F457050

General Info

Members Datasets Scaffolds Average Seq Length
509 258 1008 100

Family's Representative Sequence

Representative Sequence 3300050490|nmdc:mga03n38_125731_c1|nmdc:mga03n38_125731_c1_403_768
Length 121
Sequence LSIRSFTLFSQRHNWSPEEYEMIKNGTRLQSQVCQTQVIVVRSSERLDDLRAGGTPMVPLNTESVAVATADPALMGGNIVGKRYVDESGAEVLVTKGGQGTLTVGDAALNLKEAKPLPASD

Samples

Sample ID Description Type Environment
1 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
104 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
156 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
157 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
158 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
162 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
163 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
164 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
165 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
166 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
167 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
168 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
169 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
173 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
174 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
175 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
176 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
177 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
178 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
179 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
180 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
181 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
182 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
183 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
184 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
185 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
186 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
187 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
188 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
189 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
190 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
191 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
192 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
193 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
194 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
195 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
196 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
197 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
198 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
199 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
200 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
201 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
202 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
203 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
204 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
205 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
206 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
207 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
208 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
209 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
210 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
211 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
212 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
213 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
214 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
215 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
216 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
231 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
232 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
233 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
238 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
241 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
242 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
243 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
244 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
245 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
246 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
247 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
248 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
249 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
250 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
251 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
252 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
253 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
254 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
255 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
256 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
257 8002775197 Frankia nepalensis CN7 Isolate Nodule
258 8002784119 Frankia sp. AgB1.9 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.41
Metatranscriptomes 0
Isolates 0.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.45
Nodule 0.59
Rhizoplane 10.61
Rhizosphere 67.78
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga03n38_125731_c1 3300050490 Bacteria 1265
2 JGI24743J22301_10044200 3300001991 Bacteria 899
3 JGI24748J21848_1049068 3300002074 Bacteria 549
