F457093

General Info

Members Datasets Scaffolds Average Seq Length
510 180 1020 83

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100025253|Ga0070669_1000252532
Length 102
Sequence MSETVTLVVNDIAVEMPAGSMVSAAILKTGTHAFRRSVTGEPRGPLCGMGICFECRVTIDGEQHCRSCQTVCRNGMDVRTEPQKSTEEMQPQKGTKSAKETK

Samples

Sample ID Description Type Environment
1 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
2 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
87 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
118 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
146 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
147 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
148 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
149 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
150 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
151 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
152 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
153 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
154 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
155 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
156 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
157 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
158 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
159 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
162 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
163 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
164 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
165 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
166 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
167 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
168 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
169 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
170 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
175 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
176 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
177 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
180 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.2
Rhizosphere 99.22
Stem 0
Stem Tuber 0
Unclassified 25.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070669_100025253 3300005353 Bacteria 4267
2 CNBas_1011538 3300000531 Unclassified 545
3 JGI24751J29686_10000003 3300002459 Bacteria 157815
4 JGI25406J46586_10024675 3300003203 Unclassified 2351
5 rootL2_10229967 3300003322 Bacteria 3140
6 Ga0065712_10003967 3300005290 Bacteria 4271
7 Ga0065712_10067727 3300005290 Bacteria 189643
8 Ga0065712_10402147 3300005290 Unclassified 730
9 Ga0065712_10646269 3300005290 Unclassified 569
10 Ga0065715_10000520 3300005293 Bacteria 22337
11 Ga0065715_10009366 3300005293 Bacteria 2974
12 Ga0065715_10122425 3300005293 Bacteria 2205
13 Ga0065715_10156707 3300005293 Unclassified 1669
14 Ga0065715_10306332 3300005293 Bacteria 1028
15 Ga0065715_10708554 3300005293 Bacteria 649
16 Ga0065715_10713573 3300005293 Unclassified 647
17 Ga0065715_10837102 3300005293 Bacteria 596
18 Ga0065715_11022956 3300005293 Bacteria 539
19 Ga0065707_10195297 3300005295 Unclassified 1339
20 Ga0065707_10247777 3300005295 Bacteria 1135
21 Ga0070676_10215496 3300005328 Bacteria 1265
22 Ga0070676_10545173 3300005328 Unclassified 829
23 Ga0070676_11380804 3300005328 Unclassified 540
24 Ga0070690_100110532 3300005330 Bacteria 1833
25 Ga0070690_100361328 3300005330 Unclassified 1056
26 Ga0070690_100400596 3300005330 Unclassified 1008
27 Ga0070690_101099461 3300005330 Unclassified 630
28 Ga0070670_100000190 3300005331 Bacteria 56382
29 Ga0070670_100240228 3300005331 Bacteria 1577
30 Ga0070670_100654348 3300005331 Bacteria 943
31 Ga0068869_100071495 3300005334 Unclassified 2569
32 Ga0068869_100071519 3300005334 Bacteria 2568
33 Ga0068869_100092888 3300005334 Bacteria 2272
34 Ga0068869_100122663 3300005334 Unclassified 1989
35 Ga0068869_100489372 3300005334 Bacteria 1025
36 Ga0070666_10299523 3300005335 Bacteria 1145
37 Ga0070666_10691091 3300005335 Unclassified 748
38 Ga0070666_11363976 3300005335 Unclassified 529
39 Ga0070680_100038169 3300005336 Bacteria 3884
40 Ga0070680_100113237 3300005336 Bacteria 2259
41 Ga0070682_101359299 3300005337 Unclassified 606
42 Ga0068868_100137175 3300005338 Bacteria 2006
43 Ga0068868_100544800 3300005338 Bacteria 1022
44 Ga0070660_101812952 3300005339 Bacteria 520
45 Ga0070689_100011690 3300005340 Bacteria 6299
46 Ga0070689_100178337 3300005340 Unclassified 1724
47 Ga0070689_100733744 3300005340 Bacteria 865
48 Ga0070687_100073489 3300005343 Unclassified 1843
49 Ga0070687_100151719 3300005343 Bacteria 1361
50 Ga0070661_100270053 3300005344 Bacteria 1317
51 Ga0070661_100507482 3300005344 Bacteria 966
52 Ga0070692_10024854 3300005345 Bacteria 2948
53 Ga0070692_10153730 3300005345 Bacteria 1313
54 Ga0070692_10272707 3300005345 Bacteria 1022
55 Ga0070692_11194801 3300005345 Bacteria 541
56 Ga0070668_100548095 3300005347 Bacteria 1006
57 Ga0070669_101347161 3300005353 Unclassified 619
58 Ga0070675_100513037 3300005354 Unclassified 1081
59 Ga0070675_101348144 3300005354 Bacteria 658
