F457130

General Info

Members Datasets Scaffolds Average Seq Length
510 313 1020 61

Family's Representative Sequence

Representative Sequence 3300012478|Ga0157328_1010241|Ga0157328_10102411
Length 71
Sequence MPAFTFEKISPPTRRGPIPPIAKKQRGVIVQILDRFVEARVKRSMRQDSMRQEKGVIARNPHHKPPDQADL

Samples

Sample ID Description Type Environment
1 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
88 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
103 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
175 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
177 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
178 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
179 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
180 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
181 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
182 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
183 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
184 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
185 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
186 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
187 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
188 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
189 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
190 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
191 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
192 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
193 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
194 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
195 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
196 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
197 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
198 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
199 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
200 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
201 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
202 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
203 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
204 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
205 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
206 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
207 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
208 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
210 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
211 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
212 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
215 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
216 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
217 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
218 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
219 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
220 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
221 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
222 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
223 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
224 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
225 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
226 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
227 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
228 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
229 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
230 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
231 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
232 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
233 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
234 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
235 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
236 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
237 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
238 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
239 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
240 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
241 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
242 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
243 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
244 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
245 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
246 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
247 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
248 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
249 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
250 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
251 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
252 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
253 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
254 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
255 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
256 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
257 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
258 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
259 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
260 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
261 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
262 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
263 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
264 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
265 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
