F457052

General Info

Members Datasets Scaffolds Average Seq Length
509 219 1018 354

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_84048_c1|nmdc:mga0n895_84048_c1_260_1441
Length 393
Sequence MVYSQIRLSKGVRRVQDFGSRGAAQRSTSRMVKGALVVLGVTAIVASRAFVSEPRAQAQYPIEIVKPGKGPFTFPPGYQTPWDKIEIMVTAKMSPNLFVLHGSEGLDPAHPDASGGRAMALFGPDGVLLVDTENRQVADKTLKTIRSFTDAPIKVLVNTHIHPDHTGANAFFAAQGALIFAQENLRIEMLHPPMRPNGEPAPAPEMAGVPVVTYKYNPKTPGEAAVTFEMNGETVDFIPMMPSHTAGDTIVRFRKANVIYIEDFYRNFGYPFADQTNGGSVNGMLDAIDLIDKLASAETLLIPGHGTLVRKTDLVPYRNMLVDVLAKVKALRDQGKSLKDVLAANLTAPYDKTTLGDTQQSKDRFITEVYDEVRDFPPVIDGKRTMPRHTTND

Samples

Sample ID Description Type Environment
1 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
98 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
144 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
145 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
146 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
147 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
148 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
149 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
150 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
151 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
152 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
153 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
154 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
155 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
156 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
157 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
158 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
159 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
160 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
161 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
162 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
166 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
169 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
170 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
171 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
172 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
173 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
174 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
175 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
176 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
177 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
178 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
179 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
180 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
181 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
182 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
183 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
184 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
185 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
186 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
187 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
188 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
189 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
190 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
215 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
218 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
219 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.14
Rhizosphere 96.46
Stem 0
Stem Tuber 0
Unclassified 29.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0n895_84048_c1 3300050512 Bacteria 3176
2 JGI25406J46586_10000278 3300003203 Bacteria 22807
3 JGI25406J46586_10000490 3300003203 Bacteria 18508
4 Ga0058862_10039671 3300004803 Bacteria 1570
5 Ga0065704_10082455 3300005289 Unclassified 3598
6 Ga0065712_10078189 3300005290 Bacteria 3382
7 Ga0065712_10137577 3300005290 Bacteria 1482
8 Ga0065715_10017877 3300005293 Bacteria 2088
9 Ga0065715_10120139 3300005293 Bacteria 2266
10 Ga0065707_10094663 3300005295 Unclassified 3469
11 Ga0070683_100050162 3300005329 Bacteria 3862
12 Ga0070690_100111568 3300005330 Unclassified 1825
13 Ga0070670_100002940 3300005331 Bacteria 14107
14 Ga0070670_100011809 3300005331 Bacteria 7467
15 Ga0070670_100023483 3300005331 Bacteria 5308
16 Ga0070670_100024109 3300005331 Bacteria 5234
17 Ga0070670_100097397 3300005331 Bacteria 2530
18 Ga0070670_100191516 3300005331 Bacteria 1776
19 Ga0070677_10006345 3300005333 Unclassified 3925
20 Ga0070677_10044739 3300005333 Bacteria 1763
21 Ga0070677_10055293 3300005333 Bacteria 1620
22 Ga0068869_100009089 3300005334 Bacteria 6439
23 Ga0068869_100141409 3300005334 Unclassified 1858
24 Ga0070666_10026478 3300005335 Unclassified 3790
25 Ga0070666_10057620 3300005335 Bacteria 2625
26 Ga0070666_10218278 3300005335 Unclassified 1344
27 Ga0068868_100019102 3300005338 Bacteria 5133
28 Ga0070689_100010826 3300005340 Bacteria 6519
29 Ga0070689_100014276 3300005340 Bacteria 5767
30 Ga0070687_100018793 3300005343 Unclassified 3204
31 Ga0070687_100038261 3300005343 Bacteria 2403
32 Ga0070687_100095149 3300005343 Bacteria 1656
33 Ga0070661_100007242 3300005344 Bacteria 7650
34 Ga0070661_100031551 3300005344 Bacteria 3833
35 Ga0070661_100084291 3300005344 Bacteria 2348
36 Ga0070661_100124505 3300005344 Bacteria 1933
37 Ga0070692_10032349 3300005345 Unclassified 2629
