707_10151622
770 Ga0207707_10283200
771 Ga0207695_10019729
772 Ga0207695_10126688
773 Ga0207695_10145292
774 Ga0207695_10273352
775 Ga0207695_10672137
776 Ga0207671_10224073
777 Ga0207693_10011220
778 Ga0207693_10071008
779 Ga0207663_10146289
780 Ga0207663_10489664
781 Ga0207663_10871220
782 Ga0207660_10002771
783 Ga0207660_10031219
784 Ga0207660_10060889
785 Ga0207660_10273196
786 Ga0207662_10023518
787 Ga0207662_10032357
788 Ga0207662_10301622
789 Ga0207657_10054896
790 Ga0207657_10061141
791 Ga0207657_10242990
792 Ga0207657_10256271
793 Ga0207657_10332439
794 Ga0207649_10041800
795 Ga0207649_10313681
796 Ga0207652_10011216
797 Ga0207652_10054085
798 Ga0207652_10137898
799 Ga0207652_10214996
800 Ga0207652_11002099
801 Ga0207681_10031980
802 Ga0207681_10135136
803 Ga0207681_10154809
804 Ga0207694_10128891
805 Ga0207694_10381559
806 Ga0207650_10042556
807 Ga0207650_10185492
808 Ga0207659_10099101
809 Ga0207659_10361695
810 Ga0207659_10392887
811 Ga0207687_10057665
812 Ga0207687_10060296
813 Ga0207687_10417418
814 Ga0207687_10440610
815 Ga0207664_10283334
816 Ga0207664_11086550
817 Ga0207644_10095279
818 Ga0207690_10113476
819 Ga0207690_10182906
820 Ga0207690_10851576
821 Ga0207706_10002334
822 Ga0207706_10114619
823 Ga0207706_10491252
824 Ga0207706_11018142
825 Ga0207670_10188666
826 Ga0207670_10531866
827 Ga0207669_10182185
828 Ga0207665_10410272
829 Ga0207691_10001754
830 Ga0207691_10005499
831 Ga0207691_10012606
832 Ga0207691_10055364
833 Ga0207691_10227133
834 Ga0207691_10344744
835 Ga0207711_10352965
836 Ga0207711_10370371
837 Ga0207689_10048725
838 Ga0207689_10486754
839 Ga0207661_10020932
840 Ga0207661_10100709
841 Ga0207661_10269461
842 Ga0207661_10741019
843 Ga0207661_11038191
844 Ga0207679_10074035
845 Ga0207679_10112605
846 Ga0207679_10194920
847 Ga0207679_10298293
848 Ga0207679_10689460
849 Ga0207667_10038844
850 Ga0207667_10145634
851 Ga0207667_10629179
852 Ga0207651_10050263
853 Ga0207651_10153150
854 Ga0207712_10006045
855 Ga0207668_10395316
856 Ga0207640_10728769
857 Ga0207658_10269495
858 Ga0207677_10055138
859 Ga0207677_10065974
860 Ga0207639_10053584
861 Ga0207639_10169776
862 Ga0207639_10214133
863 Ga0207708_10549375
864 Ga0207702_10736399
865 Ga0207641_10061867
866 Ga0207676_10212088
867 Ga0207676_10434874
868 Ga0207674_10023368
869 Ga0207674_10051404
870 Ga0207674_10630069
871 Ga0207675_100001703
872 Ga0207683_10463014
873 Ga0207698_10735811
874 Ga0207698_10903693
875 Ga0209968_1004560
876 Ga0268265_10573486
877 Ga0268264_11191058
878 Ga0307408_100073577
879 Ga0265314_10016377
880 Ga0307406_10001255
881 Ga0307412_10587763
882 Ga0307409_100147018
883 Ga0307416_100216842
884 Ga0307416_101049236
885 Ga0307411_10094709
886 Ga0307415_100357788
887 Ga0307510_10019078
888 Ga0373959_0009442
889 Ga0373926_0033646
890 Ga0373934_0058851
891 Ga0373940_0007645
892 Ga0373949_0069155
893 Ga0373923_0429536
894 Ga0373941_0019304
895 Ga0373956_0137045
896 Ga0373943_0030607
897 Ga0373943_0117154
898 Ga0373943_0317142
899 Ga0373946_0089470
900 Ga0373955_0127860
901 Ga0373942_0023901
902 Ga0373931_0731350
903 Ga0373935_0198299
904 Ga0373927_0031000
905 Ga0373927_0171340
906 Ga0373933_0126375
907 Ga0373947_0137547
908 Ga0373947_0144959
909 Ga0373937_0001376
910 Ga0373937_0186224
911 Ga0373937_0508202
912 Ga0373937_0626897
913 Ga0265778_021477
914 Ga0373925_0241049
915 Ga0395900_1149221
916 Ga0395905_0772811
917 Ga0436364_1402506
918 Ga0451800_0471053
919 Ga0451839_1501793
920 Ga0451853_1055004
921 Ga0466963_0063909
922 Ga0466963_0589576
923 Ga0466964_0280107
924 Ga0451576_0144476
925 Ga0451576_1850476
926 Ga0466967_0148716
927 Ga0466967_0259246
928 Ga0495651_0045312
929 Ga0495651_0449998
930 Ga0495580_0015003
931 Ga0495580_0514303
932 Ga0495582_0012115
933 Ga0495639_0138127
934 Ga0495594_0009314
935 Ga0495594_0041807
936 Ga0495596_0066125
937 Ga0495608_0062296
938 Ga0495628_0052025
939 Ga0495628_0180235
940 Ga0495628_0187839
941 Ga0495630_0107846
942 Ga0495630_0264696
943 Ga0495663_0183186
944 Ga0495663_0196147
945 Ga0495666_0136011
946 Ga0495652_0200316
947 Ga0495652_0263037
948 Ga0495665_0339284
949 Ga0495640_0074598
950 Ga0495640_0142709
951 Ga0495586_0226453
952 Ga0495587_0011026
953 Ga0495587_0406451
954 Ga0495621_0085958
955 Ga0495645_0011746
956 Ga0495667_0000491
957 Ga0495667_0012032
958 Ga0495667_0183443
959 Ga0495634_0070647
960 Ga0495635_0067640
961 Ga0495635_0175277
962 Ga0495657_0131823
963 Ga0495599_0099647
964 Ga0495599_0380021
965 Ga0495623_0001665
966 Ga0495623_0002061
967 Ga0495646_0122807
968 Ga0495658_0302735
969 Ga0495658_0380929
970 Ga0495658_0420291
971 Ga0495624_0180700
972 Ga0495600_0043260
973 Ga0495581_0035842
974 Ga0495581_0044324
975 Ga0495581_0435381
976 Ga0495674_0039794
977 Ga0495674_0903287
978 Ga0495680_0088533
979 Ga0495680_0490500
980 Ga0495675_0007858
981 Ga0495675_0073533
982 Ga0495675_0408640
983 Ga0495685_027511
984 Ga0495684_0007214
985 Ga0495684_0076980
986 Ga0495593_0105397
987 Ga0495602_0105733
988 Ga0495602_0139258
989 Ga0495615_0013723
990 Ga0496104_0007032
991 Ga0496104_0075664
992 Ga0496104_0418364
993 Ga0496105_0113393
994 Ga0496105_0270248
995 Ga0496108_0012356
996 Ga0496108_0020167
997 Ga0496109_0001037
998 Ga0496110_0016385
999 Ga0496110_0546863
1000 Ga0496111_0060108
1001 Ga0496111_0166469
1002 Ga0496112_0000129
1003 Ga0496112_0602443
1004 Ga0496113_0000062
1005 Ga0496113_0019996
1006 Ga0496114_0710435
1007 Ga0501233_148257
1008 Ga0501259_117018
1009 nmdc:mga05p37_765358_c1
1010 nmdc:mga0qj67_14306_c1
1011 nmdc:mga0qj67_308841_c1
1012 nmdc:mga0qj67_419901_c1
1013 nmdc:mga06r32_466744_c1
1014 nmdc:mga06r32_774190_c1
1015 nmdc:mga06r32_811228_c1
1016 nmdc:mga0n895_285393_c1
1017 nmdc:mga0n895_78054_c1
1018 nmdc:mga08x19_161116_c1
1019 nmdc:mga08x19_397546_c1
1020 nmdc:mga0a205_111590_c1
1021 nmdc:mga0a205_548652_c1
1022 nmdc:mga0a205_99831_c1
1023 Ga0495601_0052619
1024 Ga0495619_0229479