266 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
267 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
268 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
269 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
270 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
271 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
272 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
273 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
274 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
275 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
276 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
277 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
278 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
279 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
280 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
281 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
282 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
283 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
284 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
285 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
286 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
287 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
288 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
289 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
290 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
291 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
292 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
293 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
294 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
295 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
296 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
297 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
298 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
299 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
300 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
301 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
302 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
303 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
304 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
305 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
306 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
307 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
308 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
309 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
310 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
311 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
312 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
313 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.51
Nodule 0
Rhizoplane 8.24
Rhizosphere 85.88
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157328_1010241 3300012478 Bacteria 645
2 JGI24751J29686_10126625 3300002459 Bacteria 538
3 JGI25406J46586_10000789 3300003203 Bacteria 14957
4 JGI25405J52794_10082275 3300003911 Bacteria 709
5 Ga0065712_10599153 3300005290 Bacteria 586
6 Ga0070676_10057578 3300005328 Bacteria 2300
7 Ga0070683_101617699 3300005329 Bacteria 623
8 Ga0070690_101487383 3300005330 Bacteria 547
9 Ga0070670_100290793 3300005331 Bacteria 1428
10 Ga0070666_10457891 3300005335 Bacteria 922
11 Ga0070682_100306737 3300005337 Bacteria 1167
12 Ga0068868_100019643 3300005338 Bacteria 5065
13 Ga0068868_100044721 3300005338 Bacteria 3463
14 Ga0068868_100970950 3300005338 Bacteria 776
15 Ga0070660_101176022 3300005339 Bacteria 650
16 Ga0070660_101522642 3300005339 Bacteria 569
17 Ga0070689_101193560 3300005340 Bacteria 683
18 Ga0070691_10477425 3300005341 Bacteria 717
19 Ga0070691_10516461 3300005341 Bacteria 693
20 Ga0070687_100503526 3300005343 Bacteria 816
21 Ga0070661_100014272 3300005344 Bacteria 5596
22 Ga0070661_101045184 3300005344 Bacteria 679
23 Ga0070692_10212974 3300005345 Bacteria 1138
24 Ga0070668_100118737 3300005347 Bacteria 2111
25 Ga0070668_101904931 3300005347 Bacteria 548
26 Ga0070669_100088462 3300005353 Bacteria 2318
27 Ga0070671_100267585 3300005355 Bacteria 1453
28 Ga0070674_100060517 3300005356 Bacteria 2640
29 Ga0070674_100629855 3300005356 Bacteria 910
30 Ga0070673_100162532 3300005364 Bacteria 1900
31 Ga0070659_100775707 3300005366 Bacteria 833
32 Ga0070667_100915180 3300005367 Bacteria 817
33 Ga0070709_10104891 3300005434 Bacteria 1890
34 Ga0070709_11258905 3300005434 Bacteria 596
35 Ga0070714_100227097 3300005435 Bacteria 1718
36 Ga0070714_101259562 3300005435 Bacteria 722
37 Ga0070713_100413153 3300005436 Bacteria 1262
38 Ga0070713_100883507 3300005436 Bacteria 859
39 Ga0070713_101162196 3300005436 Bacteria 747
40 Ga0070701_10527720 3300005438 Bacteria 771
41 Ga0070711_102063479 3300005439 Bacteria 502
42 Ga0070700_100624108 3300005441 Bacteria 848
43 Ga0070694_100266630 3300005444 Bacteria 1301
44 Ga0070708_101763293 3300005445 Bacteria 575
45 Ga0070663_100194164 3300005455 Bacteria 1581
46 Ga0070663_100309189 3300005455 Bacteria 1268
47 Ga0070663_100817807 3300005455 Bacteria 800
48 Ga0070678_100299214 3300005456 Bacteria 1367
49 Ga0070678_100363482 3300005456 Bacteria 1248
50 Ga0070678_100543129 3300005456 Bacteria 1031
51 Ga0070662_100136128 3300005457 Bacteria 1899
52 Ga0070662_101671572 3300005457 Bacteria 550
53 Ga0068867_101052166 3300005459 Bacteria 741
54 Ga0070685_11625620 3300005466 Bacteria 500
55 Ga0070706_100927662 3300005467 Bacteria 804
56 Ga0070698_100271320 3300005471 Bacteria 1628
57 Ga0070699_100992677 3300005518 Bacteria 770