38 Ga0070669_100001432 3300005353 Bacteria 17255
39 Ga0070669_100069318 3300005353 Unclassified 2604
40 Ga0070669_100083458 3300005353 Unclassified 2383
41 Ga0070675_100009983 3300005354 Bacteria 7402
42 Ga0070675_100025066 3300005354 Bacteria 4780
43 Ga0070675_100105444 3300005354 Unclassified 2378
44 Ga0070675_100113485 3300005354 Unclassified 2295
45 Ga0070675_100291711 3300005354 Bacteria 1436
46 Ga0070671_100002858 3300005355 Bacteria 13428
47 Ga0070671_100075561 3300005355 Unclassified 2815
48 Ga0070671_100231544 3300005355 Bacteria 1568
49 Ga0070671_100242163 3300005355 Unclassified 1531
50 Ga0070674_100023238 3300005356 Bacteria 4010
51 Ga0070674_100232703 3300005356 Unclassified 1439
52 Ga0070673_100017508 3300005364 Bacteria 5099
53 Ga0070673_100115554 3300005364 Unclassified 2231
54 Ga0070688_100070428 3300005365 Unclassified 2236
55 Ga0070667_100242508 3300005367 Unclassified 1609
56 Ga0070713_100148328 3300005436 Unclassified 2084
57 Ga0070701_10007377 3300005438 Bacteria 4694
58 Ga0070701_10074754 3300005438 Bacteria 1820
59 Ga0070705_100000146 3300005440 Bacteria 41908
60 Ga0070705_100033654 3300005440 Unclassified 2858
61 Ga0070700_100002251 3300005441 Bacteria 9823
62 Ga0070700_100008446 3300005441 Bacteria 5605
63 Ga0070694_100054412 3300005444 Unclassified 2711
64 Ga0070678_100002458 3300005456 Bacteria 10157
65 Ga0070678_100006825 3300005456 Bacteria 6728
66 Ga0070678_100180176 3300005456 Bacteria 1729
67 Ga0070681_10016639 3300005458 Bacteria 7341
68 Ga0068867_100063170 3300005459 Bacteria 2752
69 Ga0068867_100127306 3300005459 Bacteria 1975
70 Ga0070685_10006815 3300005466 Bacteria 5833
71 Ga0070707_100257244 3300005468 Bacteria 1699
72 Ga0070698_100001590 3300005471 Bacteria 25260
73 Ga0070698_100105158 3300005471 Unclassified 2793
74 Ga0070699_100006844 3300005518 Bacteria 9923
75 Ga0070699_100008293 3300005518 Bacteria 9009
76 Ga0070699_100023802 3300005518 Bacteria 5278
77 Ga0070699_100029934 3300005518 Bacteria 4696
78 Ga0070699_100050358 3300005518 Unclassified 3606
79 Ga0070684_100094250 3300005535 Bacteria 2666
80 Ga0070697_100225059 3300005536 Bacteria 1599
81 Ga0068853_100193657 3300005539 Unclassified 1848
82 Ga0070672_100009432 3300005543 Bacteria 6727
83 Ga0070672_100043942 3300005543 Bacteria 3449
84 Ga0070672_100057392 3300005543 Unclassified 3056
85 Ga0070686_100019855 3300005544 Bacteria 3968
86 Ga0070686_100197269 3300005544 Bacteria 1440
87 Ga0070686_100327634 3300005544 Unclassified 1144
88 Ga0070695_100000071 3300005545 Bacteria 40697
89 Ga0070696_100015063 3300005546 Bacteria 5191
90 Ga0070696_100015065 3300005546 Bacteria 5191
91 Ga0070665_100005084 3300005548 Bacteria 13642
92 Ga0070665_100012726 3300005548 Bacteria 8474
93 Ga0070665_100086743 3300005548 Bacteria 3135
94 Ga0070665_100111292 3300005548 Unclassified 2741
95 Ga0070665_100154321 3300005548 Unclassified 2298
96 Ga0070704_100002017 3300005549 Bacteria 11243
97 Ga0070704_100002288 3300005549 Bacteria 10700
98 Ga0070704_100093037 3300005549 Unclassified 2252
99 Ga0070704_100098228 3300005549 Bacteria 2199
100 Ga0070704_100128297 3300005549 Bacteria 1961
101 Ga0070664_100001607 3300005564 Bacteria 18077
102 Ga0070664_100008247 3300005564 Bacteria 8423
103 Ga0070664_100065092 3300005564 Bacteria 3110
104 Ga0068857_100045973 3300005577 Bacteria 3874
105 Ga0068857_100089352 3300005577 Bacteria 2756
106 Ga0068854_100011020 3300005578 Bacteria 5869
107 Ga0068856_100034058 3300005614 Bacteria 4989
108 Ga0068852_100154289 3300005616 Bacteria 2138
109 Ga0068859_100002342 3300005617 Bacteria 19265
110 Ga0068859_100009861 3300005617 Bacteria 9643
111 Ga0068859_100090622 3300005617 Unclassified 3108
112 Ga0068859_100092004 3300005617 Unclassified 3084
113 Ga0068859_100308288 3300005617 Bacteria 1676
114 Ga0068864_100025366 3300005618 Bacteria 4991
115 Ga0068864_100206081 3300005618 Unclassified 1809
116 Ga0068864_100340350 3300005618 Bacteria 1413
117 Ga0068864_100423033 3300005618 Unclassified 1270
118 Ga0068866_10068391 3300005718 Bacteria 1867
119 Ga0068861_100041887 3300005719 Unclassified 3432
120 Ga0068861_100216732 3300005719 Bacteria 1615
121 Ga0068851_10054486 3300005834 Bacteria 2037
122 Ga0068870_10000348 3300005840 Bacteria 17317
123 Ga0068870_10011690 3300005840 Bacteria 4080
124 Ga0068870_10085462 3300005840 Unclassified 1754
125 Ga0068863_100000867 3300005841 Bacteria 30266
126 Ga0068863_100049662 3300005841 Bacteria 3977
127 Ga0068863_100076119 3300005841 Unclassified 3175
128 Ga0068863_100231812 3300005841 Unclassified 1781
129 Ga0068863_100427621 3300005841 Bacteria 1298
130 Ga0068858_100023251 3300005842 Bacteria 5777
131 Ga0068858_100048062 3300005842 Unclassified 3954
132 Ga0068858_100122376 3300005842 Unclassified 2434
133 Ga0068858_100415988 3300005842 Bacteria 1292
134 Ga0068860_100270408 3300005843 Bacteria 1658
135 Ga0068860_100391990 3300005843 Bacteria 1372
136 Ga0068862_100001212 3300005844 Bacteria 24331
137 Ga0068862_100006825 3300005844 Bacteria 9465
138 Ga0081455_10067836 3300005937 Bacteria 2971
139 Ga0081540_1042106 3300005983 Bacteria 2359
140 Ga0081539_10000071 3300005985 Bacteria 233094
141 Ga0081539_10000184 3300005985 Bacteria 147966
142 Ga0081539_10022440 3300005985 Bacteria 4175
143 Ga0081539_10024175 3300005985 Unclassified 3952
144 Ga0070717_10024537 3300006028 Bacteria 4789