4 JGI24738J21930_10088053 3300002075 Bacteria 655
5 Ga0065704_10480297 3300005289 Bacteria 675
6 Ga0070658_10502721 3300005327 Bacteria 1047
7 Ga0070676_10217189 3300005328 Bacteria 1261
8 Ga0070690_101580211 3300005330 Bacteria 531
9 Ga0068869_100286641 3300005334 Bacteria 1326
10 Ga0068869_100940971 3300005334 Bacteria 750
11 Ga0070682_100437884 3300005337 Bacteria 998
12 Ga0068868_100102959 3300005338 Bacteria 2312
13 Ga0068868_101023898 3300005338 Bacteria 756
14 Ga0070660_100244281 3300005339 Bacteria 1463
15 Ga0070660_100277096 3300005339 Bacteria 1372
16 Ga0070689_101077033 3300005340 Bacteria 718
17 Ga0070691_10256977 3300005341 Bacteria 939
18 Ga0070687_101064629 3300005343 Bacteria 590
19 Ga0070692_10566852 3300005345 Bacteria 746
20 Ga0070668_100000498 3300005347 Bacteria 25961
21 Ga0070668_100045578 3300005347 Bacteria 3364
22 Ga0070668_100541689 3300005347 Bacteria 1012
23 Ga0070669_100241626 3300005353 Bacteria 1435
24 Ga0070675_100404111 3300005354 Bacteria 1219
25 Ga0070671_100012758 3300005355 Bacteria 6776
26 Ga0070671_100420925 3300005355 Bacteria 1144
27 Ga0070674_100075541 3300005356 Bacteria 2393
28 Ga0070674_100317342 3300005356 Bacteria 1248
29 Ga0070673_100123980 3300005364 Bacteria 2159
30 Ga0070659_100686002 3300005366 Bacteria 885
31 Ga0070667_100230471 3300005367 Bacteria 1651
32 Ga0070667_100259532 3300005367 Bacteria 1555
33 Ga0070667_101711268 3300005367 Bacteria 591
34 Ga0070714_100237396 3300005435 Bacteria 1682
35 Ga0070714_100861165 3300005435 Bacteria 879
36 Ga0070713_101436144 3300005436 Bacteria 669
37 Ga0070710_10045694 3300005437 Bacteria 2436
38 Ga0070711_100086000 3300005439 Bacteria 2254
39 Ga0070711_101748537 3300005439 Bacteria 545
40 Ga0070700_100497845 3300005441 Bacteria 937
41 Ga0070694_100670110 3300005444 Bacteria 841
42 Ga0070663_100015034 3300005455 Bacteria 4981
43 Ga0070663_100324686 3300005455 Bacteria 1239
44 Ga0070663_100551103 3300005455 Bacteria 964
45 Ga0070663_100708935 3300005455 Bacteria 856
46 Ga0070678_100102041 3300005456 Bacteria 2225
47 Ga0070678_100591188 3300005456 Bacteria 990
48 Ga0070678_101105051 3300005456 Bacteria 732
49 Ga0070662_100249003 3300005457 Bacteria 1428
50 Ga0068867_101974608 3300005459 Bacteria 551
51 Ga0070685_10503695 3300005466 Bacteria 857
52 Ga0070685_11141982 3300005466 Bacteria 590
53 Ga0070698_100819085 3300005471 Bacteria 875
54 Ga0070684_100369616 3300005535 Bacteria 1320
55 Ga0070686_100383745 3300005544 Bacteria 1064
56 Ga0070686_100687854 3300005544 Bacteria 814
57 Ga0070695_100853673 3300005545 Bacteria 733
58 Ga0070696_100471993 3300005546 Bacteria 993
59 Ga0070693_100056963 3300005547 Bacteria 2257
60 Ga0070665_100455275 3300005548 Bacteria 1289
61 Ga0070665_101622237 3300005548 Bacteria 654
62 Ga0070704_100245860 3300005549 Bacteria 1467
63 Ga0068855_100846243 3300005563 Bacteria 970
64 Ga0070664_100228811 3300005564 Bacteria 1666
65 Ga0068854_100217006 3300005578 Bacteria 1511
66 Ga0070702_100071438 3300005615 Bacteria 2051
67 Ga0070702_100354959 3300005615 Bacteria 1034
68 Ga0068852_100634812 3300005616 Bacteria 1074
69 Ga0068852_100761833 3300005616 Bacteria 980
70 Ga0068859_100651009 3300005617 Bacteria 1146
71 Ga0068864_101493756 3300005618 Bacteria 679
72 Ga0068866_10034038 3300005718 Bacteria 2478
73 Ga0068866_10544046 3300005718 Bacteria 775
74 Ga0068861_100069619 3300005719 Bacteria 2722
75 Ga0068861_100293682 3300005719 Bacteria 1404
76 Ga0068870_10256449 3300005840 Bacteria 1086
77 Ga0068863_100408786 3300005841 Bacteria 1328
78 Ga0068863_101032708 3300005841 Bacteria 825
79 Ga0068863_101411549 3300005841 Bacteria 704
80 Ga0068863_101518341 3300005841 Bacteria 678
81 Ga0068858_100199608 3300005842 Bacteria 1891
82 Ga0068858_101761108 3300005842 Bacteria 612
83 Ga0068860_100189779 3300005843 Bacteria 1988
84 Ga0068860_101046938 3300005843 Bacteria 835
85 Ga0068862_100175942 3300005844 Bacteria 1919
86 Ga0068862_100364455 3300005844 Bacteria 1344
87 Ga0081540_1286262 3300005983 Bacteria 568
88 Ga0075365_10034538 3300006038 Bacteria 3265
89 Ga0075365_10179225 3300006038 Bacteria 1481
90 Ga0075365_11215883 3300006038 Bacteria 530
91 Ga0075368_10013879 3300006042 Bacteria 2965
92 Ga0075363_100002053 3300006048 Bacteria 8047
93 Ga0075363_100004119 3300006048 Bacteria 6308
94 Ga0075363_100006417 3300006048 Bacteria 5340
95 Ga0075363_100011492 3300006048 Bacteria 4241
96 Ga0075363_100024208 3300006048 Bacteria 3084
97 Ga0075363_100035044 3300006048 Bacteria 2623
98 Ga0075363_100078098 3300006048 Bacteria 1807
99 Ga0075363_100086295 3300006048 Bacteria 1723
100 Ga0075363_100113351 3300006048 Bacteria 1509
101 Ga0075363_100167500 3300006048 Bacteria 1246
102 Ga0075363_100586752 3300006048 Bacteria 667
103 Ga0075364_10000274 3300006051 Bacteria 25135
104 Ga0075364_10004990 3300006051 Bacteria 7695
105 Ga0075364_10014832 3300006051 Bacteria 4821
106 Ga0075364_10018357 3300006051 Bacteria 4377
107 Ga0075364_10021759 3300006051 Bacteria 4042
108 Ga0075364_10024876 3300006051 Bacteria 3807
109 Ga0075364_10044859 3300006051 Bacteria 2877
110 Ga0075364_10060513 3300006051 Bacteria 2483
111 Ga0075364_10123657 3300006051 Bacteria 1733
112 Ga0075364_10306499 3300006051 Bacteria 1081
113 Ga0075364_10432489 3300006051 Bacteria 899
114 Ga0075364_10557415 3300006051 Bacteria 783
115 Ga0075364_11002486 3300006051 Bacteria 568