58 Ga0070679_100616574 3300005530 Bacteria 1028
59 Ga0068853_100146954 3300005539 Bacteria 2119
60 Ga0068853_100297527 3300005539 Bacteria 1491
61 Ga0068853_100764397 3300005539 Bacteria 924
62 Ga0070672_100969688 3300005543 Bacteria 753
63 Ga0070672_101614490 3300005543 Bacteria 582
64 Ga0070686_101608770 3300005544 Bacteria 550
65 Ga0070695_100345904 3300005545 Bacteria 1113
66 Ga0070665_100691654 3300005548 Bacteria 1033
67 Ga0068855_100090633 3300005563 Bacteria 3528
68 Ga0068855_100624401 3300005563 Bacteria 1160
69 Ga0070664_100107626 3300005564 Bacteria 2430
70 Ga0070664_100220314 3300005564 Bacteria 1697
71 Ga0068857_100518013 3300005577 Bacteria 1121
72 Ga0068857_101711148 3300005577 Bacteria 615
73 Ga0068854_100655621 3300005578 Bacteria 902
74 Ga0068854_101497050 3300005578 Bacteria 613
75 Ga0068854_102257194 3300005578 Bacteria 504
76 Ga0068856_100082555 3300005614 Bacteria 3189
77 Ga0068856_101356738 3300005614 Bacteria 726
78 Ga0068852_100097761 3300005616 Bacteria 2642
79 Ga0068852_100447840 3300005616 Bacteria 1278
80 Ga0068852_101386687 3300005616 Bacteria 725
81 Ga0068859_100447760 3300005617 Bacteria 1387
82 Ga0068864_100008536 3300005618 Bacteria 8454
83 Ga0068864_100098418 3300005618 Bacteria 2591
84 Ga0068866_10154316 3300005718 Bacteria 1333
85 Ga0068861_100008090 3300005719 Bacteria 7233
86 Ga0068861_100813889 3300005719 Bacteria 878
87 Ga0068851_10204368 3300005834 Bacteria 1104
88 Ga0068863_100496411 3300005841 Bacteria 1202
89 Ga0068863_100655924 3300005841 Bacteria 1041
90 Ga0068858_100017551 3300005842 Bacteria 6712
91 Ga0068858_100269241 3300005842 Bacteria 1621
92 Ga0068860_101051396 3300005843 Bacteria 833
93 Ga0068860_101061994 3300005843 Bacteria 829
94 Ga0068862_100072594 3300005844 Bacteria 2973
95 Ga0081455_10008108 3300005937 Bacteria 10963
96 Ga0081455_10042864 3300005937 Bacteria 3965
97 Ga0081455_10120221 3300005937 Bacteria 2071
98 Ga0081455_10153387 3300005937 Bacteria 1774
99 Ga0081540_1002927 3300005983 Bacteria 13745
100 Ga0081540_1028073 3300005983 Bacteria 3171
101 Ga0081539_10002973 3300005985 Bacteria 22242
102 Ga0081539_10027572 3300005985 Bacteria 3593
103 Ga0070717_10516158 3300006028 Bacteria 1081
104 Ga0075365_10261291 3300006038 Bacteria 1217
105 Ga0075365_10614737 3300006038 Bacteria 768
106 Ga0075368_10045697 3300006042 Bacteria 1730
107 Ga0075363_100088566 3300006048 Bacteria 1701
108 Ga0075364_10120024 3300006051 Bacteria 1759
109 Ga0075432_10294059 3300006058 Bacteria 672
110 Ga0070715_10266761 3300006163 Bacteria 902
111 Ga0070716_100351241 3300006173 Bacteria 1044
112 Ga0070716_100763960 3300006173 Bacteria 745
113 Ga0070712_100934807 3300006175 Bacteria 749
114 Ga0075362_10091372 3300006177 Bacteria 1413
115 Ga0075362_10381955 3300006177 Bacteria 708
116 Ga0075367_10216105 3300006178 Bacteria 1199
117 Ga0075369_10129077 3300006186 Bacteria 1148
118 Ga0075366_10164402 3300006195 Bacteria 1345
119 Ga0075366_10623977 3300006195 Bacteria 668
120 Ga0097621_100178684 3300006237 Bacteria 1833
121 Ga0097621_100360688 3300006237 Bacteria 1294
122 Ga0097621_100468159 3300006237 Bacteria 1138
123 Ga0075370_10153832 3300006353 Bacteria 1348
124 Ga0068871_100110601 3300006358 Bacteria 2311
125 Ga0068871_100310385 3300006358 Bacteria 1386
126 Ga0068871_101258534 3300006358 Bacteria 695
127 Ga0075428_100409133 3300006844 Bacteria 1454
128 Ga0075434_100718108 3300006871 Bacteria 1016
129 Ga0075434_100829158 3300006871 Bacteria 941
130 Ga0068865_100168676 3300006881 Bacteria 1676
131 Ga0068865_101867739 3300006881 Bacteria 544
132 Ga0097620_100447757 3300006931 Bacteria 1387
133 Ga0075435_100261560 3300007076 Bacteria 1474
134 Ga0099794_10038660 3300007265 Bacteria 2262
135 Ga0099795_10073819 3300007788 Bacteria 1292
136 Ga0105240_10150659 3300009093 Bacteria 2771
137 Ga0105240_11695674 3300009093 Bacteria 660
138 Ga0105245_10147468 3300009098 Bacteria 2221
139 Ga0105245_10326086 3300009098 Bacteria 1514
140 Ga0105247_10026556 3300009101 Bacteria 3498
141 Ga0105247_11449802 3300009101 Bacteria 558
142 Ga0114129_10844806 3300009147 Bacteria 1164
143 Ga0105243_10130905 3300009148 Bacteria 2128
144 Ga0105243_10475300 3300009148 Bacteria 1178
145 Ga0105241_10179837 3300009174 Bacteria 1753
146 Ga0105241_10375357 3300009174 Bacteria 1241
147 Ga0105242_10102824 3300009176 Bacteria 2423
148 Ga0105242_10111360 3300009176 Bacteria 2334
149 Ga0105242_10594038 3300009176 Bacteria 1068
150 Ga0105248_10297458 3300009177 Bacteria 1817
151 Ga0105248_10385760 3300009177 Bacteria 1577
152 Ga0105237_10085768 3300009545 Bacteria 3139
153 Ga0105238_10237949 3300009551 Bacteria 1798
154 Ga0105238_10904432 3300009551 Bacteria 901
155 Ga0105249_10141132 3300009553 Bacteria 2310
156 Ga0105249_10141379 3300009553 Bacteria 2308
157 Ga0105239_10055849 3300010375 Bacteria 4331
158 Ga0105239_10879478 3300010375 Bacteria 1028
159 Ga0105239_10887206 3300010375 Bacteria 1023
160 Ga0105246_10023303 3300011119 Bacteria 4005
161 Ga0105246_10030133 3300011119 Bacteria 3580
162 Ga0157346_1008786 3300012480 Bacteria 703
163 Ga0157335_1036902 3300012492 Bacteria 536
164 Ga0157370_12019328 3300013104 Bacteria 517
165 Ga0157369_11093354 3300013105 Bacteria 815
166 Ga0157369_11357928 3300013105 Bacteria 724
167 Ga0157374_10016924 3300013296 Bacteria 6417
168 Ga0157374_11267120 3300013296 Bacteria 759
169 Ga0157378_10513739 3300013297 Bacteria 1198
170 Ga0157378_11011462 3300013297 Bacteria 866
171 Ga0157378_11461128 3300013297 Bacteria 728
172 Ga0163162_10536490 3300013306 Bacteria 1299
173 Ga0163162_12053360 3300013306 Bacteria 655