145 Ga0097621_100005361 3300006237 Bacteria 9036
146 Ga0097621_100005902 3300006237 Bacteria 8655
147 Ga0097621_100053683 3300006237 Bacteria 3285
148 Ga0097621_100117671 3300006237 Bacteria 2252
149 Ga0097621_100129644 3300006237 Bacteria 2145
150 Ga0097621_100217970 3300006237 Bacteria 1662
151 Ga0068871_100000974 3300006358 Bacteria 19172
152 Ga0068871_100010060 3300006358 Bacteria 6879
153 Ga0068871_100011045 3300006358 Bacteria 6619
154 Ga0068871_100017747 3300006358 Bacteria 5394
155 Ga0068871_100027325 3300006358 Unclassified 4462
156 Ga0068871_100080271 3300006358 Unclassified 2701
157 Ga0068871_100148469 3300006358 Unclassified 1998
158 Ga0068871_100161321 3300006358 Bacteria 1918
159 Ga0075428_100001755 3300006844 Bacteria 23151
160 Ga0075428_100001864 3300006844 Bacteria 22582
161 Ga0075428_100115698 3300006844 Unclassified 2921
162 Ga0075428_100164635 3300006844 Bacteria 2406
163 Ga0075430_100001987 3300006846 Bacteria 16844
164 Ga0075430_100003115 3300006846 Bacteria 13866
165 Ga0075431_100002526 3300006847 Bacteria 17651
166 Ga0075431_100025213 3300006847 Bacteria 6095
167 Ga0075433_10037850 3300006852 Unclassified 4163
168 Ga0075433_10047762 3300006852 Unclassified 3723
169 Ga0075433_10048831 3300006852 Bacteria 3681
170 Ga0075433_10109610 3300006852 Unclassified 2449
171 Ga0075434_100001582 3300006871 Bacteria 19283
172 Ga0075434_100002191 3300006871 Bacteria 17027
173 Ga0075434_100011334 3300006871 Bacteria 8402
174 Ga0075434_100037174 3300006871 Unclassified 4819
175 Ga0075434_100050607 3300006871 Bacteria 4127
176 Ga0075434_100051968 3300006871 Bacteria 4072
177 Ga0075434_100083306 3300006871 Bacteria 3196
178 Ga0075434_100149740 3300006871 Unclassified 2354
179 Ga0075429_100001764 3300006880 Bacteria 17910
180 Ga0075429_100052808 3300006880 Unclassified 3535
181 Ga0075429_100094289 3300006880 Unclassified 2611
182 Ga0075429_100198783 3300006880 Unclassified 1756
183 Ga0068865_100007682 3300006881 Bacteria 6641
184 Ga0068865_100034847 3300006881 Unclassified 3381
185 Ga0068865_100055148 3300006881 Bacteria 2764
186 Ga0075436_100004546 3300006914 Bacteria 9505
187 Ga0075436_100018256 3300006914 Bacteria 4805
188 Ga0097620_100002342 3300006931 Bacteria 19265
189 Ga0097620_100009861 3300006931 Bacteria 9643
190 Ga0097620_100090624 3300006931 Unclassified 3108
191 Ga0097620_100092005 3300006931 Unclassified 3084
192 Ga0097620_100308295 3300006931 Bacteria 1676
193 Ga0075435_100001504 3300007076 Bacteria 14978
194 Ga0075435_100043258 3300007076 Bacteria 3605
195 Ga0075435_100155304 3300007076 Unclassified 1925
196 Ga0075435_100166852 3300007076 Unclassified 1857
197 Ga0111539_10012073 3300009094 Bacteria 10834
198 Ga0111539_10015323 3300009094 Bacteria 9549
199 Ga0111539_10041737 3300009094 Bacteria 5514
200 Ga0111539_10197338 3300009094 Bacteria 2347
201 Ga0105245_10023271 3300009098 Bacteria 5439
202 Ga0105245_10043677 3300009098 Unclassified 3998
203 Ga0105245_10231959 3300009098 Bacteria 1786
204 Ga0105245_10245398 3300009098 Bacteria 1738
205 Ga0105245_10320787 3300009098 Bacteria 1526
206 Ga0105247_10001931 3300009101 Bacteria 14446
207 Ga0114129_10011341 3300009147 Bacteria 12696
208 Ga0114129_10015277 3300009147 Bacteria 10927
209 Ga0114129_10052246 3300009147 Bacteria 5736
210 Ga0114129_10140496 3300009147 Unclassified 3311
211 Ga0114129_10153225 3300009147 Bacteria 3154
212 Ga0114129_10169915 3300009147 Unclassified 2973
213 Ga0114129_10177599 3300009147 Bacteria 2899
214 Ga0114129_10237324 3300009147 Archaea 2452
215 Ga0114129_10306799 3300009147 Bacteria 2114
216 Ga0114129_10481723 3300009147 Bacteria 1623
217 Ga0114129_10551240 3300009147 Bacteria 1499
218 Ga0105243_10011210 3300009148 Bacteria 6782
219 Ga0105243_10056951 3300009148 Unclassified 3111
220 Ga0105242_10002441 3300009176 Bacteria 14599
221 Ga0105242_10005954 3300009176 Bacteria 9406
222 Ga0105242_10008535 3300009176 Bacteria 7869
223 Ga0105242_10045057 3300009176 Unclassified 3574
224 Ga0105248_10005030 3300009177 Bacteria 14601
225 Ga0105248_10026755 3300009177 Bacteria 6415
226 Ga0105248_10027852 3300009177 Bacteria 6291
227 Ga0105248_10034286 3300009177 Bacteria 5674
228 Ga0105248_10042670 3300009177 Bacteria 5087
229 Ga0105248_10093596 3300009177 Unclassified 3384
230 Ga0105248_10106165 3300009177 Bacteria 3166
231 Ga0105248_10118641 3300009177 Bacteria 2984
232 Ga0105248_10121937 3300009177 Unclassified 2940
233 Ga0105248_10188665 3300009177 Bacteria 2323
234 Ga0105248_10339181 3300009177 Bacteria 1692
235 Ga0105248_10625138 3300009177 Unclassified 1215
236 Ga0105249_10016331 3300009553 Bacteria 6586
237 Ga0105249_10490378 3300009553 Unclassified 1272
238 Ga0157369_10111669 3300013105 Bacteria 2905
239 Ga0157374_10087750 3300013296 Bacteria 2962
240 Ga0157374_10245217 3300013296 Unclassified 1762
241 Ga0157378_10122113 3300013297 Unclassified 2402
242 Ga0163162_10005742 3300013306 Bacteria 12001
243 Ga0163162_10122527 3300013306 Bacteria 2705
244 Ga0163162_10170568 3300013306 Unclassified 2301
245 Ga0163162_10583558 3300013306 Bacteria 1245
246 Ga0157375_10048686 3300013308 Unclassified 4148
247 Ga0157375_10075490 3300013308 Bacteria 3395
248 Ga0157375_10125349 3300013308 Bacteria 2682
249 Ga0157375_10296564 3300013308 Unclassified 1780
250 Ga0163163_10003744 3300014325 Bacteria 12948