60 Ga0070671_100006739 3300005355 Bacteria 9191
61 Ga0070671_100112951 3300005355 Bacteria 2282
62 Ga0070671_100160653 3300005355 Bacteria 1899
63 Ga0070671_100360113 3300005355 Bacteria 1242
64 Ga0070674_100287009 3300005356 Bacteria 1307
65 Ga0070674_100582347 3300005356 Bacteria 943
66 Ga0070673_100103119 3300005364 Bacteria 2353
67 Ga0070673_100143655 3300005364 Bacteria 2015
68 Ga0070673_101026098 3300005364 Bacteria 769
69 Ga0070673_101085096 3300005364 Bacteria 747
70 Ga0070673_101384824 3300005364 Bacteria 662
71 Ga0070688_100120796 3300005365 Bacteria 1755
72 Ga0070688_100325740 3300005365 Unclassified 1118
73 Ga0070688_100669032 3300005365 Bacteria 801
74 Ga0070688_100758015 3300005365 Bacteria 756
75 Ga0070659_100040156 3300005366 Bacteria 3655
76 Ga0070659_100576230 3300005366 Bacteria 965
77 Ga0070659_101100089 3300005366 Unclassified 700
78 Ga0070659_102069116 3300005366 Unclassified 512
79 Ga0070667_100125885 3300005367 Bacteria 2233
80 Ga0070703_10242751 3300005406 Unclassified 727
81 Ga0070701_10025364 3300005438 Bacteria 2878
82 Ga0070701_10265670 3300005438 Unclassified 1042
83 Ga0070701_10275955 3300005438 Bacteria 1025
84 Ga0070701_10416249 3300005438 Bacteria 855
85 Ga0070705_100018895 3300005440 Bacteria 3620
86 Ga0070705_100153553 3300005440 Bacteria 1530
87 Ga0070705_100341879 3300005440 Bacteria 1088
88 Ga0070705_100672976 3300005440 Bacteria 810
89 Ga0070705_101401922 3300005440 Unclassified 582
90 Ga0070705_101564226 3300005440 Bacteria 554
91 Ga0070700_100171176 3300005441 Unclassified 1504
92 Ga0070700_100217881 3300005441 Bacteria 1350
93 Ga0070700_100314719 3300005441 Unclassified 1148
94 Ga0070694_100052705 3300005444 Bacteria 2751
95 Ga0070694_100053848 3300005444 Bacteria 2724
96 Ga0070694_100165943 3300005444 Bacteria 1624
97 Ga0070694_100712349 3300005444 Bacteria 817
98 Ga0070694_101504331 3300005444 Bacteria 570
99 Ga0070694_101534476 3300005444 Bacteria 564
100 Ga0070694_101611262 3300005444 Unclassified 551
101 Ga0070678_100149996 3300005456 Bacteria 1877
102 Ga0070678_100455420 3300005456 Bacteria 1121
103 Ga0070678_101014318 3300005456 Unclassified 763
104 Ga0070678_101270166 3300005456 Unclassified 684
105 Ga0070662_100322733 3300005457 Bacteria 1259
106 Ga0070662_100324036 3300005457 Bacteria 1257
107 Ga0070662_101341868 3300005457 Unclassified 616
108 Ga0070681_10000991 3300005458 Bacteria 24026
109 Ga0070681_10423614 3300005458 Unclassified 1243
110 Ga0070681_10853694 3300005458 Bacteria 828
111 Ga0068867_100066515 3300005459 Bacteria 2685
112 Ga0068867_100073141 3300005459 Bacteria 2567
113 Ga0068867_100744743 3300005459 Unclassified 869
114 Ga0068867_100820138 3300005459 Unclassified 831
115 Ga0068867_102046813 3300005459 Bacteria 542
116 Ga0070685_11045598 3300005466 Bacteria 615
117 Ga0070685_11368434 3300005466 Unclassified 542
118 Ga0070685_11487635 3300005466 Unclassified 521
119 Ga0070706_101078158 3300005467 Unclassified 740
120 Ga0070698_100023005 3300005471 Bacteria 6515
121 Ga0070698_100055758 3300005471 Bacteria 4005
122 Ga0070698_100163904 3300005471 Bacteria 2166
123 Ga0070699_100134945 3300005518 Bacteria 2177
124 Ga0070699_100143823 3300005518 Bacteria 2107
125 Ga0070699_100149914 3300005518 Bacteria 2062
126 Ga0070699_101406344 3300005518 Unclassified 640
127 Ga0070699_101561176 3300005518 Bacteria 605
128 Ga0070679_100000013 3300005530 Bacteria 151602
129 Ga0070684_100591590 3300005535 Unclassified 1031
130 Ga0070684_100809271 3300005535 Bacteria 876
131 Ga0070697_100117280 3300005536 Bacteria 2224
132 Ga0068853_100049732 3300005539 Bacteria 3603
133 Ga0068853_101130323 3300005539 Unclassified 756
134 Ga0068853_101159322 3300005539 Bacteria 746
135 Ga0070672_100134866 3300005543 Bacteria 2032
136 Ga0070672_100768701 3300005543 Bacteria 846
137 Ga0070672_101334213 3300005543 Unclassified 641
138 Ga0070695_100105551 3300005545 Bacteria 1904
139 Ga0070695_100112061 3300005545 Bacteria 1853
140 Ga0070695_100121164 3300005545 Bacteria 1790
141 Ga0070695_100375184 3300005545 Bacteria 1072
142 Ga0070695_100456696 3300005545 Bacteria 980
143 Ga0070695_100564496 3300005545 Unclassified 889
144 Ga0070695_100634027 3300005545 Unclassified 842
145 Ga0070695_100755474 3300005545 Bacteria 776
146 Ga0070695_100803046 3300005545 Unclassified 754
147 Ga0070695_100815664 3300005545 Bacteria 748
148 Ga0070695_100991293 3300005545 Bacteria 683
149 Ga0070696_100133352 3300005546 Unclassified 1809
150 Ga0070696_100188452 3300005546 Bacteria 1534
151 Ga0070696_100366015 3300005546 Bacteria 1120
152 Ga0070696_100924362 3300005546 Bacteria 725
153 Ga0070693_100023856 3300005547 Bacteria 3274
154 Ga0070693_100040790 3300005547 Unclassified 2608
155 Ga0070693_100530130 3300005547 Bacteria 840
156 Ga0070693_100651840 3300005547 Bacteria 766
157 Ga0070693_100936046 3300005547 Unclassified 651
158 Ga0070665_100221993 3300005548 Unclassified 1890
159 Ga0070665_100826650 3300005548 Bacteria 939
160 Ga0070704_100867722 3300005549 Unclassified 810
161 Ga0070704_100911305 3300005549 Bacteria 791
162 Ga0070704_101148240 3300005549 Unclassified 707
163 Ga0070704_101366743 3300005549 Bacteria 649