174 Ga0163162_13023133 3300013306 Bacteria 540
175 Ga0157372_10859817 3300013307 Bacteria 1053
176 Ga0157375_10220850 3300013308 Bacteria 2053
177 Ga0157375_10943991 3300013308 Bacteria 1005
178 Ga0163163_10052887 3300014325 Bacteria 4008
179 Ga0163163_10759205 3300014325 Bacteria 1033
180 Ga0157380_11876636 3300014326 Bacteria 659
181 Ga0157377_10273620 3300014745 Bacteria 1104
182 Ga0157377_10305405 3300014745 Bacteria 1052
183 Ga0157379_10265731 3300014968 Bacteria 1560
184 Ga0157379_10391117 3300014968 Bacteria 1277
185 Ga0157376_10025066 3300014969 Bacteria 4693
186 Ga0157376_10193340 3300014969 Bacteria 1867
187 Ga0207697_10115367 3300025315 Bacteria 1153
188 Ga0207697_10299211 3300025315 Bacteria 713
189 Ga0207656_10118767 3300025321 Bacteria 1229
190 Ga0207692_10786177 3300025898 Bacteria 622
191 Ga0207710_10078734 3300025900 Bacteria 1525
192 Ga0207710_10404240 3300025900 Bacteria 701
193 Ga0207688_10113556 3300025901 Bacteria 1574
194 Ga0207688_10255818 3300025901 Bacteria 1062
195 Ga0207647_10189573 3300025904 Bacteria 1192
196 Ga0207647_10454641 3300025904 Bacteria 717
197 Ga0207685_10538408 3300025905 Bacteria 619
198 Ga0207699_11110589 3300025906 Bacteria 585
199 Ga0207699_11162665 3300025906 Bacteria 571
200 Ga0207645_10034762 3300025907 Bacteria 3238
201 Ga0207645_11240148 3300025907 Bacteria 500
202 Ga0207643_10208993 3300025908 Bacteria 1191
203 Ga0207705_10556285 3300025909 Bacteria 892
204 Ga0207654_10236028 3300025911 Bacteria 1220
205 Ga0207654_10353784 3300025911 Bacteria 1012
206 Ga0207671_10092301 3300025914 Bacteria 2283
207 Ga0207671_10124473 3300025914 Bacteria 1973
208 Ga0207671_10610665 3300025914 Bacteria 869
209 Ga0207693_10143610 3300025915 Bacteria 1877
210 Ga0207657_10756500 3300025919 Bacteria 753
211 Ga0207652_10696988 3300025921 Bacteria 906
212 Ga0207646_10256768 3300025922 Bacteria 1580
213 Ga0207681_10909038 3300025923 Bacteria 737
214 Ga0207694_10067121 3300025924 Bacteria 2800
215 Ga0207694_10302877 3300025924 Bacteria 1316
216 Ga0207694_10972861 3300025924 Bacteria 718
217 Ga0207694_11487735 3300025924 Bacteria 572
218 Ga0207650_10263049 3300025925 Bacteria 1400
219 Ga0207687_10139974 3300025927 Bacteria 1835
220 Ga0207687_10706953 3300025927 Bacteria 856
221 Ga0207700_10229406 3300025928 Bacteria 1578
222 Ga0207664_10605894 3300025929 Bacteria 984
223 Ga0207664_11700901 3300025929 Bacteria 553
224 Ga0207644_10331698 3300025931 Bacteria 1232
225 Ga0207690_10400476 3300025932 Bacteria 1094
226 Ga0207690_10990636 3300025932 Bacteria 699
227 Ga0207706_10035078 3300025933 Bacteria 4462
228 Ga0207686_10116605 3300025934 Bacteria 1810
229 Ga0207686_10602133 3300025934 Bacteria 865
230 Ga0207686_10741978 3300025934 Bacteria 783
231 Ga0207709_11558578 3300025935 Bacteria 548
232 Ga0207670_10335907 3300025936 Bacteria 1193
233 Ga0207669_10531350 3300025937 Bacteria 946
234 Ga0207669_10559142 3300025937 Bacteria 924
235 Ga0207704_10476493 3300025938 Bacteria 1001
236 Ga0207665_11438673 3300025939 Bacteria 548
237 Ga0207691_10136506 3300025940 Bacteria 2163
238 Ga0207691_10181665 3300025940 Bacteria 1838
239 Ga0207711_10097010 3300025941 Bacteria 2602
240 Ga0207689_10014554 3300025942 Bacteria 6690
241 Ga0207661_10077762 3300025944 Bacteria 2730
242 Ga0207661_11910724 3300025944 Bacteria 539
243 Ga0207679_10320201 3300025945 Bacteria 1342
244 Ga0207679_10512470 3300025945 Bacteria 1072
245 Ga0207667_10467638 3300025949 Bacteria 1280
246 Ga0207667_11155216 3300025949 Bacteria 755
247 Ga0207651_10145958 3300025960 Bacteria 1835
248 Ga0207712_11114380 3300025961 Bacteria 703
249 Ga0207712_11151517 3300025961 Bacteria 691
250 Ga0207712_11814646 3300025961 Bacteria 546
251 Ga0207668_10089524 3300025972 Bacteria 2256
252 Ga0207677_10053779 3300026023 Bacteria 2743
253 Ga0207677_10288577 3300026023 Bacteria 1350
254 Ga0207703_10044332 3300026035 Bacteria 3574
255 Ga0207639_10125805 3300026041 Bacteria 2114
256 Ga0207639_10469019 3300026041 Bacteria 1146
257 Ga0207639_10914572 3300026041 Bacteria 820
258 Ga0207678_10110584 3300026067 Bacteria 2344
259 Ga0207678_10276190 3300026067 Bacteria 1441
260 Ga0207678_10800242 3300026067 Bacteria 832
261 Ga0207708_11751066 3300026075 Bacteria 545
262 Ga0207702_10221495 3300026078 Bacteria 1763
263 Ga0207702_10707394 3300026078 Bacteria 993
264 Ga0207702_11438079 3300026078 Bacteria 683
265 Ga0207641_10498063 3300026088 Bacteria 1183
266 Ga0207641_10639297 3300026088 Bacteria 1044
267 Ga0207676_10019965 3300026095 Bacteria 4895
268 Ga0207676_10128322 3300026095 Bacteria 2152
269 Ga0207676_11460776 3300026095 Bacteria 680
270 Ga0207674_10361091 3300026116 Bacteria 1404
271 Ga0207674_11433057 3300026116 Bacteria 660
272 Ga0207675_100043075 3300026118 Bacteria 4215
273 Ga0207675_100676594 3300026118 Bacteria 1039
274 Ga0207683_10013758 3300026121 Bacteria 6899
275 Ga0207683_10084186 3300026121 Bacteria 2827
276 Ga0207683_10766621 3300026121 Bacteria 895
277 Ga0207698_10089286 3300026142 Bacteria 2516
278 Ga0207698_10300644 3300026142 Bacteria 1494
279 Ga0207698_10843230 3300026142 Bacteria 921
280 Ga0209179_1079584 3300027512 Bacteria 722
281 Ga0209813_10088234 3300027866 Bacteria 1037
282 Ga0268266_10115036 3300028379 Bacteria 2387
283 Ga0268266_11235001 3300028379 Bacteria 722
284 Ga0268265_10033754 3300028380 Bacteria 3723
285 Ga0268265_12502552 3300028380 Bacteria 522
286 Ga0268264_10310542 3300028381 Bacteria 1488
287 Ga0268264_10540693 3300028381 Bacteria 1141
288 Ga0307517_10537491 3300028786 Bacteria 587
289 Ga0265773_1036199 3300031018 Unclassified 550