251 Ga0163163_10011154 3300014325 Bacteria 8136
252 Ga0163163_10027696 3300014325 Bacteria 5433
253 Ga0163163_10047735 3300014325 Unclassified 4209
254 Ga0163163_10078486 3300014325 Bacteria 3298
255 Ga0157380_10016094 3300014326 Bacteria 5510
256 Ga0157380_10040078 3300014326 Bacteria 3646
257 Ga0157380_10041849 3300014326 Bacteria 3578
258 Ga0157380_10125809 3300014326 Bacteria 2178
259 Ga0157380_10279553 3300014326 Unclassified 1527
260 Ga0157377_10026503 3300014745 Unclassified 3102
261 Ga0157377_10039094 3300014745 Unclassified 2623
262 Ga0157377_10078623 3300014745 Bacteria 1923
263 Ga0157379_10019460 3300014968 Bacteria 5996
264 Ga0157379_10135216 3300014968 Bacteria 2221
265 Ga0157379_10390411 3300014968 Bacteria 1278
266 Ga0157376_10015898 3300014969 Bacteria 5699
267 Ga0157376_10089996 3300014969 Bacteria 2655
268 Ga0163161_10226347 3300017792 Unclassified 1450
269 Ga0213875_10004645 3300021388 Bacteria 7486
270 Ga0207653_10060347 3300025885 Unclassified 1278
271 Ga0207682_10031195 3300025893 Bacteria 2138
272 Ga0207642_10051191 3300025899 Bacteria 1867
273 Ga0207642_10100514 3300025899 Bacteria 1451
274 Ga0207680_10024840 3300025903 Unclassified 3295
275 Ga0207680_10082580 3300025903 Unclassified 2022
276 Ga0207680_10128728 3300025903 Unclassified 1666
277 Ga0207680_10220331 3300025903 Bacteria 1300
278 Ga0207645_10004591 3300025907 Bacteria 10183
279 Ga0207643_10001054 3300025908 Bacteria 16318
280 Ga0207643_10009866 3300025908 Bacteria 5131
281 Ga0207643_10054746 3300025908 Unclassified 2268
282 Ga0207707_10144988 3300025912 Bacteria 2076
283 Ga0207660_10137586 3300025917 Bacteria 1865
284 Ga0207662_10009381 3300025918 Bacteria 5382
285 Ga0207662_10052821 3300025918 Unclassified 2419
286 Ga0207662_10061423 3300025918 Bacteria 2256
287 Ga0207662_10077343 3300025918 Unclassified 2024
288 Ga0207662_10178343 3300025918 Bacteria 1366
289 Ga0207657_10135454 3300025919 Unclassified 2016
290 Ga0207649_10060341 3300025920 Bacteria 2383
291 Ga0207649_10160120 3300025920 Bacteria 1559
292 Ga0207681_10081782 3300025923 Bacteria 2281
293 Ga0207650_10011894 3300025925 Bacteria 5996
294 Ga0207650_10047767 3300025925 Unclassified 3155
295 Ga0207659_10002882 3300025926 Bacteria 10236
296 Ga0207659_10006373 3300025926 Bacteria 7226
297 Ga0207659_10009765 3300025926 Bacteria 6003
298 Ga0207659_10029973 3300025926 Unclassified 3712
299 Ga0207687_10026291 3300025927 Bacteria 3896
300 Ga0207687_10232878 3300025927 Bacteria 1456
301 Ga0207700_10105436 3300025928 Bacteria 2257
302 Ga0207700_10204339 3300025928 Unclassified 1666
303 Ga0207644_10012668 3300025931 Bacteria 5604
304 Ga0207644_10247587 3300025931 Bacteria 1421
305 Ga0207706_10152557 3300025933 Unclassified 2032
306 Ga0207686_10010129 3300025934 Bacteria 5125
307 Ga0207686_10026519 3300025934 Bacteria 3381
308 Ga0207686_10048293 3300025934 Bacteria 2636
309 Ga0207686_10060471 3300025934 Bacteria 2398
310 Ga0207709_10079195 3300025935 Unclassified 2112
311 Ga0207670_10103012 3300025936 Bacteria 2042
312 Ga0207669_10014972 3300025937 Bacteria 3900
313 Ga0207669_10057582 3300025937 Bacteria 2367
314 Ga0207704_10010624 3300025938 Bacteria 4498
315 Ga0207704_10015146 3300025938 Bacteria 3920
316 Ga0207704_10019134 3300025938 Unclassified 3591
317 Ga0207704_10085072 3300025938 Unclassified 2057
318 Ga0207665_10115695 3300025939 Unclassified 1889
319 Ga0207691_10005686 3300025940 Bacteria 12051
320 Ga0207691_10048592 3300025940 Bacteria 3889
321 Ga0207691_10052393 3300025940 Unclassified 3727
322 Ga0207691_10069666 3300025940 Unclassified 3177
323 Ga0207691_10090193 3300025940 Bacteria 2748
324 Ga0207711_10039514 3300025941 Bacteria 4014
325 Ga0207711_10082140 3300025941 Unclassified 2816
326 Ga0207711_10282369 3300025941 Unclassified 1529
327 Ga0207689_10003332 3300025942 Bacteria 14715
328 Ga0207689_10004152 3300025942 Bacteria 13168
329 Ga0207689_10322390 3300025942 Archaea 1282
330 Ga0207661_10360833 3300025944 Unclassified 1312
331 Ga0207679_10012132 3300025945 Bacteria 5609
332 Ga0207679_10048302 3300025945 Unclassified 3097
333 Ga0207679_10089607 3300025945 Bacteria 2375
334 Ga0207679_10377709 3300025945 Unclassified 1242
335 Ga0207651_10039879 3300025960 Plasmid 3101
336 Ga0207651_10098871 3300025960 Bacteria 2159
337 Ga0207712_10052395 3300025961 Unclassified 2858
338 Ga0207668_10024509 3300025972 Unclassified 3895
339 Ga0207640_10027060 3300025981 Bacteria 3491
340 Ga0207677_10020728 3300026023 Bacteria 3998
341 Ga0207703_10025226 3300026035 Bacteria 4676
342 Ga0207703_10090920 3300026035 Bacteria 2566
343 Ga0207703_10214885 3300026035 Bacteria 1716
344 Ga0207703_10247463 3300026035 Bacteria 1605
345 Ga0207708_10002523 3300026075 Bacteria 13461
346 Ga0207708_10008447 3300026075 Bacteria 7621
347 Ga0207708_10009674 3300026075 Bacteria 7151
348 Ga0207708_10018554 3300026075 Bacteria 5240
349 Ga0207641_10000259 3300026088 Bacteria 67298
350 Ga0207641_10036506 3300026088 Bacteria 4103
351 Ga0207641_10298636 3300026088 Bacteria 1521
352 Ga0207648_10001037 3300026089 Bacteria 31185
353 Ga0207648_10005062 3300026089 Bacteria 13367
354 Ga0207648_10049065 3300026089 Unclassified 3696
355 Ga0207676_10003292 3300026095 Bacteria 11482
356 Ga0207676_10016008 3300026095 Bacteria 5426
357 Ga0207676_10056221 3300026095 Unclassified 3093