116 Ga0070715_10942792 3300006163 Bacteria 534
117 Ga0070716_100083564 3300006173 Bacteria 1912
118 Ga0070712_100129886 3300006175 Bacteria 1908
119 Ga0070712_100304091 3300006175 Bacteria 1292
120 Ga0070712_101633082 3300006175 Bacteria 564
121 Ga0075362_10075630 3300006177 Bacteria 1545
122 Ga0075362_10122414 3300006177 Bacteria 1232
123 Ga0075362_10626590 3300006177 Bacteria 557
124 Ga0075362_10726444 3300006177 Bacteria 519
125 Ga0075367_10060509 3300006178 Bacteria 2258
126 Ga0075367_10500751 3300006178 Bacteria 771
127 Ga0075369_10000964 3300006186 Bacteria 9569
128 Ga0075369_10001768 3300006186 Bacteria 7508
129 Ga0075369_10005641 3300006186 Bacteria 4689
130 Ga0075369_10017927 3300006186 Bacteria 2877
131 Ga0075369_10145399 3300006186 Bacteria 1082
132 Ga0075369_10152759 3300006186 Bacteria 1056
133 Ga0075369_10480546 3300006186 Bacteria 590
134 Ga0075369_10544199 3300006186 Bacteria 554
135 Ga0097621_100547700 3300006237 Bacteria 1053
136 Ga0075370_10006528 3300006353 Bacteria 5872
137 Ga0075370_10020812 3300006353 Bacteria 3589
138 Ga0075370_10052330 3300006353 Bacteria 2316
139 Ga0075428_100004586 3300006844 Bacteria 15280
140 Ga0075430_100010053 3300006846 Bacteria 8006
141 Ga0075434_102069304 3300006871 Bacteria 574
142 Ga0097620_100651017 3300006931 Bacteria 1146
143 Ga0105250_10139040 3300009092 Bacteria 1006
144 Ga0105240_10085569 3300009093 Bacteria 3862
145 Ga0105240_10225209 3300009093 Bacteria 2182
146 Ga0105240_12297774 3300009093 Bacteria 559
147 Ga0111539_12885160 3300009094 Bacteria 556
148 Ga0105245_10065385 3300009098 Bacteria 3289
149 Ga0105245_11214393 3300009098 Bacteria 802
150 Ga0105247_10037007 3300009101 Bacteria 2976
151 Ga0105247_10510552 3300009101 Bacteria 877
152 Ga0105247_10514413 3300009101 Bacteria 874
153 Ga0114129_10013266 3300009147 Bacteria 11737
154 Ga0105243_10057697 3300009148 Bacteria 3092
155 Ga0105243_10897940 3300009148 Bacteria 881
156 Ga0105241_10385816 3300009174 Bacteria 1225
157 Ga0105242_10551262 3300009176 Bacteria 1105
158 Ga0105242_10914128 3300009176 Bacteria 879
159 Ga0105248_10045736 3300009177 Bacteria 4907
160 Ga0105248_10103280 3300009177 Bacteria 3213
161 Ga0105248_10696774 3300009177 Bacteria 1146
162 Ga0105237_10523601 3300009545 Bacteria 1192
163 Ga0105238_10116813 3300009551 Bacteria 2648
164 Ga0105238_12559269 3300009551 Bacteria 546
165 Ga0105249_10011782 3300009553 Bacteria 7687
166 Ga0105249_11521259 3300009553 Bacteria 741
167 Ga0105239_10044136 3300010375 Bacteria 4887
168 Ga0105239_10391072 3300010375 Bacteria 1573
169 Ga0105239_11728883 3300010375 Bacteria 724
170 Ga0105239_12769207 3300010375 Bacteria 572
171 Ga0105239_13051103 3300010375 Bacteria 546
172 Ga0105246_10059519 3300011119 Bacteria 2650
173 Ga0157338_1045741 3300012515 Bacteria 611
174 Ga0157371_11410338 3300013102 Bacteria 541
175 Ga0157374_10032029 3300013296 Bacteria 4784
176 Ga0157374_10927947 3300013296 Bacteria 889
177 Ga0157374_12806705 3300013296 Bacteria 515
178 Ga0157378_10389649 3300013297 Bacteria 1370
179 Ga0163162_10676492 3300013306 Bacteria 1155
180 Ga0157372_10361304 3300013307 Bacteria 1692
181 Ga0157375_10074218 3300013308 Bacteria 3422
182 Ga0157375_10250126 3300013308 Bacteria 1933
183 Ga0163163_10414858 3300014325 Bacteria 1405
184 Ga0157380_10111005 3300014326 Bacteria 2304
185 Ga0157380_12594956 3300014326 Bacteria 573
186 Ga0182008_10327219 3300014497 Bacteria 808
187 Ga0157377_10510253 3300014745 Bacteria 842
188 Ga0157379_10266839 3300014968 Bacteria 1556
189 Ga0157379_10411906 3300014968 Bacteria 1244
190 Ga0163161_10031085 3300017792 Bacteria 3802
191 Ga0163161_10059637 3300017792 Bacteria 2775
192 Ga0163161_10944824 3300017792 Bacteria 733
193 Ga0213876_10021889 3300021384 Bacteria 3382
194 Ga0213875_10013973 3300021388 Bacteria 3927
195 Ga0207697_10200160 3300025315 Bacteria 878
196 Ga0207692_10764320 3300025898 Bacteria 630
197 Ga0207692_10858546 3300025898 Bacteria 596
198 Ga0207642_10238031 3300025899 Bacteria 1026
199 Ga0207642_10373558 3300025899 Bacteria 847
200 Ga0207710_10257304 3300025900 Bacteria 874
201 Ga0207710_10666264 3300025900 Bacteria 545
202 Ga0207710_10684668 3300025900 Bacteria 538
203 Ga0207688_10005289 3300025901 Bacteria 7014
204 Ga0207688_10307432 3300025901 Bacteria 970
205 Ga0207680_10982510 3300025903 Bacteria 605
206 Ga0207643_10094497 3300025908 Bacteria 1746
207 Ga0207693_10179504 3300025915 Bacteria 1666
208 Ga0207693_10360067 3300025915 Bacteria 1138
209 Ga0207663_10171981 3300025916 Bacteria 1540
210 Ga0207662_10218214 3300025918 Bacteria 1241
211 Ga0207657_10127939 3300025919 Bacteria 2084
212 Ga0207657_11100209 3300025919 Bacteria 607
213 Ga0207681_11444110 3300025923 Bacteria 577
214 Ga0207694_10487423 3300025924 Bacteria 1031
215 Ga0207694_11249459 3300025924 Bacteria 628
216 Ga0207650_11340388 3300025925 Bacteria 609
217 Ga0207659_10672961 3300025926 Bacteria 885
218 Ga0207687_10367653 3300025927 Bacteria 1175
219 Ga0207664_10286992 3300025929 Bacteria 1445
220 Ga0207664_10703380 3300025929 Bacteria 909
221 Ga0207644_10011455 3300025931 Bacteria 5868
222 Ga0207644_10267372 3300025931 Bacteria 1369
223 Ga0207644_10728524 3300025931 Bacteria 828
224 Ga0207690_11003740 3300025932 Bacteria 694
225 Ga0207706_10015354 3300025933 Bacteria 6920
226 Ga0207686_10135052 3300025934 Bacteria 1697
227 Ga0207686_10331763 3300025934 Bacteria 1140