290 Ga0265330_10037331 3300031235 Bacteria 2163
291 Ga0265330_10178630 3300031235 Bacteria 899
292 Ga0265332_10026518 3300031238 Bacteria 2542
293 Ga0265328_10010952 3300031239 Bacteria 3637
294 Ga0265328_10377547 3300031239 Bacteria 554
295 Ga0265325_10002917 3300031241 Bacteria 11397
296 Ga0265329_10182102 3300031242 Bacteria 687
297 Ga0265340_10064772 3300031247 Bacteria 1741
298 Ga0265340_10118732 3300031247 Bacteria 1218
299 Ga0265340_10504062 3300031247 Bacteria 533
300 Ga0265339_10065401 3300031249 Bacteria 1949
301 Ga0265339_10357608 3300031249 Bacteria 687
302 Ga0265331_10128870 3300031250 Bacteria 1155
303 Ga0265316_10176271 3300031344 Bacteria 1593
304 Ga0265313_10081510 3300031595 Bacteria 1469
305 Ga0265314_10036635 3300031711 Bacteria 3562
306 Ga0265314_10110379 3300031711 Bacteria 1749
307 Ga0265342_10221728 3300031712 Bacteria 1018
308 Ga0316214_1070467 3300033545 Bacteria 516
309 Ga0373948_0010866 3300034817 Bacteria 1597
310 Ga0373958_0143759 3300034819 Bacteria 592
311 Ga0373938_0131039 3300034957 Bacteria 654
312 Ga0373934_0114661 3300035086 Bacteria 1094
313 Ga0373934_0226910 3300035086 Bacteria 771
314 Ga0373934_0241298 3300035086 Bacteria 747
315 Ga0373940_0118292 3300035088 Bacteria 820
316 Ga0373951_0103586 3300035091 Bacteria 759
317 Ga0373952_0297969 3300035092 Bacteria 501
318 Ga0373923_0017293 3300035111 Bacteria 2756
319 Ga0373932_0431357 3300035112 Bacteria 514
320 Ga0373941_0265891 3300035115 Bacteria 674
321 Ga0373953_0002488 3300035117 Bacteria 5577
322 Ga0373953_0157064 3300035117 Bacteria 977
323 Ga0373953_0376076 3300035117 Bacteria 624
324 Ga0373954_0000596 3300035118 Bacteria 13721
325 Ga0373954_0206328 3300035118 Bacteria 966
326 Ga0373956_0003285 3300035119 Bacteria 6523
327 Ga0373957_0001702 3300035120 Bacteria 6033
328 Ga0373957_0213406 3300035120 Bacteria 807
329 Ga0373943_0014933 3300035170 Bacteria 3525
330 Ga0373943_0657914 3300035170 Bacteria 619
331 Ga0373946_0499718 3300035171 Bacteria 623
332 Ga0373955_0003107 3300035172 Bacteria 7267
333 Ga0373955_0165189 3300035172 Bacteria 1308
334 Ga0373924_0000785 3300035410 Bacteria 9885
335 Ga0373931_0038543 3300035691 Bacteria 2500
336 Ga0373935_0036370 3300035692 Bacteria 3078
337 Ga0373935_0319168 3300035692 Bacteria 1102
338 Ga0373935_0972429 3300035692 Bacteria 630
339 Ga0373935_1257352 3300035692 Bacteria 552
340 Ga0373927_0023049 3300035695 Bacteria 4078
341 Ga0373927_0109107 3300035695 Bacteria 1803
342 Ga0373927_0347964 3300035695 Bacteria 977
343 Ga0373927_0932480 3300035695 Bacteria 573
344 Ga0373927_1065817 3300035695 Bacteria 533
345 Ga0373933_0023095 3300035724 Bacteria 3549
346 Ga0373933_0422133 3300035724 Bacteria 871
347 Ga0373933_0679638 3300035724 Bacteria 677
348 Ga0373947_0052484 3300035725 Bacteria 2456
349 Ga0373947_0394268 3300035725 Bacteria 933
350 Ga0373947_0719399 3300035725 Bacteria 681
351 Ga0373937_0061401 3300036401 Bacteria 3455
352 Ga0373937_0755203 3300036401 Bacteria 920
353 Ga0373925_0262170 3300037068 Bacteria 1388
354 Ga0373925_0298524 3300037068 Bacteria 1300
355 Ga0373925_0494483 3300037068 Bacteria 1004
356 Ga0395900_1182040 3300037418 Bacteria 681
357 Ga0395898_0214898 3300037466 Bacteria 1834
358 Ga0395905_0027045 3300037471 Bacteria 5410
359 Ga0395905_1143767 3300037471 Bacteria 682
360 Ga0395905_1588159 3300037471 Bacteria 559
361 Ga0451802_0511609 3300041460 Bacteria 605
362 Ga0451807_2256077 3300041486 Bacteria 592
363 Ga0451839_0224566 3300041496 Bacteria 536
364 Ga0466965_0618960 3300044683 Bacteria 616
365 Ga0466963_0077283 3300044694 Bacteria 2249
366 Ga0466967_1216404 3300045976 Bacteria 751
367 Ga0495592_0003889 3300046454 Bacteria 10813
368 Ga0495592_0795200 3300046454 Bacteria 562
369 Ga0495603_0031000 3300046455 Bacteria 3219
370 Ga0495603_0084543 3300046455 Bacteria 1858
371 Ga0495629_0001530 3300046459 Bacteria 18179
372 Ga0495641_0520171 3300046461 Bacteria 543
373 Ga0495651_0092215 3300046462 Bacteria 2269
374 Ga0495653_0009033 3300046463 Bacteria 8150
375 Ga0495653_0681717 3300046463 Bacteria 625
376 Ga0495580_0241433 3300046472 Bacteria 1239
377 Ga0495582_0862864 3300046473 Bacteria 523
378 Ga0495605_0121488 3300046474 Bacteria 1184
379 Ga0495639_0077286 3300046475 Bacteria 1545
380 Ga0495639_0126143 3300046475 Bacteria 1223
381 Ga0495664_0255041 3300046477 Bacteria 1061
382 Ga0495594_0040530 3300046499 Bacteria 2549
383 Ga0495594_0595502 3300046499 Bacteria 627
384 Ga0495596_0070435 3300046500 Bacteria 1359
385 Ga0495606_0202537 3300046507 Bacteria 1130
386 Ga0495608_0002573 3300046511 Bacteria 13016
387 Ga0495616_0380174 3300046513 Bacteria 583
388 Ga0495628_0713374 3300046516 Bacteria 707
389 Ga0495632_0514903 3300046519 Bacteria 515
390 Ga0495644_0179134 3300046523 Bacteria 815
391 Ga0495648_0047438 3300046524 Bacteria 2654
392 Ga0495666_0500314 3300046526 Bacteria 543
393 Ga0495652_0007302 3300046529 Bacteria 10195
394 Ga0495665_0461185 3300046531 Bacteria 642
395 Ga0495640_0004673 3300046533 Bacteria 10920
396 Ga0495587_0085960 3300046536 Bacteria 1820
397 Ga0495587_0383224 3300046536 Bacteria 782
398 Ga0495645_0062395 3300046543 Bacteria 2699
399 Ga0495667_0086033 3300046559 Bacteria 2039
400 Ga0495656_0253971 3300046615 Bacteria 889
401 Ga0495668_0080910 3300046616 Bacteria 1783
402 Ga0495634_0036076 3300046642 Bacteria 3383
403 Ga0495634_0198167 3300046642 Bacteria 1249
404 Ga0495611_0198180 3300046648 Bacteria 937
405 Ga0495635_0004761 3300046663 Bacteria 9434
406 Ga0495661_0377642 3300046665 Bacteria 693
407 Ga0495588_0164282 3300046674 Bacteria 1174
408 Ga0495588_0780059 3300046674 Bacteria 500