358 Ga0207676_10256256 3300026095 Bacteria 1577
359 Ga0207676_10281786 3300026095 Bacteria 1509
360 Ga0207674_10028875 3300026116 Bacteria 5847
361 Ga0207674_10077606 3300026116 Bacteria 3327
362 Ga0207675_100000826 3300026118 Bacteria 30859
363 Ga0207675_100057407 3300026118 Unclassified 3632
364 Ga0207683_10002245 3300026121 Bacteria 16964
365 Ga0207683_10013192 3300026121 Bacteria 7049
366 Ga0207683_10014709 3300026121 Bacteria 6664
367 Ga0207683_10016790 3300026121 Bacteria 6231
368 Ga0207683_10228294 3300026121 Bacteria 1697
369 Ga0207683_10410097 3300026121 Bacteria 1247
370 Ga0207428_10000427 3300027907 Bacteria 52031
371 Ga0207428_10002221 3300027907 Bacteria 19484
372 Ga0207428_10007903 3300027907 Bacteria 9668
373 Ga0207428_10043670 3300027907 Unclassified 3619
374 Ga0268265_10009916 3300028380 Bacteria 6435
375 Ga0268265_10039405 3300028380 Unclassified 3483
376 Ga0268264_10033126 3300028381 Unclassified 4242
377 Ga0268264_10057936 3300028381 Unclassified 3242
378 Ga0373930_0012972 3300034816 Unclassified 1528
379 Ga0373948_0003245 3300034817 Unclassified 2485
380 Ga0373950_0001048 3300034818 Unclassified 3529
381 Ga0373958_0006461 3300034819 Unclassified 1828
382 Ga0373959_0003992 3300034820 Bacteria 2363
383 Ga0373928_0019904 3300035084 Unclassified 1404
384 Ga0373929_0002534 3300035085 Bacteria 3356
385 Ga0373940_0001193 3300035088 Bacteria 4572
386 Ga0373949_0000767 3300035090 Bacteria 10352
387 Ga0373951_0005043 3300035091 Bacteria 3090
388 Ga0373932_0000210 3300035112 Bacteria 17175
389 Ga0373932_0014616 3300035112 Bacteria 1977
390 Ga0373936_0055040 3300035113 Bacteria 1615
391 Ga0373939_0000892 3300035114 Bacteria 7410
392 Ga0373939_0033704 3300035114 Unclassified 1498
393 Ga0373941_0001455 3300035115 Bacteria 5004
394 Ga0373945_0064621 3300035116 Unclassified 1372
395 Ga0373960_0003282 3300035121 Bacteria 3658
396 Ga0373955_0018782 3300035172 Unclassified 3445
397 Ga0373942_0000074 3300035207 Bacteria 21298
398 Ga0373942_0028780 3300035207 Unclassified 1454
399 Ga0373961_0000854 3300035241 Bacteria 10282
400 Ga0373924_0086463 3300035410 Unclassified 1338
401 Ga0373931_0035511 3300035691 Unclassified 2592
402 Ga0373931_0116364 3300035691 Unclassified 1523
403 Ga0373935_0008286 3300035692 Bacteria 6220
404 Ga0373935_0056652 3300035692 Bacteria 2500
405 Ga0373927_0095753 3300035695 Unclassified 1930
406 Ga0373947_0161374 3300035725 Unclassified 1450
407 Ga0373937_0087977 3300036401 Bacteria 2876
408 Ga0436364_0387448 3300037853 Bacteria 4348
409 Ga0436360_1173713 3300039438 Unclassified 2067
410 Ga0495603_0015359 3300046455 Bacteria 4633
411 Ga0495603_0015727 3300046455 Bacteria 4576
412 Ga0495629_0094160 3300046459 Bacteria 2090
413 Ga0495580_0007223 3300046472 Bacteria 8936
414 Ga0495608_0017174 3300046511 Bacteria 5008
415 Ga0495663_0007663 3300046525 Bacteria 2985
416 Ga0495642_0019900 3300046528 Unclassified 2632
417 Ga0495621_0030769 3300046539 Unclassified 1837
418 Ga0495645_0039353 3300046543 Bacteria 3449
419 Ga0495634_0051050 3300046642 Bacteria 2776
420 Ga0495634_0101708 3300046642 Unclassified 1856
421 Ga0495659_0008102 3300046664 Unclassified 3339
422 Ga0495659_0010787 3300046664 Bacteria 2940
423 Ga0495659_0035545 3300046664 Bacteria 1756
424 Ga0495623_0045370 3300046679 Bacteria 2792
425 Ga0495647_0013999 3300046681 Unclassified 2789
426 Ga0495658_0012107 3300046683 Unclassified 4357
427 Ga0495669_0006103 3300046684 Bacteria 5026
428 Ga0495669_0090279 3300046684 Bacteria 1414
429 Ga0495613_0004434 3300046689 Bacteria 10514
430 Ga0495670_0050420 3300046691 Unclassified 2084
431 Ga0495600_0008215 3300046809 Bacteria 6408
432 Ga0495674_0031579 3300047319 Bacteria 4811
433 Ga0495677_0015182 3300047445 Unclassified 2799
434 Ga0495684_0000349 3300047471 Bacteria 37169
435 Ga0496100_0266765 3300048903 Bacteria 1271
436 Ga0496101_0015156 3300048904 Bacteria 5189
437 Ga0496103_0245952 3300048906 Unclassified 1151
438 Ga0496104_0163157 3300048907 Bacteria 2137
439 Ga0496106_0020708 3300048909 Bacteria 4882
440 Ga0496108_0066221 3300048911 Unclassified 3046
441 Ga0496108_0132553 3300048911 Bacteria 2142
442 Ga0496108_0259530 3300048911 Unclassified 1512
443 Ga0496109_0111580 3300048912 Bacteria 2543
444 Ga0496110_0045019 3300048913 Bacteria 3855
445 Ga0496110_0148183 3300048913 Unclassified 2124
446 Ga0496111_0077894 3300048914 Bacteria 2417
447 Ga0496112_0003987 3300048915 Bacteria 12370
448 Ga0496113_0184194 3300048916 Bacteria 1656
449 Ga0496114_0001867 3300048917 Bacteria 15972
450 Ga0496115_0113766 3300048918 Bacteria 2224
451 Ga0501032_0113215 3300049569 Unclassified 1795
452 Ga0501034_0199093 3300049571 Bacteria 1962
453 Ga0501036_0153688 3300049572 Bacteria 1941
454 Ga0501047_0179569 3300049581 Unclassified 1983
455 Ga0501048_0054085 3300049582 Bacteria 2852
456 Ga0501044_0008185 3300049823 Bacteria 11473
457 nmdc:mga05p37_12138_c1 3300050507 Bacteria 10287
458 nmdc:mga05p37_220017_c2 3300050507 Bacteria 1938
459 nmdc:mga05p37_230753_c1 3300050507 Bacteria 2230
460 nmdc:mga05p37_2311_c1 3300050507 Bacteria 12378
461 nmdc:mga05p37_294960_c1 3300050507 Bacteria 1929
462 nmdc:mga05p37_607513_c1 3300050507 Unclassified 1233
463 nmdc:mga05p37_6389_c1 3300050507 Bacteria 13889
464 nmdc:mga09592_150599_c1 3300050508 Unclassified 2007