164 Ga0068855_100215600 3300005563 Bacteria 2155
165 Ga0068855_101918386 3300005563 Bacteria 600
166 Ga0070664_100002701 3300005564 Bacteria 14318
167 Ga0070664_100068563 3300005564 Bacteria 3033
168 Ga0070664_100076952 3300005564 Bacteria 2868
169 Ga0070664_100257004 3300005564 Bacteria 1571
170 Ga0070664_100937059 3300005564 Bacteria 813
171 Ga0070664_102090737 3300005564 Bacteria 537
172 Ga0068857_100416650 3300005577 Bacteria 1252
173 Ga0068857_100591864 3300005577 Bacteria 1048
174 Ga0068857_101155390 3300005577 Unclassified 749
175 Ga0068857_101516836 3300005577 Bacteria 653
176 Ga0068857_101627654 3300005577 Unclassified 631
177 Ga0068854_100235793 3300005578 Bacteria 1454
178 Ga0068854_100291311 3300005578 Unclassified 1317
179 Ga0068854_100299801 3300005578 Bacteria 1300
180 Ga0068854_100378302 3300005578 Bacteria 1166
181 Ga0068854_100386687 3300005578 Bacteria 1154
182 Ga0068854_100406728 3300005578 Bacteria 1127
183 Ga0068854_101887887 3300005578 Unclassified 549
184 Ga0068856_100013983 3300005614 Bacteria 7760
185 Ga0068856_101891108 3300005614 Bacteria 608
186 Ga0070702_100003608 3300005615 Bacteria 6953
187 Ga0070702_100030660 3300005615 Bacteria 2933
188 Ga0070702_100085976 3300005615 Bacteria 1896
189 Ga0068852_100322626 3300005616 Bacteria 1500
190 Ga0068852_100723987 3300005616 Bacteria 1006
191 Ga0068852_102402042 3300005616 Bacteria 548
192 Ga0068859_100009958 3300005617 Bacteria 9589
193 Ga0068859_100019709 3300005617 Bacteria 6774
194 Ga0068859_100026874 3300005617 Bacteria 5773
195 Ga0068859_100028873 3300005617 Bacteria 5563
196 Ga0068859_100042207 3300005617 Bacteria 4581
197 Ga0068859_100080936 3300005617 Bacteria 3289
198 Ga0068859_100081593 3300005617 Bacteria 3276
199 Ga0068859_100149122 3300005617 Bacteria 2415
200 Ga0068859_100192051 3300005617 Bacteria 2126
201 Ga0068859_100325129 3300005617 Bacteria 1632
202 Ga0068859_100401272 3300005617 Bacteria 1467
203 Ga0068859_100475396 3300005617 Bacteria 1345
204 Ga0068859_100708882 3300005617 Bacteria 1097
205 Ga0068859_100777296 3300005617 Bacteria 1046
206 Ga0068859_100781931 3300005617 Bacteria 1043
207 Ga0068859_101170021 3300005617 Unclassified 847
208 Ga0068859_101221256 3300005617 Bacteria 828
209 Ga0068859_102342886 3300005617 Bacteria 589
210 Ga0068859_102702454 3300005617 Unclassified 545
211 Ga0068864_100022549 3300005618 Bacteria 5279
212 Ga0068864_100060141 3300005618 Bacteria 3289
213 Ga0068864_100092538 3300005618 Bacteria 2669
214 Ga0068864_100126635 3300005618 Bacteria 2289
215 Ga0068864_100318142 3300005618 Bacteria 1461
216 Ga0068864_100379631 3300005618 Bacteria 1339
217 Ga0068864_100417067 3300005618 Unclassified 1278
218 Ga0068864_100771199 3300005618 Bacteria 943
219 Ga0068864_101644468 3300005618 Unclassified 646
220 Ga0068861_100134453 3300005719 Bacteria 2011
221 Ga0068861_100352798 3300005719 Bacteria 1291
222 Ga0068861_101639351 3300005719 Bacteria 635
223 Ga0068851_10006676 3300005834 Bacteria 5279
224 Ga0068851_11106568 3300005834 Bacteria 503
225 Ga0068870_10040527 3300005840 Bacteria 2415
226 Ga0068870_10434466 3300005840 Unclassified 862
227 Ga0068870_11128924 3300005840 Bacteria 565
228 Ga0068863_100052965 3300005841 Bacteria 3845
229 Ga0068863_100245410 3300005841 Bacteria 1729
230 Ga0068863_100498074 3300005841 Bacteria 1199
231 Ga0068863_100770161 3300005841 Unclassified 959
232 Ga0068863_101330455 3300005841 Unclassified 726
233 Ga0068863_101489473 3300005841 Bacteria 685
234 Ga0068863_101572665 3300005841 Unclassified 666
235 Ga0068858_100028291 3300005842 Bacteria 5208
236 Ga0068858_100044248 3300005842 Bacteria 4127
237 Ga0068858_100102785 3300005842 Unclassified 2666
238 Ga0068858_100149786 3300005842 Bacteria 2193
239 Ga0068858_100547064 3300005842 Bacteria 1121
240 Ga0068858_101132583 3300005842 Bacteria 768
241 Ga0068858_101611012 3300005842 Unclassified 641
242 Ga0068858_101748545 3300005842 Bacteria 614
243 Ga0068858_101879451 3300005842 Bacteria 592
244 Ga0068860_100020977 3300005843 Bacteria 6331
245 Ga0068860_100087101 3300005843 Bacteria 2973
246 Ga0068860_100088241 3300005843 Bacteria 2952
247 Ga0068860_100164572 3300005843 Unclassified 2140
248 Ga0068860_100282271 3300005843 Bacteria 1623
249 Ga0068860_100332398 3300005843 Bacteria 1493
250 Ga0068860_100354312 3300005843 Bacteria 1445
251 Ga0068860_100599842 3300005843 Bacteria 1106
252 Ga0068860_100624790 3300005843 Bacteria 1084
253 Ga0068860_100751988 3300005843 Unclassified 986
254 Ga0068860_100925888 3300005843 Bacteria 888
255 Ga0068860_101817054 3300005843 Unclassified 631
256 Ga0068860_102180676 3300005843 Bacteria 575
257 Ga0068862_100156998 3300005844 Bacteria 2028
258 Ga0068862_100368697 3300005844 Bacteria 1336
259 Ga0068862_100500649 3300005844 Bacteria 1153
260 Ga0068862_102147333 3300005844 Unclassified 570
261 Ga0068862_102223054 3300005844 Unclassified 560
262 Ga0081455_10661299 3300005937 Unclassified 671
263 Ga0081539_10001529 3300005985 Bacteria 38746
264 Ga0081539_10018864 3300005985 Bacteria 4754
265 Ga0081539_10023034 3300005985 Bacteria 4093
266 Ga0070717_10060878 3300006028 Bacteria 3127
267 Ga0075432_10066376 3300006058 Bacteria 1291