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12867

DinB_2

DinB superfamily

39

172

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3di5-assembly1.cif.gz_A crystal structure of a dinb-like protein (bce_4655) from bacillus cereus atcc 10987 at 2.01 a resolution 0.7857 35 184
2yqy-assembly2.cif.gz_B crystal structure of tt2238, a four-helix bundle protein 0.784 33 172
6iz2-assembly1.cif.gz_A crystal structure of dinb/yfit protein dr0053 from d. radiodurans r1 0.7766 32 184
2hkv-assembly1.cif.gz_A-2 crystal structure of a putative member of the dinb family (exig_1237) from exiguobacterium sibiricum 255-15 at 1.70 a resolution 0.7659 32 180
3dka-assembly1.cif.gz_A crystal structure of a dinb-like protein (yjoa, bsu12410) from bacillus subtilis at 2.30 a resolution 0.7622 34 189
ID Description Score Start End Superfamily
af_A0A1D6H7X6_54_145_1.10.287.370 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8584 138 180 1.10.287.370
af_Q9VTT1_11_110_1.10.287.370 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8363 134 178 1.10.287.370
af_Q8LD83_4_74_1.10.287.370 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8357 137 178 1.10.287.370
2yqyB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.784 33 172 1.20.120.450
3dkaA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7835 34 179 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A372IMB5-F1-model_v4 DinB family protein 0.9538 24 190
AF-A0A2V9ZDD9-F1-model_v4 DinB-like domain-containing protein 0.9195 24 188
AF-A0A3D4V5L1-F1-model_v4 DinB family protein 0.9123 1 191
AF-A0A1Q7V733-F1-model_v4 DinB-like domain-containing protein 0.9119 9 190
AF-A0A2V9YTC1-F1-model_v4 DinB-like domain-containing protein 0.9022 23 191

Map