465 nmdc:mga09592_33724_c1 3300050508 Bacteria 4276
466 nmdc:mga09592_4883_c1 3300050508 Bacteria 10856
467 nmdc:mga0qj67_189913_c1 3300050509 Unclassified 1669
468 nmdc:mga0qj67_8621_c1 3300050509 Bacteria 7566
469 nmdc:mga06r32_1387_c1 3300050510 Bacteria 21887
470 nmdc:mga06r32_54247_c1 3300050510 Unclassified 3843
471 nmdc:mga08y16_122205_c1 3300050511 Unclassified 2710
472 nmdc:mga08y16_146178_c1 3300050511 Unclassified 2458
473 nmdc:mga08y16_263881_c1 3300050511 Bacteria 1778
474 nmdc:mga08y16_44845_c1 3300050511 Bacteria 4634
475 nmdc:mga08y16_56247_c1 3300050511 Unclassified 4112
476 nmdc:mga08y16_61581_c1 3300050511 Bacteria 3919
477 nmdc:mga0n895_129781_c1 3300050512 Bacteria 2545
478 nmdc:mga0n895_14331_c1 3300050512 Bacteria 7196
479 nmdc:mga0n895_292413_c1 3300050512 Bacteria 1652
480 nmdc:mga0n895_374_c1 3300050512 Bacteria 30299
481 nmdc:mga0n895_43545_c1 3300050512 Bacteria 4374
482 nmdc:mga0n895_50452_c1 3300050512 Bacteria 4079
483 nmdc:mga0n895_51524_c1 3300050512 Bacteria 4039
484 nmdc:mga0n895_61224_c1 3300050512 Bacteria 3715
485 nmdc:mga0n895_654_c1 3300050512 Bacteria 24195
486 nmdc:mga0rr50_125780_c1 3300050513 Unclassified 2047
487 nmdc:mga0rr50_22_c1 3300050513 Bacteria 123539
488 nmdc:mga0rr50_64728_c1 3300050513 Bacteria 2767
489 nmdc:mga0rr50_66892_c1 3300050513 Unclassified 2728
490 nmdc:mga0rr50_93477_c1 3300050513 Bacteria 2346
491 nmdc:mga08x19_13188_c1 3300050514 Bacteria 4992
492 nmdc:mga08x19_151735_c1 3300050514 Bacteria 1569
493 nmdc:mga08x19_44415_c1 3300050514 Bacteria 2837
494 nmdc:mga08x19_450_c1 3300050514 Bacteria 28160
495 nmdc:mga0a205_11105_c1 3300050515 Bacteria 8286
496 nmdc:mga0a205_115891_c1 3300050515 Bacteria 2578
497 nmdc:mga0a205_154587_c1 3300050515 Bacteria 2193
498 nmdc:mga0a205_24783_c1 3300050515 Bacteria 5707
499 nmdc:mga0a205_542594_c1 3300050515 Bacteria 1018
500 nmdc:mga0a205_59693_c1 3300050515 Bacteria 3684
501 nmdc:mga0a205_7765_c1 3300050515 Bacteria 9738
502 Ga0495601_0001106 3300053077 Bacteria 14774
503 Ga0495601_0212115 3300053077 Unclassified 1265
504 Ga0495601_0326396 3300053077 Bacteria 999
505 Ga0495619_0002355 3300053085 Bacteria 12445
506 Ga0495619_0053657 3300053085 Bacteria 2667
507 Ga0495619_0071377 3300053085 Bacteria 2324
508 Ga0495619_0084543 3300053085 Bacteria 2142
509 Ga0501084_0079473 3300054114 Bacteria 2749
510 nmdc:mga0n895_84048_c1
511 JGI25406J46586_10000278
512 JGI25406J46586_10000490
513 Ga0058862_10039671
514 Ga0065704_10082455
515 Ga0065712_10078189
516 Ga0065712_10137577
517 Ga0065715_10017877
518 Ga0065715_10120139
519 Ga0065707_10094663
520 Ga0070683_100050162
521 Ga0070690_100111568
522 Ga0070670_100002940
523 Ga0070670_100011809
524 Ga0070670_100023483
525 Ga0070670_100024109
526 Ga0070670_100097397
527 Ga0070670_100191516
528 Ga0070677_10006345
529 Ga0070677_10044739
530 Ga0070677_10055293
531 Ga0068869_100009089
532 Ga0068869_100141409
533 Ga0070666_10026478
534 Ga0070666_10057620
535 Ga0070666_10218278
536 Ga0068868_100019102
537 Ga0070689_100010826
538 Ga0070689_100014276
539 Ga0070687_100018793
540 Ga0070687_100038261
541 Ga0070687_100095149
542 Ga0070661_100007242
543 Ga0070661_100031551
544 Ga0070661_100084291
545 Ga0070661_100124505
546 Ga0070692_10032349
547 Ga0070669_100001432
548 Ga0070669_100069318
549 Ga0070669_100083458
550 Ga0070675_100009983
551 Ga0070675_100025066
552 Ga0070675_100105444
553 Ga0070675_100113485
554 Ga0070675_100291711
555 Ga0070671_100002858
556 Ga0070671_100075561
557 Ga0070671_100231544
558 Ga0070671_100242163
559 Ga0070674_100023238
560 Ga0070674_100232703
561 Ga0070673_100017508
562 Ga0070673_100115554
563 Ga0070688_100070428
564 Ga0070667_100242508
565 Ga0070713_100148328
566 Ga0070701_10007377
567 Ga0070701_10074754
568 Ga0070705_100000146
569 Ga0070705_100033654
570 Ga0070700_100002251
571 Ga0070700_100008446
572 Ga0070694_100054412
573 Ga0070678_100002458
574 Ga0070678_100006825
575 Ga0070678_100180176
576 Ga0070681_10016639
577 Ga0068867_100063170
578 Ga0068867_100127306
579 Ga0070685_10006815
580 Ga0070707_100257244
581 Ga0070698_100001590
582 Ga0070698_100105158
583 Ga0070699_100006844
584 Ga0070699_100008293
585 Ga0070699_100023802
586 Ga0070699_100029934
587 Ga0070699_100050358
588 Ga0070684_100094250
589 Ga0070697_100225059
590 Ga0068853_100193657
591 Ga0070672_100009432
592 Ga0070672_100043942
593 Ga0070672_100057392
594 Ga0070686_100019855
595 Ga0070686_100197269
596 Ga0070686_100327634
597 Ga0070695_100000071
598 Ga0070696_100015063
599 Ga0070696_100015065
600 Ga0070665_100005084
601 Ga0070665_100012726
602 Ga0070665_100086743
603 Ga0070665_100111292
604 Ga0070665_100154321
605 Ga0070704_100002017
606 Ga0070704_100002288
607 Ga0070704_100093037
608 Ga0070704_100098228
609 Ga0070704_100128297
610 Ga0070664_100001607
611 Ga0070664_100008247
612 Ga0070664_100065092
613 Ga0068857_100045973
614 Ga0068857_100089352
615 Ga0068854_100011020
616 Ga0068856_100034058
617 Ga0068852_100154289
618 Ga0068859_100002342
619 Ga0068859_100009861
620 Ga0068859_100090622
621 Ga0068859_100092004
622 Ga0068859_100308288
623 Ga0068864_100025366
624 Ga0068864_100206081
625 Ga0068864_100340350
626 Ga0068864_100423033
627 Ga0068866_10068391
628 Ga0068861_100041887
629 Ga0068861_100216732
630 Ga0068851_10054486
631 Ga0068870_10000348
632 Ga0068870_10011690