268 Ga0070716_100102406 3300006173 Bacteria 1758
269 Ga0097621_100005230 3300006237 Bacteria 9125
270 Ga0097621_100010737 3300006237 Bacteria 6716
271 Ga0097621_100793567 3300006237 Bacteria 877
272 Ga0097621_101332412 3300006237 Unclassified 678
273 Ga0068871_100019181 3300006358 Bacteria 5219
274 Ga0068871_100084213 3300006358 Bacteria 2639
275 Ga0068871_100118051 3300006358 Bacteria 2238
276 Ga0068871_100334977 3300006358 Bacteria 1335
277 Ga0068871_101759369 3300006358 Bacteria 588
278 Ga0075428_100368560 3300006844 Unclassified 1540
279 Ga0075430_101169190 3300006846 Unclassified 633
280 Ga0075431_100017885 3300006847 Bacteria 7210
281 Ga0075431_100576768 3300006847 Bacteria 1111
282 Ga0075433_10309020 3300006852 Bacteria 1399
283 Ga0075433_10318677 3300006852 Bacteria 1376
284 Ga0075433_10351323 3300006852 Unclassified 1303
285 Ga0075433_10497207 3300006852 Bacteria 1073
286 Ga0075433_11252696 3300006852 Bacteria 643
287 Ga0075433_11544243 3300006852 Unclassified 573
288 Ga0075433_11685206 3300006852 Unclassified 546
289 Ga0075434_100047496 3300006871 Bacteria 4260
290 Ga0075434_100783307 3300006871 Unclassified 970
291 Ga0075434_101308394 3300006871 Unclassified 736
292 Ga0075434_102106099 3300006871 Bacteria 569
293 Ga0068865_100361729 3300006881 Bacteria 1178
294 Ga0075436_100003351 3300006914 Bacteria 10967
295 Ga0075436_100136207 3300006914 Bacteria 1724
296 Ga0097620_100009957 3300006931 Bacteria 9589
297 Ga0097620_100019709 3300006931 Bacteria 6774
298 Ga0097620_100026873 3300006931 Bacteria 5773
299 Ga0097620_100028871 3300006931 Bacteria 5563
300 Ga0097620_100042208 3300006931 Bacteria 4581
301 Ga0097620_100080935 3300006931 Bacteria 3289
302 Ga0097620_100081598 3300006931 Bacteria 3276
303 Ga0097620_100149115 3300006931 Bacteria 2415
304 Ga0097620_100192037 3300006931 Bacteria 2126
305 Ga0097620_100263737 3300006931 Bacteria 1814
306 Ga0097620_100325133 3300006931 Bacteria 1632
307 Ga0097620_100401271 3300006931 Bacteria 1467
308 Ga0097620_100475384 3300006931 Bacteria 1345
309 Ga0097620_100708927 3300006931 Bacteria 1097
310 Ga0097620_100777327 3300006931 Bacteria 1046
311 Ga0097620_100781975 3300006931 Bacteria 1043
312 Ga0097620_101170104 3300006931 Unclassified 847
313 Ga0097620_101221395 3300006931 Bacteria 828
314 Ga0097620_101651777 3300006931 Bacteria 708
315 Ga0097620_102342994 3300006931 Bacteria 589
316 Ga0097620_102703653 3300006931 Unclassified 545
317 Ga0075435_100417197 3300007076 Bacteria 1156
318 Ga0075435_100804592 3300007076 Bacteria 818
319 Ga0099794_10585719 3300007265 Unclassified 590
320 Ga0105251_10265794 3300009011 Unclassified 774
321 Ga0105250_10230248 3300009092 Bacteria 788
322 Ga0105240_10037272 3300009093 Bacteria 6250
323 Ga0105240_10383143 3300009093 Bacteria 1588
324 Ga0105240_11346565 3300009093 Bacteria 752
325 Ga0111539_13171096 3300009094 Unclassified 530
326 Ga0105245_10085168 3300009098 Bacteria 2897
327 Ga0105245_10156618 3300009098 Bacteria 2158
328 Ga0105245_13225178 3300009098 Bacteria 505
329 Ga0105247_10001923 3300009101 Bacteria 14491
330 Ga0105247_10037992 3300009101 Bacteria 2937
331 Ga0105247_10358209 3300009101 Bacteria 1028
332 Ga0105247_10440220 3300009101 Bacteria 937
333 Ga0105247_10921846 3300009101 Bacteria 676
334 Ga0114129_10019995 3300009147 Bacteria 9530
335 Ga0114129_10139726 3300009147 Bacteria 3321
336 Ga0114129_10369719 3300009147 Bacteria 1895
337 Ga0105243_10002285 3300009148 Bacteria 16071
338 Ga0105243_10218649 3300009148 Bacteria 1682
339 Ga0105243_10260883 3300009148 Bacteria 1551
340 Ga0105243_10286125 3300009148 Unclassified 1487
341 Ga0105243_10323134 3300009148 Bacteria 1407
342 Ga0105243_10599510 3300009148 Unclassified 1060
343 Ga0105243_10968428 3300009148 Bacteria 851
344 Ga0105243_11698407 3300009148 Bacteria 660
345 Ga0105243_12313503 3300009148 Bacteria 575
346 Ga0105241_10040081 3300009174 Bacteria 3535
347 Ga0105241_10087024 3300009174 Unclassified 2458
348 Ga0105241_10272669 3300009174 Bacteria 1442
349 Ga0105241_10506313 3300009174 Bacteria 1077
350 Ga0105241_10659168 3300009174 Unclassified 951
351 Ga0105241_10688312 3300009174 Bacteria 932
352 Ga0105241_10752533 3300009174 Bacteria 894
353 Ga0105241_10899502 3300009174 Bacteria 822
354 Ga0105242_10026361 3300009176 Bacteria 4607
355 Ga0105242_10051934 3300009176 Bacteria 3343
356 Ga0105242_10076666 3300009176 Bacteria 2788
357 Ga0105242_11417846 3300009176 Unclassified 723
358 Ga0105242_11927549 3300009176 Bacteria 632
359 Ga0105242_13252507 3300009176 Bacteria 505
360 Ga0105248_10026990 3300009177 Bacteria 6387
361 Ga0105248_10034742 3300009177 Bacteria 5641
362 Ga0105248_10146331 3300009177 Unclassified 2666
363 Ga0105248_10515540 3300009177 Bacteria 1348
364 Ga0105248_10631012 3300009177 Bacteria 1209
365 Ga0105248_10962195 3300009177 Bacteria 964
366 Ga0105248_11813429 3300009177 Unclassified 692
367 Ga0105237_10000843 3300009545 Bacteria 41798
368 Ga0105237_10073895 3300009545 Bacteria 3401
369 Ga0105237_10220049 3300009545 Bacteria 1899
370 Ga0105237_10232336 3300009545 Unclassified 1845
371 Ga0105237_10864283 3300009545 Bacteria 911
372 Ga0105237_11811437 3300009545 Unclassified 618