228 Ga0207709_10679138 3300025935 Bacteria 822
229 Ga0207709_10805036 3300025935 Bacteria 759
230 Ga0207670_10841378 3300025936 Bacteria 766
231 Ga0207669_10160744 3300025937 Bacteria 1586
232 Ga0207704_11180286 3300025938 Bacteria 652
233 Ga0207665_10003291 3300025939 Bacteria 10819
234 Ga0207691_10517462 3300025940 Bacteria 1013
235 Ga0207711_10033046 3300025941 Bacteria 4376
236 Ga0207711_11752177 3300025941 Bacteria 564
237 Ga0207689_10083701 3300025942 Bacteria 2623
238 Ga0207679_10171015 3300025945 Bacteria 1789
239 Ga0207667_10527253 3300025949 Bacteria 1196
240 Ga0207651_10907163 3300025960 Bacteria 785
241 Ga0207651_10952738 3300025960 Bacteria 766
242 Ga0207712_10079126 3300025961 Bacteria 2387
243 Ga0207712_11269915 3300025961 Bacteria 658
244 Ga0207668_10000640 3300025972 Bacteria 21592
245 Ga0207668_10083463 3300025972 Bacteria 2325
246 Ga0207668_10415125 3300025972 Bacteria 1141
247 Ga0207668_10585246 3300025972 Bacteria 971
248 Ga0207640_10280704 3300025981 Bacteria 1308
249 Ga0207658_10524133 3300025986 Bacteria 1058
250 Ga0207658_10580418 3300025986 Bacteria 1005
251 Ga0207658_10726472 3300025986 Bacteria 898
252 Ga0207658_11001206 3300025986 Bacteria 762
253 Ga0207658_11046658 3300025986 Bacteria 745
254 Ga0207677_10060854 3300026023 Bacteria 2612
255 Ga0207703_10624305 3300026035 Bacteria 1021
256 Ga0207703_10998167 3300026035 Bacteria 803
257 Ga0207703_11284766 3300026035 Bacteria 704
258 Ga0207703_12427631 3300026035 Bacteria 500
259 Ga0207678_10023579 3300026067 Bacteria 5381
260 Ga0207678_10352573 3300026067 Bacteria 1269
261 Ga0207678_10373769 3300026067 Bacteria 1231
262 Ga0207678_11535241 3300026067 Bacteria 587
263 Ga0207708_10155413 3300026075 Bacteria 1804
264 Ga0207708_10442190 3300026075 Bacteria 1081
265 Ga0207641_10020337 3300026088 Bacteria 5451
266 Ga0207641_10541696 3300026088 Bacteria 1134
267 Ga0207641_10769407 3300026088 Bacteria 951
268 Ga0207641_12130506 3300026088 Bacteria 561
269 Ga0207648_10009874 3300026089 Bacteria 9098
270 Ga0207676_10117524 3300026095 Bacteria 2237
271 Ga0207676_11186968 3300026095 Bacteria 756
272 Ga0207675_100024561 3300026118 Bacteria 5603
273 Ga0207675_100155246 3300026118 Bacteria 2181
274 Ga0207675_100653519 3300026118 Bacteria 1058
275 Ga0207683_10010085 3300026121 Bacteria 8060
276 Ga0207683_10527725 3300026121 Bacteria 1091
277 Ga0207698_11326571 3300026142 Bacteria 734
278 Ga0209813_10009643 3300027866 Bacteria 2477
279 Ga0209813_10097818 3300027866 Bacteria 994
280 Ga0268266_10009370 3300028379 Bacteria 8629
281 Ga0268266_10352969 3300028379 Bacteria 1382
282 Ga0268266_11573978 3300028379 Bacteria 633
283 Ga0268265_10609795 3300028380 Bacteria 1044
284 Ga0268265_10713503 3300028380 Bacteria 970
285 Ga0268265_11333623 3300028380 Bacteria 718
286 Ga0268264_10309413 3300028381 Bacteria 1490
287 Ga0268264_12208577 3300028381 Bacteria 558
288 Ga0316578_10748631 3300031728 Bacteria 568
289 Ga0307413_10335885 3300031824 Bacteria 1160
290 Ga0307410_10654064 3300031852 Bacteria 882
291 Ga0307407_10847559 3300031903 Bacteria 698
292 Ga0307412_10981561 3300031911 Bacteria 745
293 Ga0307414_11020402 3300032004 Bacteria 762
294 Ga0373930_0113677 3300034816 Bacteria 654
295 Ga0373929_0217850 3300035085 Bacteria 542
296 Ga0373949_0257967 3300035090 Bacteria 541
297 Ga0373939_0071963 3300035114 Bacteria 1128
298 Ga0373946_0242091 3300035171 Bacteria 877
299 Ga0373942_0171943 3300035207 Bacteria 706
300 Ga0373947_0450166 3300035725 Bacteria 872
301 Ga0316584_0417791 3300036712 Bacteria 953
302 Ga0373925_1714506 3300037068 Bacteria 513
303 Ga0436364_1113621 3300037853 Bacteria 7802
304 Ga0436365_0286002 3300039437 Bacteria 9387
305 Ga0436363_0956992 3300039450 Bacteria 1742
306 Ga0436363_1335863 3300039450 Bacteria 543
307 Ga0439461_0040553 3300041410 Bacteria 1004
308 Ga0439461_0046754 3300041410 Bacteria 949
309 Ga0439466_0033538 3300041411 Bacteria 1744
310 Ga0439465_0006862 3300041413 Bacteria 3615
311 Ga0439465_0016619 3300041413 Bacteria 2295
312 Ga0439465_0182708 3300041413 Bacteria 759
313 Ga0451789_1109387 3300041443 Bacteria 513
314 Ga0451798_0077828 3300041458 Bacteria 513
315 Ga0451798_0539690 3300041458 Bacteria 629
316 Ga0451800_1165231 3300041459 Bacteria 536
317 Ga0451804_0390908 3300041463 Bacteria 816
318 Ga0451807_1050556 3300041486 Bacteria 509
319 Ga0439431_0009159 3300041997 Bacteria 2233
320 Ga0439442_038631 3300042002 Bacteria 1000
321 Ga0439445_0003605 3300042004 Bacteria 3471
322 Ga0439445_0122462 3300042004 Bacteria 747
323 Ga0439450_034436 3300042008 Bacteria 1152
324 Ga0439446_0017059 3300042156 Bacteria 2027
325 Ga0439434_0064408 3300042435 Bacteria 1149
326 Ga0439459_0246524 3300042438 Bacteria 503
327 Ga0466972_0000267 3300044658 Bacteria 33125
328 Ga0466972_0008573 3300044658 Bacteria 5131
329 Ga0466972_0016120 3300044658 Bacteria 3735
330 Ga0466972_0049361 3300044658 Bacteria 2032
331 Ga0466972_0074550 3300044658 Bacteria 1617
332 Ga0466965_0000153 3300044683 Bacteria 20532
333 Ga0466965_0002928 3300044683 Bacteria 7379
334 Ga0466965_0028001 3300044683 Bacteria 2736
335 Ga0466965_0042875 3300044683 Bacteria 2233
336 Ga0466965_0328748 3300044683 Bacteria 834
337 Ga0466965_0918107 3300044683 Bacteria 511
338 Ga0466966_0010639 3300044684 Bacteria 6117
339 Ga0466961_0261916 3300044693 Bacteria 1060
340 Ga0466963_0403384 3300044694 Bacteria 964