633 Ga0068870_10085462
634 Ga0068863_100000867
635 Ga0068863_100049662
636 Ga0068863_100076119
637 Ga0068863_100231812
638 Ga0068863_100427621
639 Ga0068858_100023251
640 Ga0068858_100048062
641 Ga0068858_100122376
642 Ga0068858_100415988
643 Ga0068860_100270408
644 Ga0068860_100391990
645 Ga0068862_100001212
646 Ga0068862_100006825
647 Ga0081455_10067836
648 Ga0081540_1042106
649 Ga0081539_10000071
650 Ga0081539_10000184
651 Ga0081539_10022440
652 Ga0081539_10024175
653 Ga0070717_10024537
654 Ga0097621_100005361
655 Ga0097621_100005902
656 Ga0097621_100053683
657 Ga0097621_100117671
658 Ga0097621_100129644
659 Ga0097621_100217970
660 Ga0068871_100000974
661 Ga0068871_100010060
662 Ga0068871_100011045
663 Ga0068871_100017747
664 Ga0068871_100027325
665 Ga0068871_100080271
666 Ga0068871_100148469
667 Ga0068871_100161321
668 Ga0075428_100001755
669 Ga0075428_100001864
670 Ga0075428_100115698
671 Ga0075428_100164635
672 Ga0075430_100001987
673 Ga0075430_100003115
674 Ga0075431_100002526
675 Ga0075431_100025213
676 Ga0075433_10037850
677 Ga0075433_10047762
678 Ga0075433_10048831
679 Ga0075433_10109610
680 Ga0075434_100001582
681 Ga0075434_100002191
682 Ga0075434_100011334
683 Ga0075434_100037174
684 Ga0075434_100050607
685 Ga0075434_100051968
686 Ga0075434_100083306
687 Ga0075434_100149740
688 Ga0075429_100001764
689 Ga0075429_100052808
690 Ga0075429_100094289
691 Ga0075429_100198783
692 Ga0068865_100007682
693 Ga0068865_100034847
694 Ga0068865_100055148
695 Ga0075436_100004546
696 Ga0075436_100018256
697 Ga0097620_100002342
698 Ga0097620_100009861
699 Ga0097620_100090624
700 Ga0097620_100092005
701 Ga0097620_100308295
702 Ga0075435_100001504
703 Ga0075435_100043258
704 Ga0075435_100155304
705 Ga0075435_100166852
706 Ga0111539_10012073
707 Ga0111539_10015323
708 Ga0111539_10041737
709 Ga0111539_10197338
710 Ga0105245_10023271
711 Ga0105245_10043677
712 Ga0105245_10231959
713 Ga0105245_10245398
714 Ga0105245_10320787
715 Ga0105247_10001931
716 Ga0114129_10011341
717 Ga0114129_10015277
718 Ga0114129_10052246
719 Ga0114129_10140496
720 Ga0114129_10153225
721 Ga0114129_10169915
722 Ga0114129_10177599
723 Ga0114129_10237324
724 Ga0114129_10306799
725 Ga0114129_10481723
726 Ga0114129_10551240
727 Ga0105243_10011210
728 Ga0105243_10056951
729 Ga0105242_10002441
730 Ga0105242_10005954
731 Ga0105242_10008535
732 Ga0105242_10045057
733 Ga0105248_10005030
734 Ga0105248_10026755
735 Ga0105248_10027852
736 Ga0105248_10034286
737 Ga0105248_10042670
738 Ga0105248_10093596
739 Ga0105248_10106165
740 Ga0105248_10118641
741 Ga0105248_10121937
742 Ga0105248_10188665
743 Ga0105248_10339181
744 Ga0105248_10625138
745 Ga0105249_10016331
746 Ga0105249_10490378
747 Ga0157369_10111669
748 Ga0157374_10087750
749 Ga0157374_10245217
750 Ga0157378_10122113
751 Ga0163162_10005742
752 Ga0163162_10122527
753 Ga0163162_10170568
754 Ga0163162_10583558
755 Ga0157375_10048686
756 Ga0157375_10075490
757 Ga0157375_10125349
758 Ga0157375_10296564
759 Ga0163163_10003744
760 Ga0163163_10011154
761 Ga0163163_10027696
762 Ga0163163_10047735
763 Ga0163163_10078486
764 Ga0157380_10016094
765 Ga0157380_10040078
766 Ga0157380_10041849
767 Ga0157380_10125809
768 Ga0157380_10279553
769 Ga0157377_10026503
770 Ga0157377_10039094
771 Ga0157377_10078623
772 Ga0157379_10019460
773 Ga0157379_10135216
774 Ga0157379_10390411
775 Ga0157376_10015898
776 Ga0157376_10089996
777 Ga0163161_10226347
778 Ga0213875_10004645
779 Ga0207653_10060347
780 Ga0207682_10031195
781 Ga0207642_10051191
782 Ga0207642_10100514
783 Ga0207680_10024840
784 Ga0207680_10082580
785 Ga0207680_10128728
786 Ga0207680_10220331
787 Ga0207645_10004591
788 Ga0207643_10001054
789 Ga0207643_10009866
790 Ga0207643_10054746
791 Ga0207707_10144988
792 Ga0207660_10137586
793 Ga0207662_10009381
794 Ga0207662_10052821
795 Ga0207662_10061423
796 Ga0207662_10077343
797 Ga0207662_10178343
798 Ga0207657_10135454
799 Ga0207649_10060341
800 Ga0207649_10160120
801 Ga0207681_10081782
802 Ga0207650_10011894
803 Ga0207650_10047767
804 Ga0207659_10002882
805 Ga0207659_10006373
806 Ga0207659_10009765
807 Ga0207659_10029973
808 Ga0207687_10026291
809 Ga0207687_10232878
810 Ga0207700_10105436
811 Ga0207700_10204339
812 Ga0207644_10012668
813 Ga0207644_10247587
814 Ga0207706_10152557
815 Ga0207686_10010129
816 Ga0207686_10026519
817 Ga0207686_10048293
818 Ga0207686_10060471
819 Ga0207709_10079195
820 Ga0207670_10103012
821 Ga0207669_10014972
822 Ga0207669_10057582
823 Ga0207704_10010624
824 Ga0207704_10015146
825 Ga0207704_10019134
826 Ga0207704_10085072
827 Ga0207665_10115695
828 Ga0207691_10005686
829 Ga0207691_10048592
830 Ga0207691_10052393
831 Ga0207691_10069666
832 Ga0207691_10090193
833 Ga0207711_10039514
834 Ga0207711_10082140
835 Ga0207711_10282369
836 Ga0207689_10003332
837 Ga0207689_10004152
838 Ga0207689_10322390
839 Ga0207661_10360833
840 Ga0207679_10012132
841 Ga0207679_10048302
842 Ga0207679_10089607
843 Ga0207679_10377709
844 Ga0207651_10039879
845 Ga0207651_10098871
846 Ga0207712_10052395
847 Ga0207668_10024509
848 Ga0207640_10027060
849 Ga0207677_10020728
850 Ga0207703_10025226
851 Ga0207703_10090920
852 Ga0207703_10214885
853 Ga0207703_10247463
854 Ga0207708_10002523
855 Ga0207708_10008447
856 Ga0207708_10009674
857 Ga0207708_10018554
858 Ga0207641_10000259
859 Ga0207641_10036506