373 Ga0105238_10729020 3300009551 Bacteria 1004
374 Ga0105249_10000844 3300009553 Bacteria 27423
375 Ga0105249_10057038 3300009553 Bacteria 3577
376 Ga0105249_11697980 3300009553 Bacteria 704
377 Ga0105028_132815 3300009993 Bacteria 580
378 Ga0105239_10040324 3300010375 Bacteria 5116
379 Ga0105239_10124425 3300010375 Bacteria 2865
380 Ga0105239_10361483 3300010375 Bacteria 1639
381 Ga0105239_10613750 3300010375 Bacteria 1241
382 Ga0105239_11056151 3300010375 Bacteria 934
383 Ga0105239_12136692 3300010375 Bacteria 651
384 Ga0105239_13315283 3300010375 Bacteria 524
385 Ga0105239_13495174 3300010375 Bacteria 511
386 Ga0105246_10140069 3300011119 Bacteria 1818
387 Ga0105246_10683299 3300011119 Bacteria 897
388 Ga0157373_10008162 3300013100 Bacteria 7783
389 Ga0157373_10252328 3300013100 Unclassified 1248
390 Ga0157373_10768143 3300013100 Bacteria 709
391 Ga0157371_11023399 3300013102 Bacteria 631
392 Ga0157370_10461932 3300013104 Bacteria 1167
393 Ga0157369_12227615 3300013105 Bacteria 556
394 Ga0157374_10143519 3300013296 Bacteria 2318
395 Ga0157374_10181828 3300013296 Unclassified 2054
396 Ga0157374_12806994 3300013296 Unclassified 515
397 Ga0157378_10020058 3300013297 Bacteria 5879
398 Ga0157378_10072303 3300013297 Bacteria 3099
399 Ga0157378_11494478 3300013297 Unclassified 720
400 Ga0157378_12281046 3300013297 Unclassified 593
401 Ga0157378_12464924 3300013297 Unclassified 572
402 Ga0163162_10104365 3300013306 Bacteria 2929
403 Ga0163162_10124702 3300013306 Bacteria 2681
404 Ga0163162_11019474 3300013306 Bacteria 936
405 Ga0163162_11155597 3300013306 Bacteria 878
406 Ga0163162_11707051 3300013306 Unclassified 719
407 Ga0163162_11897217 3300013306 Unclassified 682
408 Ga0157372_10059033 3300013307 Unclassified 4290
409 Ga0157372_10095033 3300013307 Bacteria 3395
410 Ga0157372_10161943 3300013307 Bacteria 2586
411 Ga0157372_10446411 3300013307 Unclassified 1507
412 Ga0157372_11347163 3300013307 Bacteria 823
413 Ga0157372_12521484 3300013307 Unclassified 590
414 Ga0157372_13461304 3300013307 Unclassified 502
415 Ga0157375_10612524 3300013308 Bacteria 1247
416 Ga0157375_10786396 3300013308 Bacteria 1101
417 Ga0157375_10999971 3300013308 Bacteria 976
418 Ga0157375_11257156 3300013308 Bacteria 869
419 Ga0157375_11366127 3300013308 Unclassified 834
420 Ga0157375_11413750 3300013308 Unclassified 820
421 Ga0157375_12002280 3300013308 Bacteria 688
422 Ga0157375_13080871 3300013308 Unclassified 556
423 Ga0163163_10000209 3300014325 Bacteria 60592
424 Ga0163163_10033706 3300014325 Bacteria 4956
425 Ga0163163_10048137 3300014325 Bacteria 4191
426 Ga0163163_10130171 3300014325 Bacteria 2556
427 Ga0163163_10196493 3300014325 Bacteria 2065
428 Ga0163163_10489003 3300014325 Bacteria 1292
429 Ga0163163_10601365 3300014325 Bacteria 1163
430 Ga0163163_11250916 3300014325 Bacteria 805
431 Ga0163163_11273680 3300014325 Bacteria 797
432 Ga0163163_11521231 3300014325 Bacteria 730
433 Ga0157380_10023612 3300014326 Bacteria 4641
434 Ga0157380_10917619 3300014326 Bacteria 903
435 Ga0157380_11226413 3300014326 Unclassified 795
436 Ga0157377_10068663 3300014745 Bacteria 2043
437 Ga0157377_10184285 3300014745 Bacteria 1315
438 Ga0157379_10046382 3300014968 Bacteria 3876
439 Ga0157379_11094881 3300014968 Unclassified 763
440 Ga0157379_11396575 3300014968 Unclassified 679
441 Ga0157376_10053379 3300014969 Bacteria 3365
442 Ga0157376_10061364 3300014969 Bacteria 3160
443 Ga0157376_11292906 3300014969 Unclassified 759
444 Ga0182005_1105963 3300015265 Bacteria 791
445 Ga0213876_10029832 3300021384 Bacteria 2874
446 Ga0207710_10133110 3300025900 Bacteria 1195
447 Ga0207710_10336889 3300025900 Unclassified 767
448 Ga0207645_11208528 3300025907 Unclassified 507
449 Ga0207705_11188443 3300025909 Bacteria 585
450 Ga0207649_10991264 3300025920 Bacteria 661
451 Ga0207681_10074937 3300025923 Bacteria 2372
452 Ga0207659_10376619 3300025926 Unclassified 1183
453 Ga0207687_10050764 3300025927 Bacteria 2888
454 Ga0207687_10618050 3300025927 Unclassified 914
455 Ga0207664_10056776 3300025929 Bacteria 3110
456 Ga0207644_10423959 3300025931 Bacteria 1090
457 Ga0207690_10381042 3300025932 Unclassified 1121
458 Ga0207686_10875845 3300025934 Unclassified 723
459 Ga0207691_10807893 3300025940 Bacteria 788
460 Ga0207667_10901222 3300025949 Bacteria 876
461 Ga0207640_10281813 3300025981 Bacteria 1306
462 Ga0207641_12072267 3300026088 Unclassified 570
463 Ga0207674_10331605 3300026116 Bacteria 1471
464 Ga0207698_11352702 3300026142 Unclassified 727
465 Ga0307408_100258587 3300031548 Unclassified 1440
466 Ga0307406_10138977 3300031901 Unclassified 1717
467 Ga0307416_100922050 3300032002 Unclassified 974
468 Ga0373955_0656474 3300035172 Bacteria 643
469 Ga0373935_0325771 3300035692 Unclassified 1091
470 Ga0373927_0293946 3300035695 Bacteria 1069
471 Ga0373925_0336855 3300037068 Bacteria 1223
472 Ga0395900_1037498 3300037418 Bacteria 739
473 Ga0436365_1506872 3300039437 Bacteria 1352
474 Ga0466965_0433881 3300044683 Bacteria 730
475 Ga0466960_0668093 3300044901 Bacteria 621
476 Ga0495651_0170972 3300046462 Bacteria 1548
477 Ga0495639_0616939 3300046475 Bacteria 558
478 Ga0495662_0393086 3300046476 Bacteria 681