341 Ga0466964_0008737 3300044706 Bacteria 3808
342 Ga0466964_0017915 3300044706 Bacteria 2714
343 Ga0466964_0202641 3300044706 Bacteria 953
344 Ga0466971_0014350 3300044719 Bacteria 3486
345 Ga0466968_0001239 3300044735 Bacteria 9062
346 Ga0466968_0002890 3300044735 Bacteria 6349
347 Ga0466968_0118917 3300044735 Bacteria 1194
348 Ga0466968_0143220 3300044735 Bacteria 1094
349 Ga0466970_0000690 3300044765 Bacteria 16514
350 Ga0466970_0005008 3300044765 Bacteria 6545
351 Ga0466970_0024518 3300044765 Bacteria 3155
352 Ga0466970_0028425 3300044765 Bacteria 2938
353 Ga0466970_0283803 3300044765 Bacteria 931
354 Ga0466957_0015448 3300044842 Bacteria 4459
355 Ga0466957_0076109 3300044842 Bacteria 2083
356 Ga0466957_0263928 3300044842 Bacteria 1148
357 Ga0466957_0575688 3300044842 Bacteria 787
358 Ga0466960_0002488 3300044901 Bacteria 6933
359 Ga0466960_0074649 3300044901 Bacteria 1695
360 Ga0466960_0115986 3300044901 Bacteria 1397
361 Ga0466960_0285774 3300044901 Bacteria 926
362 Ga0466959_0000292 3300045049 Bacteria 30202
363 Ga0466959_0012547 3300045049 Bacteria 6127
364 Ga0466959_0051453 3300045049 Bacteria 3021
365 Ga0466959_0086833 3300045049 Bacteria 2250
366 Ga0466958_0007717 3300045836 Bacteria 5935
367 Ga0466958_0283421 3300045836 Bacteria 1062
368 Ga0466967_0000991 3300045976 Bacteria 15454
369 Ga0466967_0112706 3300045976 Bacteria 2501
370 Ga0466967_0283027 3300045976 Bacteria 1591
371 Ga0466967_0294661 3300045976 Bacteria 1559
372 Ga0466967_0310680 3300045976 Bacteria 1518
373 Ga0466967_0606466 3300045976 Bacteria 1081
374 Ga0466967_1892790 3300045976 Bacteria 593
375 Ga0466967_2446866 3300045976 Bacteria 517
376 Ga0495629_0008706 3300046459 Bacteria 7468
377 Ga0495638_0000427 3300046460 Bacteria 50873
378 Ga0495582_0142663 3300046473 Bacteria 1358
379 Ga0495630_0053217 3300046517 Bacteria 3031
380 Ga0495666_0102620 3300046526 Bacteria 1347
381 Ga0495656_0767298 3300046615 Bacteria 520
382 Ga0495625_0597785 3300046660 Bacteria 663
383 Ga0495649_0345272 3300046694 Bacteria 753
384 Ga0495672_0151787 3300047320 Bacteria 1201
385 Ga0495672_0449481 3300047320 Bacteria 581
386 Ga0495676_0165290 3300047321 Bacteria 1562
387 Ga0495683_0434726 3300047323 Bacteria 541
388 Ga0495686_0002803 3300047472 Bacteria 15820
389 Ga0495686_0401317 3300047472 Bacteria 736
390 Ga0495626_0064609 3300048091 Bacteria 1658
391 Ga0496100_0000202 3300048903 Bacteria 32795
392 Ga0496100_0846897 3300048903 Bacteria 717
393 Ga0496100_0967677 3300048903 Bacteria 669
394 Ga0496101_0000285 3300048904 Bacteria 35438
395 Ga0496102_0045472 3300048905 Bacteria 3986
396 Ga0496102_0045764 3300048905 Bacteria 3973
397 Ga0496102_0224893 3300048905 Bacteria 1769
398 Ga0496102_0425801 3300048905 Bacteria 1247
399 Ga0496103_0099280 3300048906 Bacteria 1842
400 Ga0496103_0472900 3300048906 Bacteria 803
401 Ga0496104_0002749 3300048907 Bacteria 15145
402 Ga0496104_0061398 3300048907 Bacteria 3564
403 Ga0496104_0272280 3300048907 Bacteria 1606
404 Ga0496104_0287562 3300048907 Bacteria 1556
405 Ga0496104_0289595 3300048907 Bacteria 1550
406 Ga0496105_0014029 3300048908 Bacteria 6375
407 Ga0496105_0025081 3300048908 Bacteria 4849
408 Ga0496105_0244231 3300048908 Bacteria 1456
409 Ga0496105_0842650 3300048908 Bacteria 694
410 Ga0496106_0001563 3300048909 Bacteria 17234
411 Ga0496106_0203942 3300048909 Bacteria 1574
412 Ga0496107_0013427 3300048910 Bacteria 5726
413 Ga0496108_0000759 3300048911 Bacteria 25117
414 Ga0496108_0038463 3300048911 Bacteria 3986
415 Ga0496108_0268642 3300048911 Bacteria 1484
416 Ga0496109_0010589 3300048912 Bacteria 7887
417 Ga0496109_0012962 3300048912 Bacteria 7208
418 Ga0496109_0049393 3300048912 Bacteria 3830
419 Ga0496109_0120669 3300048912 Bacteria 2442
420 Ga0496110_0378182 3300048913 Bacteria 1290
421 Ga0496110_1394766 3300048913 Bacteria 610
422 Ga0496111_0022292 3300048914 Bacteria 4432
423 Ga0496111_0733627 3300048914 Bacteria 717
424 Ga0496111_1231146 3300048914 Bacteria 529
425 Ga0496112_0015965 3300048915 Bacteria 7020
426 Ga0496112_0018952 3300048915 Bacteria 6486
427 Ga0496112_0281786 3300048915 Bacteria 1609
428 Ga0496112_0378676 3300048915 Bacteria 1356
429 Ga0496112_0388322 3300048915 Bacteria 1336
430 Ga0496112_0911148 3300048915 Bacteria 801
431 Ga0496112_1494607 3300048915 Bacteria 589
432 Ga0496113_0026315 3300048916 Bacteria 4158
433 Ga0496113_0092235 3300048916 Bacteria 2336
434 Ga0496113_0225792 3300048916 Bacteria 1493
435 Ga0496113_1421846 3300048916 Bacteria 537
436 Ga0496114_0001795 3300048917 Bacteria 16292
437 Ga0496114_0116391 3300048917 Bacteria 2295
438 Ga0496115_0361051 3300048918 Bacteria 1183
439 Ga0496118_0000194 3300048921 Bacteria 107296
440 Ga0496123_0038604 3300048926 Bacteria 3353
441 Ga0501032_0924065 3300049569 Bacteria 549
442 Ga0501034_0358877 3300049571 Bacteria 1385
443 Ga0501034_0466439 3300049571 Bacteria 1179
444 Ga0501034_1714286 3300049571 Bacteria 501
445 Ga0501043_0275857 3300049579 Bacteria 1290
446 Ga0501047_0666416 3300049581 Bacteria 859
447 Ga0501070_1195239 3300049586 Bacteria 584
448 Ga0501073_1282951 3300049589 Bacteria 502
449 Ga0501044_0599359 3300049823 Bacteria 995
450 nmdc:mga03683_178523_c1 3300050489 Bacteria 968
451 nmdc:mga03n38_19283_c1 3300050490 Bacteria 2708
452 nmdc:mga03n38_28457_c1 3300050490 Bacteria 2330
453 nmdc:mga03n38_363787_c1 3300050490 Bacteria 790