409 Ga0495657_0118058 3300046675 Bacteria 1673
410 Ga0495599_0004233 3300046678 Bacteria 8479
411 Ga0495623_0060209 3300046679 Bacteria 2382
412 Ga0495646_0309779 3300046680 Bacteria 833
413 Ga0495647_0053011 3300046681 Bacteria 1581
414 Ga0495658_0084288 3300046683 Bacteria 1871
415 Ga0495669_0046878 3300046684 Bacteria 1930
416 Ga0495613_0082283 3300046689 Bacteria 2338
417 Ga0495671_0353496 3300046692 Bacteria 705
418 Ga0495671_0640851 3300046692 Bacteria 505
419 Ga0495600_0004785 3300046809 Bacteria 8124
420 Ga0495600_0242846 3300046809 Bacteria 1147
421 Ga0495581_0115190 3300047315 Bacteria 1563
422 Ga0495581_0138389 3300047315 Bacteria 1420
423 Ga0495581_0564323 3300047315 Bacteria 660
424 Ga0495604_0012947 3300047317 Bacteria 6647
425 Ga0495604_0538754 3300047317 Bacteria 754
426 Ga0495674_0008741 3300047319 Bacteria 9634
427 Ga0495674_0582563 3300047319 Bacteria 888
428 Ga0495672_0325967 3300047320 Bacteria 720
429 Ga0495676_0089575 3300047321 Bacteria 2305
430 Ga0495676_0628342 3300047321 Bacteria 698
431 Ga0495675_0004725 3300047444 Bacteria 8268
432 Ga0495675_0245033 3300047444 Bacteria 1078
433 Ga0495673_0030282 3300047469 Bacteria 2543
434 Ga0495684_0013210 3300047471 Bacteria 6372
435 Ga0495593_0002266 3300047673 Bacteria 11535
436 Ga0495593_0314573 3300047673 Bacteria 783
437 Ga0495602_0043989 3300048088 Bacteria 4053
438 Ga0495602_0228167 3300048088 Bacteria 1401
439 Ga0496100_0013300 3300048903 Bacteria 4742
440 Ga0496100_0458001 3300048903 Bacteria 978
441 Ga0496100_0900776 3300048903 Bacteria 695
442 Ga0496101_0022109 3300048904 Bacteria 4375
443 Ga0496101_0202287 3300048904 Bacteria 1536
444 Ga0496101_0942424 3300048904 Bacteria 679
445 Ga0496102_0002007 3300048905 Bacteria 17583
446 Ga0496102_1173186 3300048905 Bacteria 687
447 Ga0496103_0012128 3300048906 Bacteria 5120
448 Ga0496103_0303097 3300048906 Bacteria 1028
449 Ga0496104_0214519 3300048907 Bacteria 1836
450 Ga0496104_0221644 3300048907 Bacteria 1803
451 Ga0496104_0824889 3300048907 Bacteria 833
452 Ga0496105_0013030 3300048908 Bacteria 6589
453 Ga0496105_0076210 3300048908 Bacteria 2769
454 Ga0496105_0905096 3300048908 Bacteria 665
455 Ga0496106_0021340 3300048909 Bacteria 4808
456 Ga0496106_0051714 3300048909 Bacteria 3098
457 Ga0496106_0226784 3300048909 Bacteria 1491
458 Ga0496107_0007234 3300048910 Bacteria 7647
459 Ga0496107_0079823 3300048910 Bacteria 2385
460 Ga0496107_1187172 3300048910 Bacteria 549
461 Ga0496108_0008204 3300048911 Bacteria 8476
462 Ga0496108_0142228 3300048911 Bacteria 2067
463 Ga0496108_0356965 3300048911 Bacteria 1275
464 Ga0496109_0175835 3300048912 Bacteria 2009
465 Ga0496109_0254550 3300048912 Bacteria 1653
466 Ga0496109_0459040 3300048912 Bacteria 1203
467 Ga0496110_0017010 3300048913 Bacteria 6079
468 Ga0496110_0139615 3300048913 Bacteria 2190
469 Ga0496111_0057196 3300048914 Bacteria 2823
470 Ga0496112_0022055 3300048915 Bacteria 6064
471 Ga0496112_0039237 3300048915 Bacteria 4626
472 Ga0496112_0431214 3300048915 Bacteria 1256
473 Ga0496113_0325879 3300048916 Bacteria 1231
474 Ga0496113_0480061 3300048916 Bacteria 998
475 Ga0496114_0021956 3300048917 Bacteria 5196
476 Ga0496115_0037110 3300048918 Bacteria 3861
477 Ga0496115_0112112 3300048918 Bacteria 2241
478 Ga0496115_0552376 3300048918 Bacteria 920
479 Ga0496117_0254472 3300048920 Bacteria 956
480 Ga0496121_0005166 3300048924 Bacteria 16947
481 Ga0496121_0392597 3300048924 Bacteria 911
482 Ga0496125_0583699 3300048928 Bacteria 613
483 Ga0501067_0672367 3300049583 Bacteria 582
484 nmdc:mga03683_99285_c1 3300050489 Bacteria 1278
485 nmdc:mga03n38_58474_c1 3300050490 Bacteria 1747
486 nmdc:mga00v17_107502_c1 3300050491 Bacteria 1767
487 nmdc:mga0yw44_125498_c1 3300050492 Bacteria 1657
488 nmdc:mga0k408_81327_c1 3300050493 Bacteria 1897
489 nmdc:mga06z11_149058_c1 3300050494 Bacteria 1328
490 nmdc:mga06z11_515864_c1 3300050494 Bacteria 725
491 nmdc:mga05p37_854520_c1 3300050507 Bacteria 988
492 nmdc:mga08y16_1109106_c1 3300050511 Bacteria 766
493 nmdc:mga0n895_601176_c1 3300050512 Bacteria 1102
494 nmdc:mga0n895_641986_c1 3300050512 Bacteria 1061
495 nmdc:mga0rr50_1450146_c1 3300050513 Bacteria 581
496 nmdc:mga0a205_540807_c1 3300050515 Bacteria 1020
497 nmdc:mga0sz30_111799_c1 3300050516 Bacteria 1198
498 nmdc:mga0sz30_96801_c1 3300050516 Bacteria 1287
499 Ga0495601_0079919 3300053077 Bacteria 2097
500 Ga0495601_0136049 3300053077 Bacteria 1602
501 Ga0495601_0374508 3300053077 Bacteria 924
502 Ga0495601_0389444 3300053077 Bacteria 904
503 Ga0495655_0202977 3300053083 Bacteria 649
504 Ga0495595_0008012 3300053084 Bacteria 4327
505 Ga0495595_0025940 3300053084 Bacteria 2600
506 Ga0495619_0001898 3300053085 Bacteria 13926
507 Ga0495619_0056934 3300053085 Bacteria 2593
508 Ga0495619_0360819 3300053085 Bacteria 1005
509 Ga0495619_1070871 3300053085 Bacteria 537
510 Ga0500637_0480571 3300053178 Bacteria 622
511 Ga0157328_1010241
512 JGI24751J29686_10126625
513 JGI25406J46586_10000789
514 JGI25405J52794_10082275
515 Ga0065712_10599153
516 Ga0070676_10057578
517 Ga0070683_101617699
518 Ga0070690_101487383
519 Ga0070670_100290793
520 Ga0070666_10457891
521 Ga0070682_100306737
522 Ga0068868_100019643
523 Ga0068868_100044721
524 Ga0068868_100970950
525 Ga0070660_101176022
526 Ga0070660_101522642
527 Ga0070689_101193560
528 Ga0070691_10477425
529 Ga0070691_10516461
530 Ga0070687_100503526
531 Ga0070661_100014272
532 Ga0070661_101045184
533 Ga0070692_10212974
534 Ga0070668_100118737
535 Ga0070668_101904931
536 Ga0070669_100088462
537 Ga0070671_100267585
538 Ga0070674_100060517
539 Ga0070674_100629855