479 Ga0495664_0637047 3300046477 Unclassified 632
480 Ga0495594_0331956 3300046499 Unclassified 866
481 Ga0495618_0147977 3300046514 Bacteria 1501
482 Ga0495628_0083443 3300046516 Bacteria 2481
483 Ga0495630_0076700 3300046517 Bacteria 2519
484 Ga0495652_0016363 3300046529 Bacteria 6635
485 Ga0495587_0430776 3300046536 Bacteria 731
486 Ga0495645_0237269 3300046543 Bacteria 1218
487 Ga0495667_0109126 3300046559 Bacteria 1788
488 Ga0495634_0089696 3300046642 Bacteria 1998
489 Ga0495635_0059217 3300046663 Bacteria 2634
490 Ga0495599_0020698 3300046678 Bacteria 4099
491 Ga0495646_0164567 3300046680 Bacteria 1226
492 Ga0495624_0165224 3300046690 Bacteria 1351
493 Ga0495624_0562628 3300046690 Bacteria 681
494 Ga0495604_0208564 3300047317 Bacteria 1351
495 Ga0495674_0027641 3300047319 Bacteria 5182
496 Ga0495672_0044647 3300047320 Bacteria 2657
497 Ga0495680_0018770 3300047322 Bacteria 5861
498 Ga0495675_0045457 3300047444 Bacteria 2796
499 Ga0495684_0011363 3300047471 Bacteria 6875
500 Ga0495602_0113754 3300048088 Bacteria 2193
501 Ga0496109_1195622 3300048912 Unclassified 697
502 Ga0501292_025747 3300049515 Bacteria 970
503 Ga0501047_0648478 3300049581 Bacteria 875
504 Ga0501068_0937992 3300049584 Unclassified 570
505 Ga0501235_111712 3300049669 Bacteria 676
506 Ga0501044_0663353 3300049823 Bacteria 931
507 nmdc:mga09592_684152_c1 3300050508 Bacteria 874
508 nmdc:mga0n895_2036920_c1 3300050512 Bacteria 531
509 nmdc:mga0a205_1530410_c1 3300050515 Unclassified 515
510 Ga0495619_1127459 3300053085 Bacteria 521
511 Ga0070669_100025253
512 CNBas_1011538
513 JGI24751J29686_10000003
514 JGI25406J46586_10024675
515 rootL2_10229967
516 Ga0065712_10003967
517 Ga0065712_10067727
518 Ga0065712_10402147
519 Ga0065712_10646269
520 Ga0065715_10000520
521 Ga0065715_10009366
522 Ga0065715_10122425
523 Ga0065715_10156707
524 Ga0065715_10306332
525 Ga0065715_10708554
526 Ga0065715_10713573
527 Ga0065715_10837102
528 Ga0065715_11022956
529 Ga0065707_10195297
530 Ga0065707_10247777
531 Ga0070676_10215496
532 Ga0070676_10545173
533 Ga0070676_11380804
534 Ga0070690_100110532
535 Ga0070690_100361328
536 Ga0070690_100400596
537 Ga0070690_101099461
538 Ga0070670_100000190
539 Ga0070670_100240228
540 Ga0070670_100654348
541 Ga0068869_100071495
542 Ga0068869_100071519
543 Ga0068869_100092888
544 Ga0068869_100122663
545 Ga0068869_100489372
546 Ga0070666_10299523
547 Ga0070666_10691091
548 Ga0070666_11363976
549 Ga0070680_100038169
550 Ga0070680_100113237
551 Ga0070682_101359299
552 Ga0068868_100137175
553 Ga0068868_100544800
554 Ga0070660_101812952
555 Ga0070689_100011690
556 Ga0070689_100178337
557 Ga0070689_100733744
558 Ga0070687_100073489
559 Ga0070687_100151719
560 Ga0070661_100270053
561 Ga0070661_100507482
562 Ga0070692_10024854
563 Ga0070692_10153730
564 Ga0070692_10272707
565 Ga0070692_11194801
566 Ga0070668_100548095
567 Ga0070669_101347161
568 Ga0070675_100513037
569 Ga0070675_101348144
570 Ga0070671_100006739
571 Ga0070671_100112951
572 Ga0070671_100160653
573 Ga0070671_100360113
574 Ga0070674_100287009
575 Ga0070674_100582347
576 Ga0070673_100103119
577 Ga0070673_100143655
578 Ga0070673_101026098
579 Ga0070673_101085096
580 Ga0070673_101384824
581 Ga0070688_100120796
582 Ga0070688_100325740
583 Ga0070688_100669032
584 Ga0070688_100758015
585 Ga0070659_100040156
586 Ga0070659_100576230
587 Ga0070659_101100089
588 Ga0070659_102069116
589 Ga0070667_100125885
590 Ga0070703_10242751
591 Ga0070701_10025364
592 Ga0070701_10265670
593 Ga0070701_10275955
594 Ga0070701_10416249
595 Ga0070705_100018895
596 Ga0070705_100153553
597 Ga0070705_100341879
598 Ga0070705_100672976
599 Ga0070705_101401922
600 Ga0070705_101564226
601 Ga0070700_100171176
602 Ga0070700_100217881
603 Ga0070700_100314719
604 Ga0070694_100052705
605 Ga0070694_100053848
606 Ga0070694_100165943
607 Ga0070694_100712349
608 Ga0070694_101504331
609 Ga0070694_101534476
610 Ga0070694_101611262
611 Ga0070678_100149996
612 Ga0070678_100455420
613 Ga0070678_101014318
614 Ga0070678_101270166
615 Ga0070662_100322733
616 Ga0070662_100324036
617 Ga0070662_101341868
618 Ga0070681_10000991
619 Ga0070681_10423614
620 Ga0070681_10853694
621 Ga0068867_100066515
622 Ga0068867_100073141
623 Ga0068867_100744743
624 Ga0068867_100820138
625 Ga0068867_102046813
626 Ga0070685_11045598
627 Ga0070685_11368434
628 Ga0070685_11487635
629 Ga0070706_101078158
630 Ga0070698_100023005
631 Ga0070698_100055758
632 Ga0070698_100163904
633 Ga0070699_100134945
634 Ga0070699_100143823
635 Ga0070699_100149914
636 Ga0070699_101406344
637 Ga0070699_101561176
638 Ga0070679_100000013
639 Ga0070684_100591590
640 Ga0070684_100809271
641 Ga0070697_100117280
642 Ga0068853_100049732
643 Ga0068853_101130323
644 Ga0068853_101159322
645 Ga0070672_100134866
646 Ga0070672_100768701
647 Ga0070672_101334213
648 Ga0070695_100105551
649 Ga0070695_100112061
650 Ga0070695_100121164
651 Ga0070695_100375184
652 Ga0070695_100456696
653 Ga0070695_100564496
654 Ga0070695_100634027
655 Ga0070695_100755474
656 Ga0070695_100803046
657 Ga0070695_100815664
658 Ga0070695_100991293
659 Ga0070696_100133352
660 Ga0070696_100188452
661 Ga0070696_100366015