860 Ga0207641_10298636
861 Ga0207648_10001037
862 Ga0207648_10005062
863 Ga0207648_10049065
864 Ga0207676_10003292
865 Ga0207676_10016008
866 Ga0207676_10056221
867 Ga0207676_10256256
868 Ga0207676_10281786
869 Ga0207674_10028875
870 Ga0207674_10077606
871 Ga0207675_100000826
872 Ga0207675_100057407
873 Ga0207683_10002245
874 Ga0207683_10013192
875 Ga0207683_10014709
876 Ga0207683_10016790
877 Ga0207683_10228294
878 Ga0207683_10410097
879 Ga0207428_10000427
880 Ga0207428_10002221
881 Ga0207428_10007903
882 Ga0207428_10043670
883 Ga0268265_10009916
884 Ga0268265_10039405
885 Ga0268264_10033126
886 Ga0268264_10057936
887 Ga0373930_0012972
888 Ga0373948_0003245
889 Ga0373950_0001048
890 Ga0373958_0006461
891 Ga0373959_0003992
892 Ga0373928_0019904
893 Ga0373929_0002534
894 Ga0373940_0001193
895 Ga0373949_0000767
896 Ga0373951_0005043
897 Ga0373932_0000210
898 Ga0373932_0014616
899 Ga0373936_0055040
900 Ga0373939_0000892
901 Ga0373939_0033704
902 Ga0373941_0001455
903 Ga0373945_0064621
904 Ga0373960_0003282
905 Ga0373955_0018782
906 Ga0373942_0000074
907 Ga0373942_0028780
908 Ga0373961_0000854
909 Ga0373924_0086463
910 Ga0373931_0035511
911 Ga0373931_0116364
912 Ga0373935_0008286
913 Ga0373935_0056652
914 Ga0373927_0095753
915 Ga0373947_0161374
916 Ga0373937_0087977
917 Ga0436364_0387448
918 Ga0436360_1173713
919 Ga0495603_0015359
920 Ga0495603_0015727
921 Ga0495629_0094160
922 Ga0495580_0007223
923 Ga0495608_0017174
924 Ga0495663_0007663
925 Ga0495642_0019900
926 Ga0495621_0030769
927 Ga0495645_0039353
928 Ga0495634_0051050
929 Ga0495634_0101708
930 Ga0495659_0008102
931 Ga0495659_0010787
932 Ga0495659_0035545
933 Ga0495623_0045370
934 Ga0495647_0013999
935 Ga0495658_0012107
936 Ga0495669_0006103
937 Ga0495669_0090279
938 Ga0495613_0004434
939 Ga0495670_0050420
940 Ga0495600_0008215
941 Ga0495674_0031579
942 Ga0495677_0015182
943 Ga0495684_0000349
944 Ga0496100_0266765
945 Ga0496101_0015156
946 Ga0496103_0245952
947 Ga0496104_0163157
948 Ga0496106_0020708
949 Ga0496108_0066221
950 Ga0496108_0132553
951 Ga0496108_0259530
952 Ga0496109_0111580
953 Ga0496110_0045019
954 Ga0496110_0148183
955 Ga0496111_0077894
956 Ga0496112_0003987
957 Ga0496113_0184194
958 Ga0496114_0001867
959 Ga0496115_0113766
960 Ga0501032_0113215
961 Ga0501034_0199093
962 Ga0501036_0153688
963 Ga0501047_0179569
964 Ga0501048_0054085
965 Ga0501044_0008185
966 nmdc:mga05p37_12138_c1
967 nmdc:mga05p37_220017_c2
968 nmdc:mga05p37_230753_c1
969 nmdc:mga05p37_2311_c1
970 nmdc:mga05p37_294960_c1
971 nmdc:mga05p37_607513_c1
972 nmdc:mga05p37_6389_c1
973 nmdc:mga09592_150599_c1
974 nmdc:mga09592_33724_c1
975 nmdc:mga09592_4883_c1
976 nmdc:mga0qj67_189913_c1
977 nmdc:mga0qj67_8621_c1
978 nmdc:mga06r32_1387_c1
979 nmdc:mga06r32_54247_c1
980 nmdc:mga08y16_122205_c1
981 nmdc:mga08y16_146178_c1
982 nmdc:mga08y16_263881_c1
983 nmdc:mga08y16_44845_c1
984 nmdc:mga08y16_56247_c1
985 nmdc:mga08y16_61581_c1
986 nmdc:mga0n895_129781_c1
987 nmdc:mga0n895_14331_c1
988 nmdc:mga0n895_292413_c1
989 nmdc:mga0n895_374_c1
990 nmdc:mga0n895_43545_c1
991 nmdc:mga0n895_50452_c1
992 nmdc:mga0n895_51524_c1
993 nmdc:mga0n895_61224_c1
994 nmdc:mga0n895_654_c1
995 nmdc:mga0rr50_125780_c1
996 nmdc:mga0rr50_22_c1
997 nmdc:mga0rr50_64728_c1
998 nmdc:mga0rr50_66892_c1
999 nmdc:mga0rr50_93477_c1
1000 nmdc:mga08x19_13188_c1
1001 nmdc:mga08x19_151735_c1
1002 nmdc:mga08x19_44415_c1
1003 nmdc:mga08x19_450_c1
1004 nmdc:mga0a205_11105_c1
1005 nmdc:mga0a205_115891_c1
1006 nmdc:mga0a205_154587_c1
1007 nmdc:mga0a205_24783_c1
1008 nmdc:mga0a205_542594_c1
1009 nmdc:mga0a205_59693_c1
1010 nmdc:mga0a205_7765_c1
1011 Ga0495601_0001106
1012 Ga0495601_0212115
1013 Ga0495601_0326396
1014 Ga0495619_0002355
1015 Ga0495619_0053657
1016 Ga0495619_0071377
1017 Ga0495619_0084543
1018 Ga0501084_0079473

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

112

261

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xfr-assembly1.cif.gz_A metallo-beta-lactamase from pontibacter korlensis 0.8363 54 280
3fcz-assembly2.cif.gz_B adaptive protein evolution grants organismal fitness by improving catalysis and flexibility 0.8269 53 280
2znb-assembly1.cif.gz_A metallo-beta-lactamase (cadmium-bound form) 0.8232 54 286
6xfr-assembly1.cif.gz_A metallo-beta-lactamase from pontibacter korlensis 0.822 54 280
1znb-assembly2.cif.gz_B metallo-beta-lactamase 0.8175 54 286
ID Description Score Start End Superfamily
af_Q682P6_229_394_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8226 96 269 3.60.15.10
1znbB00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8175 54 286 3.60.15.10
4nq7A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8129 54 280 3.60.15.10
1m2xC00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8085 52 282 3.60.15.10
af_I6XHY3_12_197_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8037 54 268 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A1F2RBQ8-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9571 196 333
AF-A0A382X0I0-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9514 82 147 GO:0008270
GO:0008800
GO:0017001
AF-A0A2V7ZJM0-F1-model_v4 MBL fold metallo-hydrolase 0.9461 182 333 GO:0016787
AF-A0A2V8HCM5-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9445 109 349
AF-A0A2V8WSX7-F1-model_v4 MBL fold metallo-hydrolase 0.94 185 309 GO:0016787

Map