540 Ga0070673_100162532
541 Ga0070659_100775707
542 Ga0070667_100915180
543 Ga0070709_10104891
544 Ga0070709_11258905
545 Ga0070714_100227097
546 Ga0070714_101259562
547 Ga0070713_100413153
548 Ga0070713_100883507
549 Ga0070713_101162196
550 Ga0070701_10527720
551 Ga0070711_102063479
552 Ga0070700_100624108
553 Ga0070694_100266630
554 Ga0070708_101763293
555 Ga0070663_100194164
556 Ga0070663_100309189
557 Ga0070663_100817807
558 Ga0070678_100299214
559 Ga0070678_100363482
560 Ga0070678_100543129
561 Ga0070662_100136128
562 Ga0070662_101671572
563 Ga0068867_101052166
564 Ga0070685_11625620
565 Ga0070706_100927662
566 Ga0070698_100271320
567 Ga0070699_100992677
568 Ga0070679_100616574
569 Ga0068853_100146954
570 Ga0068853_100297527
571 Ga0068853_100764397
572 Ga0070672_100969688
573 Ga0070672_101614490
574 Ga0070686_101608770
575 Ga0070695_100345904
576 Ga0070665_100691654
577 Ga0068855_100090633
578 Ga0068855_100624401
579 Ga0070664_100107626
580 Ga0070664_100220314
581 Ga0068857_100518013
582 Ga0068857_101711148
583 Ga0068854_100655621
584 Ga0068854_101497050
585 Ga0068854_102257194
586 Ga0068856_100082555
587 Ga0068856_101356738
588 Ga0068852_100097761
589 Ga0068852_100447840
590 Ga0068852_101386687
591 Ga0068859_100447760
592 Ga0068864_100008536
593 Ga0068864_100098418
594 Ga0068866_10154316
595 Ga0068861_100008090
596 Ga0068861_100813889
597 Ga0068851_10204368
598 Ga0068863_100496411
599 Ga0068863_100655924
600 Ga0068858_100017551
601 Ga0068858_100269241
602 Ga0068860_101051396
603 Ga0068860_101061994
604 Ga0068862_100072594
605 Ga0081455_10008108
606 Ga0081455_10042864
607 Ga0081455_10120221
608 Ga0081455_10153387
609 Ga0081540_1002927
610 Ga0081540_1028073
611 Ga0081539_10002973
612 Ga0081539_10027572
613 Ga0070717_10516158
614 Ga0075365_10261291
615 Ga0075365_10614737
616 Ga0075368_10045697
617 Ga0075363_100088566
618 Ga0075364_10120024
619 Ga0075432_10294059
620 Ga0070715_10266761
621 Ga0070716_100351241
622 Ga0070716_100763960
623 Ga0070712_100934807
624 Ga0075362_10091372
625 Ga0075362_10381955
626 Ga0075367_10216105
627 Ga0075369_10129077
628 Ga0075366_10164402
629 Ga0075366_10623977
630 Ga0097621_100178684
631 Ga0097621_100360688
632 Ga0097621_100468159
633 Ga0075370_10153832
634 Ga0068871_100110601
635 Ga0068871_100310385
636 Ga0068871_101258534
637 Ga0075428_100409133
638 Ga0075434_100718108
639 Ga0075434_100829158
640 Ga0068865_100168676
641 Ga0068865_101867739
642 Ga0097620_100447757
643 Ga0075435_100261560
644 Ga0099794_10038660
645 Ga0099795_10073819
646 Ga0105240_10150659
647 Ga0105240_11695674
648 Ga0105245_10147468
649 Ga0105245_10326086
650 Ga0105247_10026556
651 Ga0105247_11449802
652 Ga0114129_10844806
653 Ga0105243_10130905
654 Ga0105243_10475300
655 Ga0105241_10179837
656 Ga0105241_10375357
657 Ga0105242_10102824
658 Ga0105242_10111360
659 Ga0105242_10594038
660 Ga0105248_10297458
661 Ga0105248_10385760
662 Ga0105237_10085768
663 Ga0105238_10237949
664 Ga0105238_10904432
665 Ga0105249_10141132
666 Ga0105249_10141379
667 Ga0105239_10055849
668 Ga0105239_10879478
669 Ga0105239_10887206
670 Ga0105246_10023303
671 Ga0105246_10030133
672 Ga0157346_1008786
673 Ga0157335_1036902
674 Ga0157370_12019328
675 Ga0157369_11093354
676 Ga0157369_11357928
677 Ga0157374_10016924
678 Ga0157374_11267120
679 Ga0157378_10513739
680 Ga0157378_11011462
681 Ga0157378_11461128
682 Ga0163162_10536490
683 Ga0163162_12053360
684 Ga0163162_13023133
685 Ga0157372_10859817
686 Ga0157375_10220850
687 Ga0157375_10943991
688 Ga0163163_10052887
689 Ga0163163_10759205
690 Ga0157380_11876636
691 Ga0157377_10273620
692 Ga0157377_10305405
693 Ga0157379_10265731
694 Ga0157379_10391117
695 Ga0157376_10025066
696 Ga0157376_10193340
697 Ga0207697_10115367
698 Ga0207697_10299211
699 Ga0207656_10118767
700 Ga0207692_10786177
701 Ga0207710_10078734
702 Ga0207710_10404240
703 Ga0207688_10113556
704 Ga0207688_10255818
705 Ga0207647_10189573
706 Ga0207647_10454641
707 Ga0207685_10538408
708 Ga0207699_11110589
709 Ga0207699_11162665
710 Ga0207645_10034762
711 Ga0207645_11240148
712 Ga0207643_10208993
713 Ga0207705_10556285
714 Ga0207654_10236028
715 Ga0207654_10353784
716 Ga0207671_10092301
717 Ga0207671_10124473
718 Ga0207671_10610665
719 Ga0207693_10143610
720 Ga0207657_10756500
721 Ga0207652_10696988
722 Ga0207646_10256768
723 Ga0207681_10909038
724 Ga0207694_10067121
725 Ga0207694_10302877
726 Ga0207694_10972861
727 Ga0207694_11487735
728 Ga0207650_10263049
729 Ga0207687_10139974
730 Ga0207687_10706953
731 Ga0207700_10229406
732 Ga0207664_10605894
733 Ga0207664_11700901
734 Ga0207644_10331698
735 Ga0207690_10400476
736 Ga0207690_10990636
737 Ga0207706_10035078
738 Ga0207686_10116605
739 Ga0207686_10602133
740 Ga0207686_10741978
741 Ga0207709_11558578
742 Ga0207670_10335907
743 Ga0207669_10531350
744 Ga0207669_10559142
745 Ga0207704_10476493
746 Ga0207665_11438673
747 Ga0207691_10136506
748 Ga0207691_10181665
749 Ga0207711_10097010
750 Ga0207689_10014554
751 Ga0207661_10077762
752 Ga0207661_11910724
753 Ga0207679_10320201
754 Ga0207679_10512470
755 Ga0207667_10467638
756 Ga0207667_11155216
757 Ga0207651_10145958
758 Ga0207712_11114380
759 Ga0207712_11151517
760 Ga0207712_11814646
761 Ga0207668_10089524
762 Ga0207677_10053779
763 Ga0207677_10288577
764 Ga0207703_10044332
765 Ga0207639_10125805
766 Ga0207639_10469019
767 Ga0207639_10914572
768 Ga0207678_10110584
769 Ga0207678_10276190
770 Ga0207678_10800242
771 Ga0207708_11751066
772 Ga0207702_10221495
773 Ga0207702_10707394
774 Ga0207702_11438079
775 Ga0207641_10498063
776 Ga0207641_10639297
777 Ga0207676_10019965