662 Ga0070696_100924362
663 Ga0070693_100023856
664 Ga0070693_100040790
665 Ga0070693_100530130
666 Ga0070693_100651840
667 Ga0070693_100936046
668 Ga0070665_100221993
669 Ga0070665_100826650
670 Ga0070704_100867722
671 Ga0070704_100911305
672 Ga0070704_101148240
673 Ga0070704_101366743
674 Ga0068855_100215600
675 Ga0068855_101918386
676 Ga0070664_100002701
677 Ga0070664_100068563
678 Ga0070664_100076952
679 Ga0070664_100257004
680 Ga0070664_100937059
681 Ga0070664_102090737
682 Ga0068857_100416650
683 Ga0068857_100591864
684 Ga0068857_101155390
685 Ga0068857_101516836
686 Ga0068857_101627654
687 Ga0068854_100235793
688 Ga0068854_100291311
689 Ga0068854_100299801
690 Ga0068854_100378302
691 Ga0068854_100386687
692 Ga0068854_100406728
693 Ga0068854_101887887
694 Ga0068856_100013983
695 Ga0068856_101891108
696 Ga0070702_100003608
697 Ga0070702_100030660
698 Ga0070702_100085976
699 Ga0068852_100322626
700 Ga0068852_100723987
701 Ga0068852_102402042
702 Ga0068859_100009958
703 Ga0068859_100019709
704 Ga0068859_100026874
705 Ga0068859_100028873
706 Ga0068859_100042207
707 Ga0068859_100080936
708 Ga0068859_100081593
709 Ga0068859_100149122
710 Ga0068859_100192051
711 Ga0068859_100325129
712 Ga0068859_100401272
713 Ga0068859_100475396
714 Ga0068859_100708882
715 Ga0068859_100777296
716 Ga0068859_100781931
717 Ga0068859_101170021
718 Ga0068859_101221256
719 Ga0068859_102342886
720 Ga0068859_102702454
721 Ga0068864_100022549
722 Ga0068864_100060141
723 Ga0068864_100092538
724 Ga0068864_100126635
725 Ga0068864_100318142
726 Ga0068864_100379631
727 Ga0068864_100417067
728 Ga0068864_100771199
729 Ga0068864_101644468
730 Ga0068861_100134453
731 Ga0068861_100352798
732 Ga0068861_101639351
733 Ga0068851_10006676
734 Ga0068851_11106568
735 Ga0068870_10040527
736 Ga0068870_10434466
737 Ga0068870_11128924
738 Ga0068863_100052965
739 Ga0068863_100245410
740 Ga0068863_100498074
741 Ga0068863_100770161
742 Ga0068863_101330455
743 Ga0068863_101489473
744 Ga0068863_101572665
745 Ga0068858_100028291
746 Ga0068858_100044248
747 Ga0068858_100102785
748 Ga0068858_100149786
749 Ga0068858_100547064
750 Ga0068858_101132583
751 Ga0068858_101611012
752 Ga0068858_101748545
753 Ga0068858_101879451
754 Ga0068860_100020977
755 Ga0068860_100087101
756 Ga0068860_100088241
757 Ga0068860_100164572
758 Ga0068860_100282271
759 Ga0068860_100332398
760 Ga0068860_100354312
761 Ga0068860_100599842
762 Ga0068860_100624790
763 Ga0068860_100751988
764 Ga0068860_100925888
765 Ga0068860_101817054
766 Ga0068860_102180676
767 Ga0068862_100156998
768 Ga0068862_100368697
769 Ga0068862_100500649
770 Ga0068862_102147333
771 Ga0068862_102223054
772 Ga0081455_10661299
773 Ga0081539_10001529
774 Ga0081539_10018864
775 Ga0081539_10023034
776 Ga0070717_10060878
777 Ga0075432_10066376
778 Ga0070716_100102406
779 Ga0097621_100005230
780 Ga0097621_100010737
781 Ga0097621_100793567
782 Ga0097621_101332412
783 Ga0068871_100019181
784 Ga0068871_100084213
785 Ga0068871_100118051
786 Ga0068871_100334977
787 Ga0068871_101759369
788 Ga0075428_100368560
789 Ga0075430_101169190
790 Ga0075431_100017885
791 Ga0075431_100576768
792 Ga0075433_10309020
793 Ga0075433_10318677
794 Ga0075433_10351323
795 Ga0075433_10497207
796 Ga0075433_11252696
797 Ga0075433_11544243
798 Ga0075433_11685206
799 Ga0075434_100047496
800 Ga0075434_100783307
801 Ga0075434_101308394
802 Ga0075434_102106099
803 Ga0068865_100361729
804 Ga0075436_100003351
805 Ga0075436_100136207
806 Ga0097620_100009957
807 Ga0097620_100019709
808 Ga0097620_100026873
809 Ga0097620_100028871
810 Ga0097620_100042208
811 Ga0097620_100080935
812 Ga0097620_100081598
813 Ga0097620_100149115
814 Ga0097620_100192037
815 Ga0097620_100263737
816 Ga0097620_100325133
817 Ga0097620_100401271
818 Ga0097620_100475384
819 Ga0097620_100708927
820 Ga0097620_100777327
821 Ga0097620_100781975
822 Ga0097620_101170104
823 Ga0097620_101221395
824 Ga0097620_101651777
825 Ga0097620_102342994
826 Ga0097620_102703653
827 Ga0075435_100417197
828 Ga0075435_100804592
829 Ga0099794_10585719
830 Ga0105251_10265794
831 Ga0105250_10230248
832 Ga0105240_10037272
833 Ga0105240_10383143
834 Ga0105240_11346565
835 Ga0111539_13171096
836 Ga0105245_10085168
837 Ga0105245_10156618
838 Ga0105245_13225178
839 Ga0105247_10001923
840 Ga0105247_10037992
841 Ga0105247_10358209
842 Ga0105247_10440220
843 Ga0105247_10921846
844 Ga0114129_10019995
845 Ga0114129_10139726
846 Ga0114129_10369719
847 Ga0105243_10002285
848 Ga0105243_10218649
849 Ga0105243_10260883
850 Ga0105243_10286125
851 Ga0105243_10323134
852 Ga0105243_10599510
853 Ga0105243_10968428
854 Ga0105243_11698407
855 Ga0105243_12313503
856 Ga0105241_10040081
857 Ga0105241_10087024
858 Ga0105241_10272669
859 Ga0105241_10506313
860 Ga0105241_10659168
861 Ga0105241_10688312
862 Ga0105241_10752533
863 Ga0105241_10899502
864 Ga0105242_10026361
865 Ga0105242_10051934
866 Ga0105242_10076666
867 Ga0105242_11417846
868 Ga0105242_11927549
869 Ga0105242_13252507
870 Ga0105248_10026990
871 Ga0105248_10034742
872 Ga0105248_10146331
873 Ga0105248_10515540
874 Ga0105248_10631012
875 Ga0105248_10962195
876 Ga0105248_11813429
877 Ga0105237_10000843