454 nmdc:mga03n38_3946_c1 3300050490 Bacteria 4840
455 nmdc:mga03n38_42461_c1 3300050490 Bacteria 1988
456 nmdc:mga03n38_635180_c1 3300050490 Bacteria 611
457 nmdc:mga03n38_838438_c1 3300050490 Bacteria 537
458 nmdc:mga03n38_852181_c1 3300050490 Bacteria 533
459 nmdc:mga03n38_85306_c1 3300050490 Bacteria 1493
460 nmdc:mga00v17_106290_c1 3300050491 Unclassified 1776
461 nmdc:mga00v17_155520_c1 3300050491 Bacteria 1470
462 nmdc:mga00v17_187379_c1 3300050491 Bacteria 1336
463 nmdc:mga00v17_27728_c1 3300050491 Bacteria 3309
464 nmdc:mga00v17_281845_c1 3300050491 Bacteria 1079
465 nmdc:mga00v17_329_c1 3300050491 Bacteria 26668
466 nmdc:mga00v17_34790_c1 3300050491 Bacteria 2995
467 nmdc:mga00v17_42165_c1 3300050491 Bacteria 2743
468 nmdc:mga00v17_74381_c1 3300050491 Bacteria 2111
469 nmdc:mga00v17_81225_c1 3300050491 Bacteria 2024
470 nmdc:mga00v17_94222_c1 3300050491 Bacteria 1884
471 nmdc:mga0yw44_110118_c1 3300050492 Bacteria 1764
472 nmdc:mga0yw44_200402_c1 3300050492 Bacteria 1318
473 nmdc:mga0yw44_288195_c1 3300050492 Bacteria 1098
474 nmdc:mga0yw44_552325_c1 3300050492 Bacteria 782
475 nmdc:mga0yw44_90110_c1 3300050492 Bacteria 1937
476 nmdc:mga06z11_105467_c1 3300050494 Bacteria 1553
477 nmdc:mga06z11_39575_c1 3300050494 Bacteria 2347
478 nmdc:mga04h51_10572_c1 3300050495 Bacteria 2538
479 nmdc:mga07m45_12222_c1 3300050496 Bacteria 4037
480 nmdc:mga07m45_51489_c1 3300050496 Bacteria 2322
481 nmdc:mga07m45_77301_c1 3300050496 Bacteria 1898
482 nmdc:mga07m45_852035_c1 3300050496 Bacteria 522
483 nmdc:mga05p37_11463_c2 3300050507 Bacteria 9020
484 nmdc:mga0qj67_39979_c1 3300050509 Bacteria 3685
485 nmdc:mga08y16_1329601_c1 3300050511 Bacteria 684
486 nmdc:mga08y16_1818725_c1 3300050511 Bacteria 562
487 nmdc:mga0sz30_139220_c1 3300050516 Bacteria 1071
488 nmdc:mga0sz30_1889_c1 3300050516 Bacteria 7469
489 nmdc:mga0sz30_190308_c1 3300050516 Bacteria 911
490 nmdc:mga0sz30_2495_c1 3300050516 Bacteria 6557
491 nmdc:mga0sz30_2984_c1 3300050516 Bacteria 6071
492 nmdc:mga0sz30_319774_c1 3300050516 Bacteria 693
493 nmdc:mga0sz30_7668_c1 3300050516 Bacteria 4052
494 nmdc:mga0sz30_977_c1 3300050516 Bacteria 10267
495 Ga0495655_0079170 3300053083 Bacteria 936
496 Ga0500583_0094787 3300053092 Bacteria 1456
497 Ga0500556_0249137 3300053104 Bacteria 699
498 Ga0500569_246528 3300053109 Bacteria 606
499 Ga0500568_0092917 3300053139 Bacteria 1137
500 Ga0500616_0056311 3300053153 Bacteria 2053
501 Ga0466962_0023504 3300061719 Bacteria 2962
502 8002781014 8002775197 Bacteria 10728764
503 8002783593 8002775197 Bacteria 10728764
504 8002786714 8002784119 Bacteria 9788632
505 nmdc:mga03n38_125731_c1
506 JGI24743J22301_10044200
507 JGI24748J21848_1049068
508 JGI24738J21930_10088053
509 Ga0065704_10480297
510 Ga0070658_10502721
511 Ga0070676_10217189
512 Ga0070690_101580211
513 Ga0068869_100286641
514 Ga0068869_100940971
515 Ga0070682_100437884
516 Ga0068868_100102959
517 Ga0068868_101023898
518 Ga0070660_100244281
519 Ga0070660_100277096
520 Ga0070689_101077033
521 Ga0070691_10256977
522 Ga0070687_101064629
523 Ga0070692_10566852
524 Ga0070668_100000498
525 Ga0070668_100045578
526 Ga0070668_100541689
527 Ga0070669_100241626
528 Ga0070675_100404111
529 Ga0070671_100012758
530 Ga0070671_100420925
531 Ga0070674_100075541
532 Ga0070674_100317342
533 Ga0070673_100123980
534 Ga0070659_100686002
535 Ga0070667_100230471
536 Ga0070667_100259532
537 Ga0070667_101711268
538 Ga0070714_100237396
539 Ga0070714_100861165
540 Ga0070713_101436144
541 Ga0070710_10045694
542 Ga0070711_100086000
543 Ga0070711_101748537
544 Ga0070700_100497845
545 Ga0070694_100670110
546 Ga0070663_100015034
547 Ga0070663_100324686
548 Ga0070663_100551103
549 Ga0070663_100708935
550 Ga0070678_100102041
551 Ga0070678_100591188
552 Ga0070678_101105051
553 Ga0070662_100249003
554 Ga0068867_101974608
555 Ga0070685_10503695
556 Ga0070685_11141982
557 Ga0070698_100819085
558 Ga0070684_100369616
559 Ga0070686_100383745
560 Ga0070686_100687854
561 Ga0070695_100853673
562 Ga0070696_100471993
563 Ga0070693_100056963
564 Ga0070665_100455275
565 Ga0070665_101622237
566 Ga0070704_100245860
567 Ga0068855_100846243
568 Ga0070664_100228811
569 Ga0068854_100217006
570 Ga0070702_100071438
571 Ga0070702_100354959
572 Ga0068852_100634812
573 Ga0068852_100761833
574 Ga0068859_100651009
575 Ga0068864_101493756
576 Ga0068866_10034038
577 Ga0068866_10544046
578 Ga0068861_100069619
579 Ga0068861_100293682
580 Ga0068870_10256449
581 Ga0068863_100408786
582 Ga0068863_101032708
583 Ga0068863_101411549
584 Ga0068863_101518341
585 Ga0068858_100199608
586 Ga0068858_101761108
587 Ga0068860_100189779
588 Ga0068860_101046938
589 Ga0068862_100175942
590 Ga0068862_100364455
591 Ga0081540_1286262
592 Ga0075365_10034538
593 Ga0075365_10179225
594 Ga0075365_11215883
595 Ga0075368_10013879
596 Ga0075363_100002053
597 Ga0075363_100004119
598 Ga0075363_100006417
599 Ga0075363_100011492
600 Ga0075363_100024208
601 Ga0075363_100035044
602 Ga0075363_100078098
603 Ga0075363_100086295
604 Ga0075363_100113351
605 Ga0075363_100167500
606 Ga0075363_100586752
607 Ga0075364_10000274
608 Ga0075364_10004990
609 Ga0075364_10014832
610 Ga0075364_10018357
611 Ga0075364_10021759
612 Ga0075364_10024876
613 Ga0075364_10044859
614 Ga0075364_10060513
615 Ga0075364_10123657
616 Ga0075364_10306499
617 Ga0075364_10432489
618 Ga0075364_10557415