778 Ga0207676_10128322
779 Ga0207676_11460776
780 Ga0207674_10361091
781 Ga0207674_11433057
782 Ga0207675_100043075
783 Ga0207675_100676594
784 Ga0207683_10013758
785 Ga0207683_10084186
786 Ga0207683_10766621
787 Ga0207698_10089286
788 Ga0207698_10300644
789 Ga0207698_10843230
790 Ga0209179_1079584
791 Ga0209813_10088234
792 Ga0268266_10115036
793 Ga0268266_11235001
794 Ga0268265_10033754
795 Ga0268265_12502552
796 Ga0268264_10310542
797 Ga0268264_10540693
798 Ga0307517_10537491
799 Ga0265773_1036199
800 Ga0265330_10037331
801 Ga0265330_10178630
802 Ga0265332_10026518
803 Ga0265328_10010952
804 Ga0265328_10377547
805 Ga0265325_10002917
806 Ga0265329_10182102
807 Ga0265340_10064772
808 Ga0265340_10118732
809 Ga0265340_10504062
810 Ga0265339_10065401
811 Ga0265339_10357608
812 Ga0265331_10128870
813 Ga0265316_10176271
814 Ga0265313_10081510
815 Ga0265314_10036635
816 Ga0265314_10110379
817 Ga0265342_10221728
818 Ga0316214_1070467
819 Ga0373948_0010866
820 Ga0373958_0143759
821 Ga0373938_0131039
822 Ga0373934_0114661
823 Ga0373934_0226910
824 Ga0373934_0241298
825 Ga0373940_0118292
826 Ga0373951_0103586
827 Ga0373952_0297969
828 Ga0373923_0017293
829 Ga0373932_0431357
830 Ga0373941_0265891
831 Ga0373953_0002488
832 Ga0373953_0157064
833 Ga0373953_0376076
834 Ga0373954_0000596
835 Ga0373954_0206328
836 Ga0373956_0003285
837 Ga0373957_0001702
838 Ga0373957_0213406
839 Ga0373943_0014933
840 Ga0373943_0657914
841 Ga0373946_0499718
842 Ga0373955_0003107
843 Ga0373955_0165189
844 Ga0373924_0000785
845 Ga0373931_0038543
846 Ga0373935_0036370
847 Ga0373935_0319168
848 Ga0373935_0972429
849 Ga0373935_1257352
850 Ga0373927_0023049
851 Ga0373927_0109107
852 Ga0373927_0347964
853 Ga0373927_0932480
854 Ga0373927_1065817
855 Ga0373933_0023095
856 Ga0373933_0422133
857 Ga0373933_0679638
858 Ga0373947_0052484
859 Ga0373947_0394268
860 Ga0373947_0719399
861 Ga0373937_0061401
862 Ga0373937_0755203
863 Ga0373925_0262170
864 Ga0373925_0298524
865 Ga0373925_0494483
866 Ga0395900_1182040
867 Ga0395898_0214898
868 Ga0395905_0027045
869 Ga0395905_1143767
870 Ga0395905_1588159
871 Ga0451802_0511609
872 Ga0451807_2256077
873 Ga0451839_0224566
874 Ga0466965_0618960
875 Ga0466963_0077283
876 Ga0466967_1216404
877 Ga0495592_0003889
878 Ga0495592_0795200
879 Ga0495603_0031000
880 Ga0495603_0084543
881 Ga0495629_0001530
882 Ga0495641_0520171
883 Ga0495651_0092215
884 Ga0495653_0009033
885 Ga0495653_0681717
886 Ga0495580_0241433
887 Ga0495582_0862864
888 Ga0495605_0121488
889 Ga0495639_0077286
890 Ga0495639_0126143
891 Ga0495664_0255041
892 Ga0495594_0040530
893 Ga0495594_0595502
894 Ga0495596_0070435
895 Ga0495606_0202537
896 Ga0495608_0002573
897 Ga0495616_0380174
898 Ga0495628_0713374
899 Ga0495632_0514903
900 Ga0495644_0179134
901 Ga0495648_0047438
902 Ga0495666_0500314
903 Ga0495652_0007302
904 Ga0495665_0461185
905 Ga0495640_0004673
906 Ga0495587_0085960
907 Ga0495587_0383224
908 Ga0495645_0062395
909 Ga0495667_0086033
910 Ga0495656_0253971
911 Ga0495668_0080910
912 Ga0495634_0036076
913 Ga0495634_0198167
914 Ga0495611_0198180
915 Ga0495635_0004761
916 Ga0495661_0377642
917 Ga0495588_0164282
918 Ga0495588_0780059
919 Ga0495657_0118058
920 Ga0495599_0004233
921 Ga0495623_0060209
922 Ga0495646_0309779
923 Ga0495647_0053011
924 Ga0495658_0084288
925 Ga0495669_0046878
926 Ga0495613_0082283
927 Ga0495671_0353496
928 Ga0495671_0640851
929 Ga0495600_0004785
930 Ga0495600_0242846
931 Ga0495581_0115190
932 Ga0495581_0138389
933 Ga0495581_0564323
934 Ga0495604_0012947
935 Ga0495604_0538754
936 Ga0495674_0008741
937 Ga0495674_0582563
938 Ga0495672_0325967
939 Ga0495676_0089575
940 Ga0495676_0628342
941 Ga0495675_0004725
942 Ga0495675_0245033
943 Ga0495673_0030282
944 Ga0495684_0013210
945 Ga0495593_0002266
946 Ga0495593_0314573
947 Ga0495602_0043989
948 Ga0495602_0228167
949 Ga0496100_0013300
950 Ga0496100_0458001
951 Ga0496100_0900776
952 Ga0496101_0022109
953 Ga0496101_0202287
954 Ga0496101_0942424
955 Ga0496102_0002007
956 Ga0496102_1173186
957 Ga0496103_0012128
958 Ga0496103_0303097
959 Ga0496104_0214519
960 Ga0496104_0221644
961 Ga0496104_0824889
962 Ga0496105_0013030
963 Ga0496105_0076210
964 Ga0496105_0905096
965 Ga0496106_0021340
966 Ga0496106_0051714
967 Ga0496106_0226784
968 Ga0496107_0007234
969 Ga0496107_0079823
970 Ga0496107_1187172
971 Ga0496108_0008204
972 Ga0496108_0142228
973 Ga0496108_0356965
974 Ga0496109_0175835
975 Ga0496109_0254550
976 Ga0496109_0459040
977 Ga0496110_0017010
978 Ga0496110_0139615
979 Ga0496111_0057196
980 Ga0496112_0022055
981 Ga0496112_0039237
982 Ga0496112_0431214
983 Ga0496113_0325879
984 Ga0496113_0480061
985 Ga0496114_0021956
986 Ga0496115_0037110
987 Ga0496115_0112112
988 Ga0496115_0552376
989 Ga0496117_0254472
990 Ga0496121_0005166
991 Ga0496121_0392597
992 Ga0496125_0583699
993 Ga0501067_0672367
994 nmdc:mga03683_99285_c1
995 nmdc:mga03n38_58474_c1
996 nmdc:mga00v17_107502_c1
997 nmdc:mga0yw44_125498_c1
998 nmdc:mga0k408_81327_c1
999 nmdc:mga06z11_149058_c1
1000 nmdc:mga06z11_515864_c1
1001 nmdc:mga05p37_854520_c1
1002 nmdc:mga08y16_1109106_c1
1003 nmdc:mga0n895_601176_c1
1004 nmdc:mga0n895_641986_c1
1005 nmdc:mga0rr50_1450146_c1
1006 nmdc:mga0a205_540807_c1
1007 nmdc:mga0sz30_111799_c1
1008 nmdc:mga0sz30_96801_c1
1009 Ga0495601_0079919
1010 Ga0495601_0136049
1011 Ga0495601_0374508
1012 Ga0495601_0389444
1013 Ga0495655_0202977
1014 Ga0495595_0008012
1015 Ga0495595_0025940
1016 Ga0495619_0001898
1017 Ga0495619_0056934
1018 Ga0495619_0360819
1019 Ga0495619_1070871
1020 Ga0500637_0480571

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map