878 Ga0105237_10073895
879 Ga0105237_10220049
880 Ga0105237_10232336
881 Ga0105237_10864283
882 Ga0105237_11811437
883 Ga0105238_10729020
884 Ga0105249_10000844
885 Ga0105249_10057038
886 Ga0105249_11697980
887 Ga0105028_132815
888 Ga0105239_10040324
889 Ga0105239_10124425
890 Ga0105239_10361483
891 Ga0105239_10613750
892 Ga0105239_11056151
893 Ga0105239_12136692
894 Ga0105239_13315283
895 Ga0105239_13495174
896 Ga0105246_10140069
897 Ga0105246_10683299
898 Ga0157373_10008162
899 Ga0157373_10252328
900 Ga0157373_10768143
901 Ga0157371_11023399
902 Ga0157370_10461932
903 Ga0157369_12227615
904 Ga0157374_10143519
905 Ga0157374_10181828
906 Ga0157374_12806994
907 Ga0157378_10020058
908 Ga0157378_10072303
909 Ga0157378_11494478
910 Ga0157378_12281046
911 Ga0157378_12464924
912 Ga0163162_10104365
913 Ga0163162_10124702
914 Ga0163162_11019474
915 Ga0163162_11155597
916 Ga0163162_11707051
917 Ga0163162_11897217
918 Ga0157372_10059033
919 Ga0157372_10095033
920 Ga0157372_10161943
921 Ga0157372_10446411
922 Ga0157372_11347163
923 Ga0157372_12521484
924 Ga0157372_13461304
925 Ga0157375_10612524
926 Ga0157375_10786396
927 Ga0157375_10999971
928 Ga0157375_11257156
929 Ga0157375_11366127
930 Ga0157375_11413750
931 Ga0157375_12002280
932 Ga0157375_13080871
933 Ga0163163_10000209
934 Ga0163163_10033706
935 Ga0163163_10048137
936 Ga0163163_10130171
937 Ga0163163_10196493
938 Ga0163163_10489003
939 Ga0163163_10601365
940 Ga0163163_11250916
941 Ga0163163_11273680
942 Ga0163163_11521231
943 Ga0157380_10023612
944 Ga0157380_10917619
945 Ga0157380_11226413
946 Ga0157377_10068663
947 Ga0157377_10184285
948 Ga0157379_10046382
949 Ga0157379_11094881
950 Ga0157379_11396575
951 Ga0157376_10053379
952 Ga0157376_10061364
953 Ga0157376_11292906
954 Ga0182005_1105963
955 Ga0213876_10029832
956 Ga0207710_10133110
957 Ga0207710_10336889
958 Ga0207645_11208528
959 Ga0207705_11188443
960 Ga0207649_10991264
961 Ga0207681_10074937
962 Ga0207659_10376619
963 Ga0207687_10050764
964 Ga0207687_10618050
965 Ga0207664_10056776
966 Ga0207644_10423959
967 Ga0207690_10381042
968 Ga0207686_10875845
969 Ga0207691_10807893
970 Ga0207667_10901222
971 Ga0207640_10281813
972 Ga0207641_12072267
973 Ga0207674_10331605
974 Ga0207698_11352702
975 Ga0307408_100258587
976 Ga0307406_10138977
977 Ga0307416_100922050
978 Ga0373955_0656474
979 Ga0373935_0325771
980 Ga0373927_0293946
981 Ga0373925_0336855
982 Ga0395900_1037498
983 Ga0436365_1506872
984 Ga0466965_0433881
985 Ga0466960_0668093
986 Ga0495651_0170972
987 Ga0495639_0616939
988 Ga0495662_0393086
989 Ga0495664_0637047
990 Ga0495594_0331956
991 Ga0495618_0147977
992 Ga0495628_0083443
993 Ga0495630_0076700
994 Ga0495652_0016363
995 Ga0495587_0430776
996 Ga0495645_0237269
997 Ga0495667_0109126
998 Ga0495634_0089696
999 Ga0495635_0059217
1000 Ga0495599_0020698
1001 Ga0495646_0164567
1002 Ga0495624_0165224
1003 Ga0495624_0562628
1004 Ga0495604_0208564
1005 Ga0495674_0027641
1006 Ga0495672_0044647
1007 Ga0495680_0018770
1008 Ga0495675_0045457
1009 Ga0495684_0011363
1010 Ga0495602_0113754
1011 Ga0496109_1195622
1012 Ga0501292_025747
1013 Ga0501047_0648478
1014 Ga0501068_0937992
1015 Ga0501235_111712
1016 Ga0501044_0663353
1017 nmdc:mga09592_684152_c1
1018 nmdc:mga0n895_2036920_c1
1019 nmdc:mga0a205_1530410_c1
1020 Ga0495619_1127459

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13510

Fer2_4

2Fe-2S iron-sulfur cluster binding domain

2

83

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1y56-assembly1.cif.gz_A crystal structure of l-proline dehydrogenase from p.horikoshii 0.8731 3 79
2gah-assembly1.cif.gz_A heterotetrameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution 0.8157 3 80
1vrq-assembly1.cif.gz_A crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. u-96 in complex with folinic acid 0.8011 3 80
5xfa-assembly1.cif.gz_B crystal structure of nad+-reducing [nife]-hydrogenase in the h2-reduced state 0.7992 5 82
7arb-assembly1.cif.gz_G cryo-em structure of arabidopsis thaliana complex-i (complete composition) 0.7903 3 82
ID Description Score Start End Superfamily
1y56A01 Alpha Beta;Roll;Ubiquitin-like (UB roll);2Fe-2S iron-sulphur cluster binding domain, sarcosine oxidase, alpha subunit, N-terminal domain 0.8731 3 79 3.10.20.440
af_A4HT20_2_80_3.10.120.10 Alpha Beta;Roll;Flavocytochrome B2; Chain A, domain 1;Cytochrome b5-like heme/steroid binding domain 0.8698 2 17 3.10.120.10
af_P9WIV9_16_140_3.10.20.740 Alpha Beta;Roll;Ubiquitin-like (UB roll); 0.8059 5 80 3.10.20.740
af_I1LMA5_75_197_3.10.20.740 Alpha Beta;Roll;Ubiquitin-like (UB roll); 0.8046 5 82 3.10.20.740
af_A4I6P3_2_81_3.10.120.10 Alpha Beta;Roll;Flavocytochrome B2; Chain A, domain 1;Cytochrome b5-like heme/steroid binding domain 0.7961 3 17 3.10.120.10
ID Description Score Start End GO Terms
AF-A0A831X183-F1-model_v4 (2Fe-2S)-binding protein 0.9968 5 82 GO:0016491
GO:0051536
AF-A0A098UGD7-F1-model_v4 deleted 0.9897 5 82
AF-A0A6L6Q4Y3-F1-model_v4 (2Fe-2S)-binding protein 0.9886 6 80 GO:0016491
GO:0051536
AF-A0A420A1I3-F1-model_v4 2Fe-2S iron-sulfur cluster protein 0.9876 4 80 GO:0016491
GO:0051536
AF-A0A7Z1KXU6-F1-model_v4 deleted 0.9871 4 81

Map