619 Ga0075364_11002486
620 Ga0070715_10942792
621 Ga0070716_100083564
622 Ga0070712_100129886
623 Ga0070712_100304091
624 Ga0070712_101633082
625 Ga0075362_10075630
626 Ga0075362_10122414
627 Ga0075362_10626590
628 Ga0075362_10726444
629 Ga0075367_10060509
630 Ga0075367_10500751
631 Ga0075369_10000964
632 Ga0075369_10001768
633 Ga0075369_10005641
634 Ga0075369_10017927
635 Ga0075369_10145399
636 Ga0075369_10152759
637 Ga0075369_10480546
638 Ga0075369_10544199
639 Ga0097621_100547700
640 Ga0075370_10006528
641 Ga0075370_10020812
642 Ga0075370_10052330
643 Ga0075428_100004586
644 Ga0075430_100010053
645 Ga0075434_102069304
646 Ga0097620_100651017
647 Ga0105250_10139040
648 Ga0105240_10085569
649 Ga0105240_10225209
650 Ga0105240_12297774
651 Ga0111539_12885160
652 Ga0105245_10065385
653 Ga0105245_11214393
654 Ga0105247_10037007
655 Ga0105247_10510552
656 Ga0105247_10514413
657 Ga0114129_10013266
658 Ga0105243_10057697
659 Ga0105243_10897940
660 Ga0105241_10385816
661 Ga0105242_10551262
662 Ga0105242_10914128
663 Ga0105248_10045736
664 Ga0105248_10103280
665 Ga0105248_10696774
666 Ga0105237_10523601
667 Ga0105238_10116813
668 Ga0105238_12559269
669 Ga0105249_10011782
670 Ga0105249_11521259
671 Ga0105239_10044136
672 Ga0105239_10391072
673 Ga0105239_11728883
674 Ga0105239_12769207
675 Ga0105239_13051103
676 Ga0105246_10059519
677 Ga0157338_1045741
678 Ga0157371_11410338
679 Ga0157374_10032029
680 Ga0157374_10927947
681 Ga0157374_12806705
682 Ga0157378_10389649
683 Ga0163162_10676492
684 Ga0157372_10361304
685 Ga0157375_10074218
686 Ga0157375_10250126
687 Ga0163163_10414858
688 Ga0157380_10111005
689 Ga0157380_12594956
690 Ga0182008_10327219
691 Ga0157377_10510253
692 Ga0157379_10266839
693 Ga0157379_10411906
694 Ga0163161_10031085
695 Ga0163161_10059637
696 Ga0163161_10944824
697 Ga0213876_10021889
698 Ga0213875_10013973
699 Ga0207697_10200160
700 Ga0207692_10764320
701 Ga0207692_10858546
702 Ga0207642_10238031
703 Ga0207642_10373558
704 Ga0207710_10257304
705 Ga0207710_10666264
706 Ga0207710_10684668
707 Ga0207688_10005289
708 Ga0207688_10307432
709 Ga0207680_10982510
710 Ga0207643_10094497
711 Ga0207693_10179504
712 Ga0207693_10360067
713 Ga0207663_10171981
714 Ga0207662_10218214
715 Ga0207657_10127939
716 Ga0207657_11100209
717 Ga0207681_11444110
718 Ga0207694_10487423
719 Ga0207694_11249459
720 Ga0207650_11340388
721 Ga0207659_10672961
722 Ga0207687_10367653
723 Ga0207664_10286992
724 Ga0207664_10703380
725 Ga0207644_10011455
726 Ga0207644_10267372
727 Ga0207644_10728524
728 Ga0207690_11003740
729 Ga0207706_10015354
730 Ga0207686_10135052
731 Ga0207686_10331763
732 Ga0207709_10679138
733 Ga0207709_10805036
734 Ga0207670_10841378
735 Ga0207669_10160744
736 Ga0207704_11180286
737 Ga0207665_10003291
738 Ga0207691_10517462
739 Ga0207711_10033046
740 Ga0207711_11752177
741 Ga0207689_10083701
742 Ga0207679_10171015
743 Ga0207667_10527253
744 Ga0207651_10907163
745 Ga0207651_10952738
746 Ga0207712_10079126
747 Ga0207712_11269915
748 Ga0207668_10000640
749 Ga0207668_10083463
750 Ga0207668_10415125
751 Ga0207668_10585246
752 Ga0207640_10280704
753 Ga0207658_10524133
754 Ga0207658_10580418
755 Ga0207658_10726472
756 Ga0207658_11001206
757 Ga0207658_11046658
758 Ga0207677_10060854
759 Ga0207703_10624305
760 Ga0207703_10998167
761 Ga0207703_11284766
762 Ga0207703_12427631
763 Ga0207678_10023579
764 Ga0207678_10352573
765 Ga0207678_10373769
766 Ga0207678_11535241
767 Ga0207708_10155413
768 Ga0207708_10442190
769 Ga0207641_10020337
770 Ga0207641_10541696
771 Ga0207641_10769407
772 Ga0207641_12130506
773 Ga0207648_10009874
774 Ga0207676_10117524
775 Ga0207676_11186968
776 Ga0207675_100024561
777 Ga0207675_100155246
778 Ga0207675_100653519
779 Ga0207683_10010085
780 Ga0207683_10527725
781 Ga0207698_11326571
782 Ga0209813_10009643
783 Ga0209813_10097818
784 Ga0268266_10009370
785 Ga0268266_10352969
786 Ga0268266_11573978
787 Ga0268265_10609795
788 Ga0268265_10713503
789 Ga0268265_11333623
790 Ga0268264_10309413
791 Ga0268264_12208577
792 Ga0316578_10748631
793 Ga0307413_10335885
794 Ga0307410_10654064
795 Ga0307407_10847559
796 Ga0307412_10981561
797 Ga0307414_11020402
798 Ga0373930_0113677
799 Ga0373929_0217850
800 Ga0373949_0257967
801 Ga0373939_0071963
802 Ga0373946_0242091
803 Ga0373942_0171943
804 Ga0373947_0450166
805 Ga0316584_0417791
806 Ga0373925_1714506
807 Ga0436364_1113621
808 Ga0436365_0286002
809 Ga0436363_0956992
810 Ga0436363_1335863
811 Ga0439461_0040553
812 Ga0439461_0046754
813 Ga0439466_0033538
814 Ga0439465_0006862
815 Ga0439465_0016619
816 Ga0439465_0182708
817 Ga0451789_1109387
818 Ga0451798_0077828
819 Ga0451798_0539690
820 Ga0451800_1165231
821 Ga0451804_0390908
822 Ga0451807_1050556
823 Ga0439431_0009159
824 Ga0439442_038631
825 Ga0439445_0003605
826 Ga0439445_0122462
827 Ga0439450_034436
828 Ga0439446_0017059
829 Ga0439434_0064408
830 Ga0439459_0246524
831 Ga0466972_0000267
832 Ga0466972_0008573
833 Ga0466972_0016120
834 Ga0466972_0049361
835 Ga0466972_0074550
836 Ga0466965_0000153
837 Ga0466965_0002928
838 Ga0466965_0028001
839 Ga0466965_0042875
840 Ga0466965_0328748
841 Ga0466965_0918107
842 Ga0466966_0010639
843 Ga0466961_0261916
844 Ga0466963_0403384
845 Ga0466964_0008737
846 Ga0466964_0017915
847 Ga0466964_0202641
848 Ga0466971_0014350
849 Ga0466968_0001239
850 Ga0466968_0002890
851 Ga0466968_0118917
852 Ga0466968_0143220
853 Ga0466970_0000690
854 Ga0466970_0005008
855 Ga0466970_0024518
856 Ga0466970_0028425
857 Ga0466970_0283803
858 Ga0466957_0015448
859 Ga0466957_0076109
860 Ga0466957_0263928
861 Ga0466957_0575688
862 Ga0466960_0002488
863 Ga0466960_0074649
864 Ga0466960_0115986
865 Ga0466960_0285774
866 Ga0466959_0000292
867 Ga0466959_0012547
868 Ga0466959_0051453
869 Ga0466959_0086833
870 Ga0466958_0007717
871 Ga0466958_0283421
872 Ga0466967_0000991
873 Ga0466967_0112706
874 Ga0466967_0283027
875 Ga0466967_0294661
876 Ga0466967_0310680
877 Ga0466967_0606466
878 Ga0466967_1892790
879 Ga0466967_2446866
880 Ga0495629_0008706
881 Ga0495638_0000427
882 Ga0495582_0142663
883 Ga0495630_0053217
884 Ga0495666_0102620
885 Ga0495656_0767298
886 Ga0495625_0597785
887 Ga0495649_0345272
888 Ga0495672_0151787
889 Ga0495672_0449481
890 Ga0495676_0165290
891 Ga0495683_0434726
892 Ga0495686_0002803
893 Ga0495686_0401317
894 Ga0495626_0064609
895 Ga0496100_0000202
896 Ga0496100_0846897
897 Ga0496100_0967677
898 Ga0496101_0000285
899 Ga0496102_0045472
900 Ga0496102_0045764
901 Ga0496102_0224893
902 Ga0496102_0425801
903 Ga0496103_0099280
904 Ga0496103_0472900
905 Ga0496104_0002749
906 Ga0496104_0061398
907 Ga0496104_0272280
908 Ga0496104_0287562
909 Ga0496104_0289595
910 Ga0496105_0014029
911 Ga0496105_0025081
912 Ga0496105_0244231
913 Ga0496105_0842650
914 Ga0496106_0001563
915 Ga0496106_0203942
916 Ga0496107_0013427
917 Ga0496108_0000759
918 Ga0496108_0038463
919 Ga0496108_0268642
920 Ga0496109_0010589
921 Ga0496109_0012962
922 Ga0496109_0049393
923 Ga0496109_0120669
924 Ga0496110_0378182
925 Ga0496110_1394766
926 Ga0496111_0022292
927 Ga0496111_0733627
928 Ga0496111_1231146
929 Ga0496112_0015965
930 Ga0496112_0018952
931 Ga0496112_0281786
932 Ga0496112_0378676
933 Ga0496112_0388322
934 Ga0496112_0911148
935 Ga0496112_1494607
936 Ga0496113_0026315
937 Ga0496113_0092235
938 Ga0496113_0225792
939 Ga0496113_1421846
940 Ga0496114_0001795
941 Ga0496114_0116391
942 Ga0496115_0361051
943 Ga0496118_0000194
944 Ga0496123_0038604
945 Ga0501032_0924065
946 Ga0501034_0358877
947 Ga0501034_0466439
948 Ga0501034_1714286
949 Ga0501043_0275857
950 Ga0501047_0666416
951 Ga0501070_1195239
952 Ga0501073_1282951
953 Ga0501044_0599359
954 nmdc:mga03683_178523_c1
955 nmdc:mga03n38_19283_c1
956 nmdc:mga03n38_28457_c1
957 nmdc:mga03n38_363787_c1
958 nmdc:mga03n38_3946_c1
959 nmdc:mga03n38_42461_c1
960 nmdc:mga03n38_635180_c1
961 nmdc:mga03n38_838438_c1
962 nmdc:mga03n38_852181_c1
963 nmdc:mga03n38_85306_c1
964 nmdc:mga00v17_106290_c1
965 nmdc:mga00v17_155520_c1
966 nmdc:mga00v17_187379_c1
967 nmdc:mga00v17_27728_c1
968 nmdc:mga00v17_281845_c1
969 nmdc:mga00v17_329_c1
970 nmdc:mga00v17_34790_c1
971 nmdc:mga00v17_42165_c1
972 nmdc:mga00v17_74381_c1
973 nmdc:mga00v17_81225_c1
974 nmdc:mga00v17_94222_c1
975 nmdc:mga0yw44_110118_c1
976 nmdc:mga0yw44_200402_c1
977 nmdc:mga0yw44_288195_c1
978 nmdc:mga0yw44_552325_c1
979 nmdc:mga0yw44_90110_c1
980 nmdc:mga06z11_105467_c1
981 nmdc:mga06z11_39575_c1
982 nmdc:mga04h51_10572_c1
983 nmdc:mga07m45_12222_c1
984 nmdc:mga07m45_51489_c1
985 nmdc:mga07m45_77301_c1
986 nmdc:mga07m45_852035_c1
987 nmdc:mga05p37_11463_c2
988 nmdc:mga0qj67_39979_c1
989 nmdc:mga08y16_1329601_c1
990 nmdc:mga08y16_1818725_c1
991 nmdc:mga0sz30_139220_c1
992 nmdc:mga0sz30_1889_c1
993 nmdc:mga0sz30_190308_c1
994 nmdc:mga0sz30_2495_c1
995 nmdc:mga0sz30_2984_c1
996 nmdc:mga0sz30_319774_c1
997 nmdc:mga0sz30_7668_c1
998 nmdc:mga0sz30_977_c1
999 Ga0495655_0079170
1000 Ga0500583_0094787
1001 Ga0500556_0249137
1002 Ga0500569_246528
1003 Ga0500568_0092917
1004 Ga0500616_0056311
1005 Ga0466962_0023504
1006 8002781014
1007 8002783593
1008 8002786714

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lml-assembly5.cif.gz_E crystal structure of the sheath tail protein lin1278 from listeria innocua, northeast structural genomics consortium target lkr115 0.4355 4 91
7yry-assembly1.cif.gz_F f1-atpase of acinetobacter baumannii 0.4214 3 74
1vzg-assembly1.cif.gz_B structure of superoxide reductase bound to ferrocyanide and active site expansion upon x-ray induced photoreduction 0.4207 2 83
1vzg-assembly1.cif.gz_B structure of superoxide reductase bound to ferrocyanide and active site expansion upon x-ray induced photoreduction 0.3465 2 83
3eyq-assembly1.cif.gz_D crystal structure of mj5 fab, a germline antibody variant of anti-human cytomegalovirus antibody 8f9 0.3158 1 85
ID Description Score Start End Superfamily
2ji3C01 Mainly Beta;Single Sheet;Rubrerythrin, domain 2;Desulphoferrodoxin, N-terminal domain 0.9005 57 93 2.20.28.100
1vzgB01 Mainly Beta;Single Sheet;Rubrerythrin, domain 2;Desulphoferrodoxin, N-terminal domain 0.8875 57 93 2.20.28.100
1vzhA01 Mainly Beta;Single Sheet;Rubrerythrin, domain 2;Desulphoferrodoxin, N-terminal domain 0.8781 57 93 2.20.28.100
1vzgB01 Mainly Beta;Single Sheet;Rubrerythrin, domain 2;Desulphoferrodoxin, N-terminal domain 0.8473 57 93 2.20.28.100
2ji3C01 Mainly Beta;Single Sheet;Rubrerythrin, domain 2;Desulphoferrodoxin, N-terminal domain 0.8397 57 93 2.20.28.100
ID Description Score Start End GO Terms
AF-A0A6G3V545-F1-model_v4 deleted 0.999 1 94
AF-A0A6G3V545-F1-model_v4 deleted 0.9885 1 94
AF-A0A100ICX5-F1-model_v4 deleted 0.9857 1 45
AF-A0A1A2NCM2-F1-model_v4 Uncharacterized protein 0.9651 1 100
AF-A0A100ICX5-F1-model_v4 deleted 0.9648 1 45

Map